From 0eacf5ce34c903ed6820c59fb1be0678fcf6eee2 Mon Sep 17 00:00:00 2001 From: "renovate[bot]" <29139614+renovate[bot]@users.noreply.github.com> Date: Mon, 15 Apr 2024 18:59:00 +0000 Subject: [PATCH] =?UTF-8?q?chore(deps):=20update=20=F0=9F=A4=96=20mage=20t?= =?UTF-8?q?ooling=20to=20v0.12.79?= MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit --- go.mod | 20 +- go.sum | 38 +- vendor/atomicgo.dev/cursor/.golangci.yml | 54 +- vendor/atomicgo.dev/cursor/README.md | 476 +- vendor/atomicgo.dev/cursor/area.go | 155 +- vendor/atomicgo.dev/cursor/area_other.go | 13 + vendor/atomicgo.dev/cursor/area_windows.go | 21 + vendor/atomicgo.dev/cursor/cursor.go | 69 +- vendor/atomicgo.dev/cursor/cursor_other.go | 67 + .../atomicgo.dev/cursor/cursor_test_linux.go | 23 +- vendor/atomicgo.dev/cursor/cursor_windows.go | 72 +- vendor/atomicgo.dev/cursor/go.work | 10 + vendor/atomicgo.dev/cursor/utils.go | 92 +- vendor/atomicgo.dev/schedule/.golangci.yml | 53 +- vendor/atomicgo.dev/schedule/README.md | 90 +- vendor/atomicgo.dev/schedule/schedule.go | 4 +- vendor/github.com/gookit/color/color_16.go | 49 +- vendor/github.com/gookit/color/color_256.go | 20 +- vendor/github.com/gookit/color/color_rgb.go | 15 +- vendor/github.com/gookit/color/convert.go | 24 +- vendor/github.com/gookit/color/style.go | 6 +- vendor/github.com/pterm/pterm/.gitignore | 2 +- vendor/github.com/pterm/pterm/.golangci.yml | 1 - vendor/github.com/pterm/pterm/CHANGELOG.md | 1274 --- vendor/github.com/pterm/pterm/README.md | 1988 +++-- vendor/github.com/pterm/pterm/SECURITY.md | 1 - vendor/github.com/pterm/pterm/area_printer.go | 6 + vendor/github.com/pterm/pterm/box_printer.go | 4 +- .../pterm/pterm/bulletlist_printer.go | 16 +- vendor/github.com/pterm/pterm/errors.go | 3 + .../github.com/pterm/pterm/heatmap_printer.go | 744 ++ .../pterm/interactive_confirm_printer.go | 64 +- .../pterm/interactive_continue_printer.go | 37 +- .../pterm/interactive_multiselect_printer.go | 46 +- .../pterm/pterm/interactive_select_printer.go | 63 +- .../pterm/interactive_textinput_printer.go | 137 +- .../pterm/pterm/interface_live_printer.go | 4 + .../pterm/internal/cancelation_signal.go | 13 +- .../github.com/pterm/pterm/internal/exit.go | 14 + .../pterm/pterm/internal/rgb_complementary.go | 5 + .../pterm/pterm/internal/title_in_line.go | 8 +- vendor/github.com/pterm/pterm/logger.go | 23 +- .../pterm/pterm/multi_live_printer.go | 124 + .../github.com/pterm/pterm/panel_printer.go | 2 +- vendor/github.com/pterm/pterm/print.go | 6 +- .../pterm/pterm/progressbar_printer.go | 62 +- vendor/github.com/pterm/pterm/pterm.go | 16 +- vendor/github.com/pterm/pterm/rgb.go | 4 +- vendor/github.com/pterm/pterm/slog_handler.go | 90 + .../github.com/pterm/pterm/spinner_printer.go | 14 +- vendor/github.com/pterm/pterm/theme.go | 6 + .../sys/internal/unsafeheader/unsafeheader.go | 30 - .../golang.org/x/sys/plan9/pwd_go15_plan9.go | 1 - vendor/golang.org/x/sys/plan9/pwd_plan9.go | 1 - vendor/golang.org/x/sys/plan9/race.go | 1 - vendor/golang.org/x/sys/plan9/race0.go | 1 - vendor/golang.org/x/sys/plan9/str.go | 1 - vendor/golang.org/x/sys/plan9/syscall.go | 1 - .../x/sys/plan9/zsyscall_plan9_386.go | 1 - .../x/sys/plan9/zsyscall_plan9_amd64.go | 1 - .../x/sys/plan9/zsyscall_plan9_arm.go | 1 - vendor/golang.org/x/sys/unix/aliases.go | 2 - vendor/golang.org/x/sys/unix/asm_aix_ppc64.s | 1 - vendor/golang.org/x/sys/unix/asm_bsd_386.s | 2 - vendor/golang.org/x/sys/unix/asm_bsd_amd64.s | 2 - vendor/golang.org/x/sys/unix/asm_bsd_arm.s | 2 - vendor/golang.org/x/sys/unix/asm_bsd_arm64.s | 2 - vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s | 2 - .../golang.org/x/sys/unix/asm_bsd_riscv64.s | 2 - vendor/golang.org/x/sys/unix/asm_linux_386.s | 1 - .../golang.org/x/sys/unix/asm_linux_amd64.s | 1 - vendor/golang.org/x/sys/unix/asm_linux_arm.s | 1 - .../golang.org/x/sys/unix/asm_linux_arm64.s | 3 - .../golang.org/x/sys/unix/asm_linux_loong64.s | 3 - .../golang.org/x/sys/unix/asm_linux_mips64x.s | 3 - .../golang.org/x/sys/unix/asm_linux_mipsx.s | 3 - .../golang.org/x/sys/unix/asm_linux_ppc64x.s | 3 - .../golang.org/x/sys/unix/asm_linux_riscv64.s | 2 - .../golang.org/x/sys/unix/asm_linux_s390x.s | 3 - .../x/sys/unix/asm_openbsd_mips64.s | 1 - .../golang.org/x/sys/unix/asm_solaris_amd64.s | 1 - vendor/golang.org/x/sys/unix/asm_zos_s390x.s | 3 - vendor/golang.org/x/sys/unix/cap_freebsd.go | 1 - vendor/golang.org/x/sys/unix/constants.go | 1 - vendor/golang.org/x/sys/unix/dev_aix_ppc.go | 1 - vendor/golang.org/x/sys/unix/dev_aix_ppc64.go | 1 - vendor/golang.org/x/sys/unix/dev_zos.go | 1 - vendor/golang.org/x/sys/unix/dirent.go | 1 - vendor/golang.org/x/sys/unix/endian_big.go | 1 - vendor/golang.org/x/sys/unix/endian_little.go | 1 - vendor/golang.org/x/sys/unix/env_unix.go | 1 - vendor/golang.org/x/sys/unix/epoll_zos.go | 1 - vendor/golang.org/x/sys/unix/fcntl.go | 3 +- .../x/sys/unix/fcntl_linux_32bit.go | 1 - vendor/golang.org/x/sys/unix/fdset.go | 1 - vendor/golang.org/x/sys/unix/fstatfs_zos.go | 1 - vendor/golang.org/x/sys/unix/gccgo.go | 1 - vendor/golang.org/x/sys/unix/gccgo_c.c | 1 - .../x/sys/unix/gccgo_linux_amd64.go | 1 - vendor/golang.org/x/sys/unix/ifreq_linux.go | 1 - vendor/golang.org/x/sys/unix/ioctl_linux.go | 5 + vendor/golang.org/x/sys/unix/ioctl_signed.go | 1 - .../golang.org/x/sys/unix/ioctl_unsigned.go | 1 - vendor/golang.org/x/sys/unix/ioctl_zos.go | 1 - vendor/golang.org/x/sys/unix/mkall.sh | 2 +- vendor/golang.org/x/sys/unix/mkerrors.sh | 52 +- vendor/golang.org/x/sys/unix/mmap_nomremap.go | 13 + vendor/golang.org/x/sys/unix/mremap.go | 52 + vendor/golang.org/x/sys/unix/pagesize_unix.go | 1 - .../golang.org/x/sys/unix/pledge_openbsd.go | 92 +- vendor/golang.org/x/sys/unix/ptrace_darwin.go | 7 - vendor/golang.org/x/sys/unix/ptrace_ios.go | 7 - vendor/golang.org/x/sys/unix/race.go | 1 - vendor/golang.org/x/sys/unix/race0.go | 1 - .../x/sys/unix/readdirent_getdents.go | 1 - .../x/sys/unix/readdirent_getdirentries.go | 1 - vendor/golang.org/x/sys/unix/sockcmsg_unix.go | 1 - .../x/sys/unix/sockcmsg_unix_other.go | 1 - vendor/golang.org/x/sys/unix/syscall.go | 1 - vendor/golang.org/x/sys/unix/syscall_aix.go | 21 +- .../golang.org/x/sys/unix/syscall_aix_ppc.go | 1 - .../x/sys/unix/syscall_aix_ppc64.go | 1 - vendor/golang.org/x/sys/unix/syscall_bsd.go | 17 +- .../golang.org/x/sys/unix/syscall_darwin.go | 236 +- .../x/sys/unix/syscall_darwin_amd64.go | 2 - .../x/sys/unix/syscall_darwin_arm64.go | 2 - .../x/sys/unix/syscall_darwin_libSystem.go | 1 - .../x/sys/unix/syscall_dragonfly.go | 198 - .../x/sys/unix/syscall_dragonfly_amd64.go | 1 - .../golang.org/x/sys/unix/syscall_freebsd.go | 192 - .../x/sys/unix/syscall_freebsd_386.go | 1 - .../x/sys/unix/syscall_freebsd_amd64.go | 1 - .../x/sys/unix/syscall_freebsd_arm.go | 1 - .../x/sys/unix/syscall_freebsd_arm64.go | 1 - .../x/sys/unix/syscall_freebsd_riscv64.go | 1 - vendor/golang.org/x/sys/unix/syscall_hurd.go | 1 - .../golang.org/x/sys/unix/syscall_hurd_386.go | 1 - .../golang.org/x/sys/unix/syscall_illumos.go | 1 - vendor/golang.org/x/sys/unix/syscall_linux.go | 257 +- .../x/sys/unix/syscall_linux_386.go | 1 - .../x/sys/unix/syscall_linux_alarm.go | 2 - .../x/sys/unix/syscall_linux_amd64.go | 3 +- .../x/sys/unix/syscall_linux_amd64_gc.go | 1 - .../x/sys/unix/syscall_linux_arm.go | 1 - .../x/sys/unix/syscall_linux_arm64.go | 3 +- .../golang.org/x/sys/unix/syscall_linux_gc.go | 1 - .../x/sys/unix/syscall_linux_gc_386.go | 1 - .../x/sys/unix/syscall_linux_gc_arm.go | 1 - .../x/sys/unix/syscall_linux_gccgo_386.go | 1 - .../x/sys/unix/syscall_linux_gccgo_arm.go | 1 - .../x/sys/unix/syscall_linux_loong64.go | 3 +- .../x/sys/unix/syscall_linux_mips64x.go | 4 +- .../x/sys/unix/syscall_linux_mipsx.go | 2 - .../x/sys/unix/syscall_linux_ppc.go | 1 - .../x/sys/unix/syscall_linux_ppc64x.go | 2 - .../x/sys/unix/syscall_linux_riscv64.go | 14 +- .../x/sys/unix/syscall_linux_s390x.go | 1 - .../x/sys/unix/syscall_linux_sparc64.go | 1 - .../golang.org/x/sys/unix/syscall_netbsd.go | 272 +- .../x/sys/unix/syscall_netbsd_386.go | 1 - .../x/sys/unix/syscall_netbsd_amd64.go | 1 - .../x/sys/unix/syscall_netbsd_arm.go | 1 - .../x/sys/unix/syscall_netbsd_arm64.go | 1 - .../golang.org/x/sys/unix/syscall_openbsd.go | 119 +- .../x/sys/unix/syscall_openbsd_386.go | 1 - .../x/sys/unix/syscall_openbsd_amd64.go | 1 - .../x/sys/unix/syscall_openbsd_arm.go | 1 - .../x/sys/unix/syscall_openbsd_arm64.go | 1 - .../x/sys/unix/syscall_openbsd_libc.go | 1 - .../x/sys/unix/syscall_openbsd_ppc64.go | 1 - .../x/sys/unix/syscall_openbsd_riscv64.go | 1 - .../golang.org/x/sys/unix/syscall_solaris.go | 37 +- .../x/sys/unix/syscall_solaris_amd64.go | 1 - vendor/golang.org/x/sys/unix/syscall_unix.go | 12 +- .../golang.org/x/sys/unix/syscall_unix_gc.go | 2 - .../x/sys/unix/syscall_unix_gc_ppc64x.go | 3 - .../x/sys/unix/syscall_zos_s390x.go | 18 +- vendor/golang.org/x/sys/unix/sysvshm_linux.go | 1 - vendor/golang.org/x/sys/unix/sysvshm_unix.go | 1 - .../x/sys/unix/sysvshm_unix_other.go | 1 - vendor/golang.org/x/sys/unix/timestruct.go | 1 - .../golang.org/x/sys/unix/unveil_openbsd.go | 41 +- vendor/golang.org/x/sys/unix/xattr_bsd.go | 1 - .../golang.org/x/sys/unix/zerrors_aix_ppc.go | 1 - .../x/sys/unix/zerrors_aix_ppc64.go | 1 - .../x/sys/unix/zerrors_darwin_amd64.go | 1 - .../x/sys/unix/zerrors_darwin_arm64.go | 1 - .../x/sys/unix/zerrors_dragonfly_amd64.go | 1 - .../x/sys/unix/zerrors_freebsd_386.go | 1 - .../x/sys/unix/zerrors_freebsd_amd64.go | 1 - .../x/sys/unix/zerrors_freebsd_arm.go | 1 - .../x/sys/unix/zerrors_freebsd_arm64.go | 1 - .../x/sys/unix/zerrors_freebsd_riscv64.go | 1 - vendor/golang.org/x/sys/unix/zerrors_linux.go | 120 +- .../x/sys/unix/zerrors_linux_386.go | 12 +- .../x/sys/unix/zerrors_linux_amd64.go | 12 +- .../x/sys/unix/zerrors_linux_arm.go | 12 +- .../x/sys/unix/zerrors_linux_arm64.go | 14 +- .../x/sys/unix/zerrors_linux_loong64.go | 15 +- .../x/sys/unix/zerrors_linux_mips.go | 12 +- .../x/sys/unix/zerrors_linux_mips64.go | 12 +- .../x/sys/unix/zerrors_linux_mips64le.go | 12 +- .../x/sys/unix/zerrors_linux_mipsle.go | 12 +- .../x/sys/unix/zerrors_linux_ppc.go | 12 +- .../x/sys/unix/zerrors_linux_ppc64.go | 12 +- .../x/sys/unix/zerrors_linux_ppc64le.go | 12 +- .../x/sys/unix/zerrors_linux_riscv64.go | 15 +- .../x/sys/unix/zerrors_linux_s390x.go | 12 +- .../x/sys/unix/zerrors_linux_sparc64.go | 60 +- .../x/sys/unix/zerrors_netbsd_386.go | 1 - .../x/sys/unix/zerrors_netbsd_amd64.go | 1 - .../x/sys/unix/zerrors_netbsd_arm.go | 1 - .../x/sys/unix/zerrors_netbsd_arm64.go | 1 - .../x/sys/unix/zerrors_openbsd_386.go | 1 - .../x/sys/unix/zerrors_openbsd_amd64.go | 1 - .../x/sys/unix/zerrors_openbsd_arm.go | 1 - .../x/sys/unix/zerrors_openbsd_arm64.go | 1 - .../x/sys/unix/zerrors_openbsd_mips64.go | 1 - .../x/sys/unix/zerrors_openbsd_ppc64.go | 1 - .../x/sys/unix/zerrors_openbsd_riscv64.go | 1 - .../x/sys/unix/zerrors_solaris_amd64.go | 1 - .../x/sys/unix/zerrors_zos_s390x.go | 1 - .../x/sys/unix/zptrace_armnn_linux.go | 2 - .../x/sys/unix/zptrace_mipsnn_linux.go | 2 - .../x/sys/unix/zptrace_mipsnnle_linux.go | 2 - .../x/sys/unix/zptrace_x86_linux.go | 2 - .../golang.org/x/sys/unix/zsyscall_aix_ppc.go | 23 - .../x/sys/unix/zsyscall_aix_ppc64.go | 23 - .../x/sys/unix/zsyscall_aix_ppc64_gc.go | 1 - .../x/sys/unix/zsyscall_aix_ppc64_gccgo.go | 1 - .../x/sys/unix/zsyscall_darwin_amd64.go | 41 +- .../x/sys/unix/zsyscall_darwin_amd64.s | 149 - .../x/sys/unix/zsyscall_darwin_arm64.go | 41 +- .../x/sys/unix/zsyscall_darwin_arm64.s | 149 - .../x/sys/unix/zsyscall_dragonfly_amd64.go | 23 - .../x/sys/unix/zsyscall_freebsd_386.go | 23 - .../x/sys/unix/zsyscall_freebsd_amd64.go | 23 - .../x/sys/unix/zsyscall_freebsd_arm.go | 23 - .../x/sys/unix/zsyscall_freebsd_arm64.go | 23 - .../x/sys/unix/zsyscall_freebsd_riscv64.go | 23 - .../x/sys/unix/zsyscall_illumos_amd64.go | 11 +- .../golang.org/x/sys/unix/zsyscall_linux.go | 95 +- .../x/sys/unix/zsyscall_linux_386.go | 1 - .../x/sys/unix/zsyscall_linux_amd64.go | 1 - .../x/sys/unix/zsyscall_linux_arm.go | 1 - .../x/sys/unix/zsyscall_linux_arm64.go | 1 - .../x/sys/unix/zsyscall_linux_loong64.go | 1 - .../x/sys/unix/zsyscall_linux_mips.go | 1 - .../x/sys/unix/zsyscall_linux_mips64.go | 1 - .../x/sys/unix/zsyscall_linux_mips64le.go | 1 - .../x/sys/unix/zsyscall_linux_mipsle.go | 1 - .../x/sys/unix/zsyscall_linux_ppc.go | 1 - .../x/sys/unix/zsyscall_linux_ppc64.go | 1 - .../x/sys/unix/zsyscall_linux_ppc64le.go | 1 - .../x/sys/unix/zsyscall_linux_riscv64.go | 17 +- .../x/sys/unix/zsyscall_linux_s390x.go | 1 - .../x/sys/unix/zsyscall_linux_sparc64.go | 1 - .../x/sys/unix/zsyscall_netbsd_386.go | 30 +- .../x/sys/unix/zsyscall_netbsd_amd64.go | 30 +- .../x/sys/unix/zsyscall_netbsd_arm.go | 30 +- .../x/sys/unix/zsyscall_netbsd_arm64.go | 30 +- .../x/sys/unix/zsyscall_openbsd_386.go | 102 +- .../x/sys/unix/zsyscall_openbsd_386.s | 30 + .../x/sys/unix/zsyscall_openbsd_amd64.go | 102 +- .../x/sys/unix/zsyscall_openbsd_amd64.s | 30 + .../x/sys/unix/zsyscall_openbsd_arm.go | 102 +- .../x/sys/unix/zsyscall_openbsd_arm.s | 30 + .../x/sys/unix/zsyscall_openbsd_arm64.go | 102 +- .../x/sys/unix/zsyscall_openbsd_arm64.s | 30 + .../x/sys/unix/zsyscall_openbsd_mips64.go | 102 +- .../x/sys/unix/zsyscall_openbsd_mips64.s | 30 + .../x/sys/unix/zsyscall_openbsd_ppc64.go | 102 +- .../x/sys/unix/zsyscall_openbsd_ppc64.s | 36 + .../x/sys/unix/zsyscall_openbsd_riscv64.go | 102 +- .../x/sys/unix/zsyscall_openbsd_riscv64.s | 30 + .../x/sys/unix/zsyscall_solaris_amd64.go | 257 +- .../x/sys/unix/zsyscall_zos_s390x.go | 12 - .../x/sys/unix/zsysctl_openbsd_386.go | 1 - .../x/sys/unix/zsysctl_openbsd_amd64.go | 1 - .../x/sys/unix/zsysctl_openbsd_arm.go | 1 - .../x/sys/unix/zsysctl_openbsd_arm64.go | 1 - .../x/sys/unix/zsysctl_openbsd_mips64.go | 1 - .../x/sys/unix/zsysctl_openbsd_ppc64.go | 1 - .../x/sys/unix/zsysctl_openbsd_riscv64.go | 1 - .../x/sys/unix/zsysnum_darwin_amd64.go | 1 - .../x/sys/unix/zsysnum_darwin_arm64.go | 1 - .../x/sys/unix/zsysnum_dragonfly_amd64.go | 1 - .../x/sys/unix/zsysnum_freebsd_386.go | 1 - .../x/sys/unix/zsysnum_freebsd_amd64.go | 1 - .../x/sys/unix/zsysnum_freebsd_arm.go | 1 - .../x/sys/unix/zsysnum_freebsd_arm64.go | 1 - .../x/sys/unix/zsysnum_freebsd_riscv64.go | 1 - .../x/sys/unix/zsysnum_linux_386.go | 3 +- .../x/sys/unix/zsysnum_linux_amd64.go | 4 +- .../x/sys/unix/zsysnum_linux_arm.go | 3 +- .../x/sys/unix/zsysnum_linux_arm64.go | 3 +- .../x/sys/unix/zsysnum_linux_loong64.go | 3 +- .../x/sys/unix/zsysnum_linux_mips.go | 3 +- .../x/sys/unix/zsysnum_linux_mips64.go | 3 +- .../x/sys/unix/zsysnum_linux_mips64le.go | 3 +- .../x/sys/unix/zsysnum_linux_mipsle.go | 3 +- .../x/sys/unix/zsysnum_linux_ppc.go | 3 +- .../x/sys/unix/zsysnum_linux_ppc64.go | 3 +- .../x/sys/unix/zsysnum_linux_ppc64le.go | 3 +- .../x/sys/unix/zsysnum_linux_riscv64.go | 5 +- .../x/sys/unix/zsysnum_linux_s390x.go | 4 +- .../x/sys/unix/zsysnum_linux_sparc64.go | 3 +- .../x/sys/unix/zsysnum_netbsd_386.go | 1 - .../x/sys/unix/zsysnum_netbsd_amd64.go | 1 - .../x/sys/unix/zsysnum_netbsd_arm.go | 1 - .../x/sys/unix/zsysnum_netbsd_arm64.go | 1 - .../x/sys/unix/zsysnum_openbsd_386.go | 1 - .../x/sys/unix/zsysnum_openbsd_amd64.go | 1 - .../x/sys/unix/zsysnum_openbsd_arm.go | 1 - .../x/sys/unix/zsysnum_openbsd_arm64.go | 1 - .../x/sys/unix/zsysnum_openbsd_mips64.go | 1 - .../x/sys/unix/zsysnum_openbsd_ppc64.go | 1 - .../x/sys/unix/zsysnum_openbsd_riscv64.go | 1 - .../x/sys/unix/zsysnum_zos_s390x.go | 1 - .../golang.org/x/sys/unix/ztypes_aix_ppc.go | 1 - .../golang.org/x/sys/unix/ztypes_aix_ppc64.go | 1 - .../x/sys/unix/ztypes_darwin_amd64.go | 1 - .../x/sys/unix/ztypes_darwin_arm64.go | 1 - .../x/sys/unix/ztypes_dragonfly_amd64.go | 1 - .../x/sys/unix/ztypes_freebsd_386.go | 1 - .../x/sys/unix/ztypes_freebsd_amd64.go | 1 - .../x/sys/unix/ztypes_freebsd_arm.go | 1 - .../x/sys/unix/ztypes_freebsd_arm64.go | 1 - .../x/sys/unix/ztypes_freebsd_riscv64.go | 1 - vendor/golang.org/x/sys/unix/ztypes_linux.go | 148 +- .../golang.org/x/sys/unix/ztypes_linux_386.go | 3 +- .../x/sys/unix/ztypes_linux_amd64.go | 3 +- .../golang.org/x/sys/unix/ztypes_linux_arm.go | 3 +- .../x/sys/unix/ztypes_linux_arm64.go | 3 +- .../x/sys/unix/ztypes_linux_loong64.go | 3 +- .../x/sys/unix/ztypes_linux_mips.go | 3 +- .../x/sys/unix/ztypes_linux_mips64.go | 3 +- .../x/sys/unix/ztypes_linux_mips64le.go | 3 +- .../x/sys/unix/ztypes_linux_mipsle.go | 3 +- .../golang.org/x/sys/unix/ztypes_linux_ppc.go | 3 +- .../x/sys/unix/ztypes_linux_ppc64.go | 3 +- .../x/sys/unix/ztypes_linux_ppc64le.go | 3 +- .../x/sys/unix/ztypes_linux_riscv64.go | 30 +- .../x/sys/unix/ztypes_linux_s390x.go | 3 +- .../x/sys/unix/ztypes_linux_sparc64.go | 3 +- .../x/sys/unix/ztypes_netbsd_386.go | 1 - .../x/sys/unix/ztypes_netbsd_amd64.go | 1 - .../x/sys/unix/ztypes_netbsd_arm.go | 1 - .../x/sys/unix/ztypes_netbsd_arm64.go | 1 - .../x/sys/unix/ztypes_openbsd_386.go | 1 - .../x/sys/unix/ztypes_openbsd_amd64.go | 1 - .../x/sys/unix/ztypes_openbsd_arm.go | 1 - .../x/sys/unix/ztypes_openbsd_arm64.go | 1 - .../x/sys/unix/ztypes_openbsd_mips64.go | 1 - .../x/sys/unix/ztypes_openbsd_ppc64.go | 1 - .../x/sys/unix/ztypes_openbsd_riscv64.go | 1 - .../x/sys/unix/ztypes_solaris_amd64.go | 1 - .../golang.org/x/sys/unix/ztypes_zos_s390x.go | 1 - vendor/golang.org/x/sys/windows/aliases.go | 1 - vendor/golang.org/x/sys/windows/empty.s | 1 - vendor/golang.org/x/sys/windows/eventlog.go | 1 - .../golang.org/x/sys/windows/exec_windows.go | 89 +- vendor/golang.org/x/sys/windows/mksyscall.go | 1 - vendor/golang.org/x/sys/windows/race.go | 1 - vendor/golang.org/x/sys/windows/race0.go | 1 - .../x/sys/windows/security_windows.go | 21 +- vendor/golang.org/x/sys/windows/service.go | 5 +- vendor/golang.org/x/sys/windows/str.go | 1 - vendor/golang.org/x/sys/windows/syscall.go | 1 - .../x/sys/windows/syscall_windows.go | 77 +- .../golang.org/x/sys/windows/types_windows.go | 35 +- .../x/sys/windows/zsyscall_windows.go | 99 +- vendor/golang.org/x/term/term_unix.go | 3 +- vendor/golang.org/x/term/term_unix_bsd.go | 1 - vendor/golang.org/x/term/term_unix_other.go | 1 - vendor/golang.org/x/term/term_unsupported.go | 1 - vendor/golang.org/x/text/cases/icu.go | 1 - .../golang.org/x/text/cases/tables10.0.0.go | 1 - .../golang.org/x/text/cases/tables11.0.0.go | 1 - .../golang.org/x/text/cases/tables12.0.0.go | 1 - .../golang.org/x/text/cases/tables13.0.0.go | 3 +- .../golang.org/x/text/cases/tables15.0.0.go | 2527 ++++++ vendor/golang.org/x/text/cases/tables9.0.0.go | 1 - .../text/internal/language/compact/tables.go | 356 +- .../x/text/internal/language/tables.go | 4686 +++++----- vendor/golang.org/x/text/language/match.go | 2 +- vendor/golang.org/x/text/language/tables.go | 138 +- .../x/text/unicode/norm/tables10.0.0.go | 1 - .../x/text/unicode/norm/tables11.0.0.go | 1 - .../x/text/unicode/norm/tables12.0.0.go | 1 - .../x/text/unicode/norm/tables13.0.0.go | 3 +- .../x/text/unicode/norm/tables15.0.0.go | 7907 +++++++++++++++++ .../x/text/unicode/norm/tables9.0.0.go | 1 - vendor/golang.org/x/text/unicode/norm/trie.go | 2 +- vendor/modules.txt | 25 +- 395 files changed, 19176 insertions(+), 7543 deletions(-) create mode 100644 vendor/atomicgo.dev/cursor/area_other.go create mode 100644 vendor/atomicgo.dev/cursor/area_windows.go create mode 100644 vendor/atomicgo.dev/cursor/cursor_other.go create mode 100644 vendor/atomicgo.dev/cursor/go.work delete mode 100644 vendor/github.com/pterm/pterm/CHANGELOG.md create mode 100644 vendor/github.com/pterm/pterm/heatmap_printer.go create mode 100644 vendor/github.com/pterm/pterm/internal/exit.go create mode 100644 vendor/github.com/pterm/pterm/internal/rgb_complementary.go create mode 100644 vendor/github.com/pterm/pterm/multi_live_printer.go create mode 100644 vendor/github.com/pterm/pterm/slog_handler.go delete mode 100644 vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go create mode 100644 vendor/golang.org/x/sys/unix/mmap_nomremap.go create mode 100644 vendor/golang.org/x/sys/unix/mremap.go create mode 100644 vendor/golang.org/x/text/cases/tables15.0.0.go create mode 100644 vendor/golang.org/x/text/unicode/norm/tables15.0.0.go diff --git a/go.mod b/go.mod index 356aecb8..a54278a1 100644 --- a/go.mod +++ b/go.mod @@ -1,31 +1,33 @@ module github.com/DelineaXPM/github-workflows -go 1.18 +go 1.21 + +toolchain go1.22.2 require ( github.com/bitfield/script v0.22.0 github.com/magefile/mage v1.15.0 - github.com/pterm/pterm v0.12.62 + github.com/pterm/pterm v0.12.79 github.com/sheldonhull/magetools v1.0.1 ) require ( - atomicgo.dev/cursor v0.1.1 // indirect + atomicgo.dev/cursor v0.2.0 // indirect atomicgo.dev/keyboard v0.2.9 // indirect - atomicgo.dev/schedule v0.0.2 // indirect + atomicgo.dev/schedule v0.1.0 // indirect github.com/containerd/console v1.0.3 // indirect github.com/dustin/go-humanize v1.0.1 // indirect - github.com/gookit/color v1.5.3 // indirect + github.com/gookit/color v1.5.4 // indirect github.com/itchyny/gojq v0.12.12 // indirect github.com/itchyny/timefmt-go v0.1.5 // indirect github.com/lithammer/fuzzysearch v1.1.8 // indirect - github.com/mattn/go-runewidth v0.0.14 // indirect + github.com/mattn/go-runewidth v0.0.15 // indirect github.com/rivo/uniseg v0.4.4 // indirect github.com/xo/terminfo v0.0.0-20220910002029-abceb7e1c41e // indirect github.com/ztrue/tracerr v0.4.0 // indirect golang.org/x/mod v0.10.0 // indirect - golang.org/x/sys v0.8.0 // indirect - golang.org/x/term v0.8.0 // indirect - golang.org/x/text v0.9.0 // indirect + golang.org/x/sys v0.16.0 // indirect + golang.org/x/term v0.16.0 // indirect + golang.org/x/text v0.14.0 // indirect mvdan.cc/sh/v3 v3.6.0 // indirect ) diff --git a/go.sum b/go.sum index ede38326..ddda7e88 100644 --- a/go.sum +++ b/go.sum @@ -1,10 +1,11 @@ atomicgo.dev/assert v0.0.2 h1:FiKeMiZSgRrZsPo9qn/7vmr7mCsh5SZyXY4YGYiYwrg= -atomicgo.dev/cursor v0.1.1 h1:0t9sxQomCTRh5ug+hAMCs59x/UmC9QL6Ci5uosINKD4= -atomicgo.dev/cursor v0.1.1/go.mod h1:Lr4ZJB3U7DfPPOkbH7/6TOtJ4vFGHlgj1nc+n900IpU= +atomicgo.dev/assert v0.0.2/go.mod h1:ut4NcI3QDdJtlmAxQULOmA13Gz6e2DWbSAS8RUOmNYQ= +atomicgo.dev/cursor v0.2.0 h1:H6XN5alUJ52FZZUkI7AlJbUc1aW38GWZalpYRPpoPOw= +atomicgo.dev/cursor v0.2.0/go.mod h1:Lr4ZJB3U7DfPPOkbH7/6TOtJ4vFGHlgj1nc+n900IpU= atomicgo.dev/keyboard v0.2.9 h1:tOsIid3nlPLZ3lwgG8KZMp/SFmr7P0ssEN5JUsm78K8= atomicgo.dev/keyboard v0.2.9/go.mod h1:BC4w9g00XkxH/f1HXhW2sXmJFOCWbKn9xrOunSFtExQ= -atomicgo.dev/schedule v0.0.2 h1:2e/4KY6t3wokja01Cyty6qgkQM8MotJzjtqCH70oX2Q= -atomicgo.dev/schedule v0.0.2/go.mod h1:xeUa3oAkiuHYh8bKiQBRojqAMq3PXXbJujjb0hw8pEU= +atomicgo.dev/schedule v0.1.0 h1:nTthAbhZS5YZmgYbb2+DH8uQIZcTlIrd4eYr3UQxEjs= +atomicgo.dev/schedule v0.1.0/go.mod h1:xeUa3oAkiuHYh8bKiQBRojqAMq3PXXbJujjb0hw8pEU= github.com/MarvinJWendt/testza v0.1.0/go.mod h1:7AxNvlfeHP7Z/hDQ5JtE3OKYT3XFUeLCDE2DQninSqs= github.com/MarvinJWendt/testza v0.2.1/go.mod h1:God7bhG8n6uQxwdScay+gjm9/LnO4D3kkcZX4hv9Rp8= github.com/MarvinJWendt/testza v0.2.8/go.mod h1:nwIcjmr0Zz+Rcwfh3/4UhBp7ePKVhuBExvZqnKYWlII= @@ -13,6 +14,7 @@ github.com/MarvinJWendt/testza v0.2.12/go.mod h1:JOIegYyV7rX+7VZ9r77L/eH6CfJHHzX github.com/MarvinJWendt/testza v0.3.0/go.mod h1:eFcL4I0idjtIx8P9C6KkAuLgATNKpX4/2oUqKc6bF2c= github.com/MarvinJWendt/testza v0.4.2/go.mod h1:mSdhXiKH8sg/gQehJ63bINcCKp7RtYewEjXsvsVUPbE= github.com/MarvinJWendt/testza v0.5.2 h1:53KDo64C1z/h/d/stCYCPY69bt/OSwjq5KpFNwi+zB4= +github.com/MarvinJWendt/testza v0.5.2/go.mod h1:xu53QFE5sCdjtMCKk8YMQ2MnymimEctc4n3EjyIYvEY= github.com/atomicgo/cursor v0.0.1/go.mod h1:cBON2QmmrysudxNBFthvMtN32r3jxVRIvzkUiF/RuIk= github.com/bitfield/script v0.22.0 h1:LA7QHuEsXMPD52YLtxWrlqCCy+9FOpzNYfsRHC5Gsrc= github.com/bitfield/script v0.22.0/go.mod h1:ms4w+9B8f2/W0mbsgWDVTtl7K94bYuZc3AunnJC4Ebs= @@ -33,8 +35,8 @@ github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeN github.com/google/renameio/v2 v2.0.0/go.mod h1:BtmJXm5YlszgC+TD4HOEEUFgkJP3nLxehU6hfe7jRt4= github.com/gookit/color v1.4.2/go.mod h1:fqRyamkC1W8uxl+lxCQxOT09l/vYfZ+QeiX3rKQHCoQ= github.com/gookit/color v1.5.0/go.mod h1:43aQb+Zerm/BWh2GnrgOQm7ffz7tvQXEKV6BFMl7wAo= -github.com/gookit/color v1.5.3 h1:twfIhZs4QLCtimkP7MOxlF3A0U/5cDPseRT9M/+2SCE= -github.com/gookit/color v1.5.3/go.mod h1:NUzwzeehUfl7GIb36pqId+UGmRfQcU/WiiyTTeNjHtE= +github.com/gookit/color v1.5.4 h1:FZmqs7XOyGgCAxmWyPslpiok1k05wmY3SJTytgvYFs0= +github.com/gookit/color v1.5.4/go.mod h1:pZJOeOS8DM43rXbp4AZo1n9zCU2qjpcRko0b6/QJi9w= github.com/itchyny/gojq v0.12.12 h1:x+xGI9BXqKoJQZkr95ibpe3cdrTbY8D9lonrK433rcA= github.com/itchyny/gojq v0.12.12/go.mod h1:j+3sVkjxwd7A7Z5jrbKibgOLn0ZfLWkV+Awxr/pyzJE= github.com/itchyny/timefmt-go v0.1.5 h1:G0INE2la8S6ru/ZI5JecgyzbbJNs5lG1RcBqa7Jm6GE= @@ -43,6 +45,7 @@ github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa02 github.com/klauspost/cpuid/v2 v2.0.10/go.mod h1:g2LTdtYhdyuGPqyWyv7qRAmj1WBqxuObKfj5c0PQa7c= github.com/klauspost/cpuid/v2 v2.0.12/go.mod h1:g2LTdtYhdyuGPqyWyv7qRAmj1WBqxuObKfj5c0PQa7c= github.com/klauspost/cpuid/v2 v2.2.3 h1:sxCkb+qR91z4vsqw4vGGZlDgPz3G7gjaLyK3V8y70BU= +github.com/klauspost/cpuid/v2 v2.2.3/go.mod h1:RVVoqg1df56z8g3pUjL/3lE5UfnlrJX8tyFgg4nqhuY= github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE= github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk= @@ -55,10 +58,12 @@ github.com/lithammer/fuzzysearch v1.1.8/go.mod h1:IdqeyBClc3FFqSzYq/MXESsS4S0FsZ github.com/magefile/mage v1.15.0 h1:BvGheCMAsG3bWUDbZ8AyXXpCNwU9u5CB6sM+HNb9HYg= github.com/magefile/mage v1.15.0/go.mod h1:z5UZb/iS3GoOSn0JgWuiw7dxlurVYTu+/jHXqQg881A= github.com/matryer/is v1.4.1 h1:55ehd8zaGABKLXQUe2awZ99BD/PTc2ls+KV/dXphgEQ= +github.com/matryer/is v1.4.1/go.mod h1:8I/i5uYgLzgsgEloJE1U6xx5HkBQpAZvepWuujKwMRU= github.com/mattn/go-isatty v0.0.17/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM= github.com/mattn/go-runewidth v0.0.13/go.mod h1:Jdepj2loyihRzMpdS35Xk/zdY8IAYHsh153qUoGf23w= -github.com/mattn/go-runewidth v0.0.14 h1:+xnbZSEeDbOIg5/mE6JF0w6n9duR1l3/WmbinWVwUuU= github.com/mattn/go-runewidth v0.0.14/go.mod h1:Jdepj2loyihRzMpdS35Xk/zdY8IAYHsh153qUoGf23w= +github.com/mattn/go-runewidth v0.0.15 h1:UNAjwbU9l54TA3KzvqLGxwWjHmMgBUVhBiTjelZgg3U= +github.com/mattn/go-runewidth v0.0.15/go.mod h1:Jdepj2loyihRzMpdS35Xk/zdY8IAYHsh153qUoGf23w= github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= @@ -69,8 +74,8 @@ github.com/pterm/pterm v0.12.31/go.mod h1:32ZAWZVXD7ZfG0s8qqHXePte42kdz8ECtRyEej github.com/pterm/pterm v0.12.33/go.mod h1:x+h2uL+n7CP/rel9+bImHD5lF3nM9vJj80k9ybiiTTE= github.com/pterm/pterm v0.12.36/go.mod h1:NjiL09hFhT/vWjQHSj1athJpx6H8cjpHXNAK5bUw8T8= github.com/pterm/pterm v0.12.40/go.mod h1:ffwPLwlbXxP+rxT0GsgDTzS3y3rmpAO1NMjUkGTYf8s= -github.com/pterm/pterm v0.12.62 h1:Xjj5Wl6UR4Il9xOiDUOZRwReRTdO75if/JdWsn9I59s= -github.com/pterm/pterm v0.12.62/go.mod h1:+c3ujjE7N5qmNx6eKAa7YVSC6m/gCorJJKhzwYTbL90= +github.com/pterm/pterm v0.12.79 h1:lH3yrYMhdpeqX9y5Ep1u7DejyHy7NSQg9qrBjF9dFT4= +github.com/pterm/pterm v0.12.79/go.mod h1:1v/gzOF1N0FsjbgTHZ1wVycRkKiatFvJSJC4IGaQAAo= github.com/rivo/uniseg v0.2.0/go.mod h1:J6wj4VEh+S6ZtnVlnTBMWIodfgj8LQOQFoIToxlJtxc= github.com/rivo/uniseg v0.4.4 h1:8TfxU8dW6PdqD27gjM8MVNuicgxIjxpm4K7x4jp8sis= github.com/rivo/uniseg v0.4.4/go.mod h1:FN3SvrM+Zdj16jyLfmOkMNblXMcoc8DfTHruCPUcx88= @@ -85,7 +90,8 @@ github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+ github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4= github.com/stretchr/testify v1.6.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= github.com/stretchr/testify v1.7.0/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= -github.com/stretchr/testify v1.8.0 h1:pSgiaMZlXftHpm5L7V1+rVB+AZJydKsMxsQBIJw4PKk= +github.com/stretchr/testify v1.8.4 h1:CcVxjf3Q8PM0mHUKJCdn+eZZtm5yQwehR5yeSVQQcUk= +github.com/stretchr/testify v1.8.4/go.mod h1:sz/lmYIOXD/1dqDmKjjqLyZ2RngseejIcXlSw2iwfAo= github.com/xo/terminfo v0.0.0-20210125001918-ca9a967f8778/go.mod h1:2MuV+tbUrU1zIOPMxZ5EncGwgmMJsa+9ucAQZXxsObs= github.com/xo/terminfo v0.0.0-20220910002029-abceb7e1c41e h1:JVG44RsyaB9T2KIHavMF/ppJZNG9ZpyihvCd0w101no= github.com/xo/terminfo v0.0.0-20220910002029-abceb7e1c41e/go.mod h1:RbqR21r5mrJuqunuUZ/Dhy/avygyECGrLceyNeo4LiM= @@ -95,6 +101,7 @@ github.com/ztrue/tracerr v0.4.0/go.mod h1:PaFfYlas0DfmXNpo7Eay4MFhZUONqvXM+T2HyG golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/exp v0.0.0-20220909182711-5c715a9e8561 h1:MDc5xs78ZrZr3HMQugiXOAkSZtfTpbJLDr/lwfgO53E= +golang.org/x/exp v0.0.0-20220909182711-5c715a9e8561/go.mod h1:cyybsKvd6eL0RnXn6p/Grxp8F5bW7iYuBgsNCOHpMYE= golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4= golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= golang.org/x/mod v0.10.0 h1:lFO9qtOdlre5W1jxS3r/4szv2/6iXxScdzjoBMXNhYk= @@ -118,22 +125,23 @@ golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.3.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.8.0 h1:EBmGv8NaZBZTWvrbjNoL6HVt+IVy3QDQpJs7VRIw3tU= -golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.16.0 h1:xWw16ngr6ZMtmxDyKyIgsE93KNKz5HKmMa3b8ALHidU= +golang.org/x/sys v0.16.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20210220032956-6a3ed077a48d/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20210615171337-6886f2dfbf5b/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= golang.org/x/term v0.3.0/go.mod h1:q750SLmJuPmVoN1blW3UFBPREJfb1KmY3vwxfr+nFDA= golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k= -golang.org/x/term v0.8.0 h1:n5xxQn2i3PC0yLAbjTpNT85q/Kgzcr2gIoX9OrJUols= -golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo= +golang.org/x/term v0.16.0 h1:m+B6fahuftsE9qjo0VWp2FW0mB3MTJvR0BaMQrq0pmE= +golang.org/x/term v0.16.0/go.mod h1:yn7UURbUtPyrVJPGPq404EukNFxcm/foM+bV/bfcDsY= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= -golang.org/x/text v0.9.0 h1:2sjJmO8cDvYveuX97RDLsxlyUxLl+GHoLxBiRdHllBE= golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= +golang.org/x/text v0.14.0 h1:ScX5w1eTa3QqT8oi6+ziP7dTV1S2+ALU0bI+0zXKWiQ= +golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc= diff --git a/vendor/atomicgo.dev/cursor/.golangci.yml b/vendor/atomicgo.dev/cursor/.golangci.yml index d18a485d..796ca35c 100644 --- a/vendor/atomicgo.dev/cursor/.golangci.yml +++ b/vendor/atomicgo.dev/cursor/.golangci.yml @@ -17,55 +17,83 @@ linters-settings: - ptrToRefParam - paramTypeCombine - unnamedResult - misspell: - locale: US linters: disable-all: true enable: + # default linters - errcheck - gosimple - govet - ineffassign - staticcheck + - typecheck + - unused + # additional linters + - asasalint - asciicheck + - bidichk - bodyclose + - containedctx + - contextcheck + - decorder - dupl - durationcheck + - errchkjson + - errname - errorlint - exhaustive - - gci - - gocognit + - exhaustruct + - exportloopref + - forcetypeassert + - gocheckcompilerdirectives - gocritic - godot - godox - goerr113 - gofmt - - goimports - goprintffuncname - - misspell + - gosec + - gosmopolitan + - importas + - ireturn + - nakedret + - nestif - nilerr - - nlreturn - - noctx + - nilnil - prealloc - predeclared + - revive + - rowserrcheck + - tagalign + - tenv - thelper + - tparallel - unconvert - unparam + - usestdlibvars - wastedassign + - whitespace - wrapcheck + - wsl + - gocyclo + - misspell issues: - # Excluding configuration per-path, per-linter, per-text and per-source + include: + - EXC0012 + - EXC0014 exclude-rules: - path: _test\.go linters: + - gocyclo - errcheck - dupl + - gosec - gocritic - - wrapcheck - - goerr113 - # https://github.com/go-critic/go-critic/issues/926 - linters: - gocritic text: "unnecessaryDefer:" + - linters: + - gocritic + text: "preferDecodeRune:" service: - golangci-lint-version: 1.39.x # use the fixed version to not introduce new linters unexpectedly + golangci-lint-version: 1.53.x diff --git a/vendor/atomicgo.dev/cursor/README.md b/vendor/atomicgo.dev/cursor/README.md index c9d6d60d..0f799745 100644 --- a/vendor/atomicgo.dev/cursor/README.md +++ b/vendor/atomicgo.dev/cursor/README.md @@ -1,13 +1,14 @@

AtomicGo | cursor

+Downloads Latest Release -Tests +Tests @@ -18,21 +19,19 @@ Unit test count - -Issues - - License: MIT + + +Go report +

---

-Get The Module -| Documentation | Contributing @@ -49,11 +48,6 @@

-
-
- ----------------------------------------------------------------------------------------------------- - -

@@ -61,214 +55,542 @@

-
-
- ----------------------------------------------------------------------------------------------------- - -

-## Description + -Package cursor contains cross-platform methods to move the terminal cursor in -different directions. This package can be used to create interactive CLI tools -and games, live charts, algorithm visualizations and other updatable output of -any kind. + -Works niceley with https://github.com/atomicgo/keyboard +# cursor -Special thanks to github.com/k0kubun/go-ansi which this project is based on. +```go +import "atomicgo.dev/cursor" +``` +Package cursor contains cross\-platform methods to move the terminal cursor in different directions. This package can be used to create interactive CLI tools and games, live charts, algorithm visualizations and other updatable output of any kind. -## Usage +Works niceley with https://github.com/atomicgo/keyboard -#### func Bottom +Special thanks to github.com/k0kubun/go\-ansi which this project is based on. + +## Index + +- [func Bottom\(\)](<#Bottom>) +- [func Clear\(\)](<#Clear>) +- [func ClearLine\(\)](<#ClearLine>) +- [func ClearLinesDown\(n int\)](<#ClearLinesDown>) +- [func ClearLinesUp\(n int\)](<#ClearLinesUp>) +- [func Down\(n int\)](<#Down>) +- [func DownAndClear\(n int\)](<#DownAndClear>) +- [func Hide\(\)](<#Hide>) +- [func HorizontalAbsolute\(n int\)](<#HorizontalAbsolute>) +- [func Left\(n int\)](<#Left>) +- [func Move\(x, y int\)](<#Move>) +- [func Right\(n int\)](<#Right>) +- [func SetTarget\(w Writer\)](<#SetTarget>) +- [func Show\(\)](<#Show>) +- [func StartOfLine\(\)](<#StartOfLine>) +- [func StartOfLineDown\(n int\)](<#StartOfLineDown>) +- [func StartOfLineUp\(n int\)](<#StartOfLineUp>) +- [func TestCustomIOWriter\(t \*testing.T\)](<#TestCustomIOWriter>) +- [func Up\(n int\)](<#Up>) +- [func UpAndClear\(n int\)](<#UpAndClear>) +- [type Area](<#Area>) + - [func NewArea\(\) Area](<#NewArea>) + - [func \(area \*Area\) Bottom\(\)](<#Area.Bottom>) + - [func \(area \*Area\) Clear\(\)](<#Area.Clear>) + - [func \(area \*Area\) ClearLinesDown\(n int\)](<#Area.ClearLinesDown>) + - [func \(area \*Area\) ClearLinesUp\(n int\)](<#Area.ClearLinesUp>) + - [func \(area \*Area\) Down\(n int\)](<#Area.Down>) + - [func \(area \*Area\) DownAndClear\(n int\)](<#Area.DownAndClear>) + - [func \(area \*Area\) Move\(x, y int\)](<#Area.Move>) + - [func \(area \*Area\) StartOfLine\(\)](<#Area.StartOfLine>) + - [func \(area \*Area\) StartOfLineDown\(n int\)](<#Area.StartOfLineDown>) + - [func \(area \*Area\) StartOfLineUp\(n int\)](<#Area.StartOfLineUp>) + - [func \(area \*Area\) Top\(\)](<#Area.Top>) + - [func \(area \*Area\) Up\(n int\)](<#Area.Up>) + - [func \(area \*Area\) UpAndClear\(n int\)](<#Area.UpAndClear>) + - [func \(area \*Area\) Update\(content string\)](<#Area.Update>) + - [func \(area Area\) WithWriter\(writer Writer\) Area](<#Area.WithWriter>) +- [type Cursor](<#Cursor>) + - [func NewCursor\(\) \*Cursor](<#NewCursor>) + - [func \(c \*Cursor\) Clear\(\)](<#Cursor.Clear>) + - [func \(c \*Cursor\) ClearLine\(\)](<#Cursor.ClearLine>) + - [func \(c \*Cursor\) Down\(n int\)](<#Cursor.Down>) + - [func \(c \*Cursor\) Hide\(\)](<#Cursor.Hide>) + - [func \(c \*Cursor\) HorizontalAbsolute\(n int\)](<#Cursor.HorizontalAbsolute>) + - [func \(c \*Cursor\) Left\(n int\)](<#Cursor.Left>) + - [func \(c \*Cursor\) Right\(n int\)](<#Cursor.Right>) + - [func \(c \*Cursor\) Show\(\)](<#Cursor.Show>) + - [func \(c \*Cursor\) Up\(n int\)](<#Cursor.Up>) + - [func \(c \*Cursor\) WithWriter\(w Writer\) \*Cursor](<#Cursor.WithWriter>) +- [type Writer](<#Writer>) + + + +## func [Bottom]() ```go func Bottom() ``` -Bottom moves the cursor to the bottom of the terminal. This is done by -calculating how many lines were moved by Up and Down. -#### func ClearLine +Bottom moves the cursor to the bottom of the terminal. This is done by calculating how many lines were moved by Up and Down. + + +## func [Clear]() + +```go +func Clear() +``` + +Clear clears the current position and moves the cursor to the left. + + +## func [ClearLine]() ```go func ClearLine() ``` + ClearLine clears the current line and moves the cursor to it's start position. -#### func ClearLinesDown + +## func [ClearLinesDown]() ```go func ClearLinesDown(n int) ``` -ClearLinesDown clears n lines downwards from the current position and moves the -cursor. -#### func ClearLinesUp +ClearLinesDown clears n lines downwards from the current position and moves the cursor. + + +## func [ClearLinesUp]() ```go func ClearLinesUp(n int) ``` -ClearLinesUp clears n lines upwards from the current position and moves the -cursor. -#### func Down +ClearLinesUp clears n lines upwards from the current position and moves the cursor. + + +## func [Down]() ```go func Down(n int) ``` + Down moves the cursor n lines down relative to the current position. -#### func DownAndClear + +## func [DownAndClear]() ```go func DownAndClear(n int) ``` + DownAndClear moves the cursor down by n lines, then clears the line. -#### func Hide + +## func [Hide]() ```go func Hide() ``` -Hide the cursor. Don't forget to show the cursor at least at the end of your -application with Show. Otherwise the user might have a terminal with a -permanently hidden cursor, until he reopens the terminal. -#### func HorizontalAbsolute +Hide the cursor. Don't forget to show the cursor at least at the end of your application with Show. Otherwise the user might have a terminal with a permanently hidden cursor, until they reopen the terminal. + + +## func [HorizontalAbsolute]() ```go func HorizontalAbsolute(n int) ``` -HorizontalAbsolute moves the cursor to n horizontally. The position n is -absolute to the start of the line. -#### func Left +HorizontalAbsolute moves the cursor to n horizontally. The position n is absolute to the start of the line. + + +## func [Left]() ```go func Left(n int) ``` + Left moves the cursor n characters to the left relative to the current position. -#### func Move + +## func [Move]() ```go func Move(x, y int) ``` + Move moves the cursor relative by x and y. -#### func Right + +## func [Right]() ```go func Right(n int) ``` -Right moves the cursor n characters to the right relative to the current -position. -#### func SetTarget +Right moves the cursor n characters to the right relative to the current position. + + +## func [SetTarget]() ```go func SetTarget(w Writer) ``` -SetTarget allows for any arbitrary Writer to be used -#### func Show +SetTarget sets to output target of the default curser to the provided cursor.Writer \(wrapping io.Writer\). + + +## func [Show]() ```go func Show() ``` -Show the cursor if it was hidden previously. Don't forget to show the cursor at -least at the end of your application. Otherwise the user might have a terminal -with a permanently hidden cursor, until he reopens the terminal. -#### func StartOfLine +Show the cursor if it was hidden previously. Don't forget to show the cursor at least at the end of your application. Otherwise the user might have a terminal with a permanently hidden cursor, until they reopen the terminal. + + +## func [StartOfLine]() ```go func StartOfLine() ``` + StartOfLine moves the cursor to the start of the current line. -#### func StartOfLineDown + +## func [StartOfLineDown]() ```go func StartOfLineDown(n int) ``` -StartOfLineDown moves the cursor down by n lines, then moves to cursor to the -start of the line. -#### func StartOfLineUp +StartOfLineDown moves the cursor down by n lines, then moves to cursor to the start of the line. + + +## func [StartOfLineUp]() ```go func StartOfLineUp(n int) ``` -StartOfLineUp moves the cursor up by n lines, then moves to cursor to the start -of the line. -#### func TestCustomIOWriter +StartOfLineUp moves the cursor up by n lines, then moves to cursor to the start of the line. + + +## func [TestCustomIOWriter]() ```go func TestCustomIOWriter(t *testing.T) ``` -#### func Up +TestCustomIOWriter tests the cursor functions with a custom Writer. + + +## func [Up]() ```go func Up(n int) ``` + Up moves the cursor n lines up relative to the current position. -#### func UpAndClear + +## func [UpAndClear]() ```go func UpAndClear(n int) ``` + UpAndClear moves the cursor up by n lines, then clears the line. -#### type Area + +## type [Area]() + +Area displays content which can be updated on the fly. You can use this to create live output, charts, dropdowns, etc. ```go type Area struct { + // contains filtered or unexported fields } ``` -Area displays content which can be updated on the fly. You can use this to -create live output, charts, dropdowns, etc. - -#### func NewArea + +### func [NewArea]() ```go func NewArea() Area ``` + NewArea returns a new Area. -#### func (*Area) Clear + +### func \(\*Area\) [Bottom]() + +```go +func (area *Area) Bottom() +``` + +Bottom moves the cursor to the bottom of the terminal. This is done by calculating how many lines were moved by Up and Down. + + +### func \(\*Area\) [Clear]() ```go func (area *Area) Clear() ``` + Clear clears the content of the Area. -#### func (*Area) Update + +### func \(\*Area\) [ClearLinesDown]() + +```go +func (area *Area) ClearLinesDown(n int) +``` + +ClearLinesDown clears n lines downwards from the current position and moves the cursor. + + +### func \(\*Area\) [ClearLinesUp]() + +```go +func (area *Area) ClearLinesUp(n int) +``` + +ClearLinesUp clears n lines upwards from the current position and moves the cursor. + + +### func \(\*Area\) [Down]() + +```go +func (area *Area) Down(n int) +``` + +Down moves the cursor of the area down one line. + + +### func \(\*Area\) [DownAndClear]() + +```go +func (area *Area) DownAndClear(n int) +``` + +DownAndClear moves the cursor down by n lines, then clears the line. + + +### func \(\*Area\) [Move]() + +```go +func (area *Area) Move(x, y int) +``` + +Move moves the cursor relative by x and y. + + +### func \(\*Area\) [StartOfLine]() + +```go +func (area *Area) StartOfLine() +``` + +StartOfLine moves the cursor to the start of the current line. + + +### func \(\*Area\) [StartOfLineDown]() + +```go +func (area *Area) StartOfLineDown(n int) +``` + +StartOfLineDown moves the cursor down by n lines, then moves to cursor to the start of the line. + + +### func \(\*Area\) [StartOfLineUp]() + +```go +func (area *Area) StartOfLineUp(n int) +``` + +StartOfLineUp moves the cursor up by n lines, then moves to cursor to the start of the line. + + +### func \(\*Area\) [Top]() + +```go +func (area *Area) Top() +``` + +Top moves the cursor to the top of the area. This is done by calculating how many lines were moved by Up and Down. + + +### func \(\*Area\) [Up]() + +```go +func (area *Area) Up(n int) +``` + +Up moves the cursor of the area up one line. + + +### func \(\*Area\) [UpAndClear]() + +```go +func (area *Area) UpAndClear(n int) +``` + +UpAndClear moves the cursor up by n lines, then clears the line. + + +### func \(\*Area\) [Update]() ```go func (area *Area) Update(content string) ``` -Update overwrites the content of the Area. -#### type Writer +Update overwrites the content of the Area and adjusts its height based on content. + + +### func \(Area\) [WithWriter]() ```go -type Writer interface { - io.Writer - Fd() uintptr +func (area Area) WithWriter(writer Writer) Area +``` + +WithWriter sets the custom writer. + + +## type [Cursor]() + +Cursor displays content which can be updated on the fly. You can use this to create live output, charts, dropdowns, etc. + +```go +type Cursor struct { + // contains filtered or unexported fields } ``` + +### func [NewCursor]() + +```go +func NewCursor() *Cursor +``` + +NewCursor creates a new Cursor instance writing to os.Stdout. + + +### func \(\*Cursor\) [Clear]() + +```go +func (c *Cursor) Clear() +``` + +Clear clears the current position and moves the cursor to the left. + + +### func \(\*Cursor\) [ClearLine]() + +```go +func (c *Cursor) ClearLine() +``` + +ClearLine clears the current line and moves the cursor to it's start position. + + +### func \(\*Cursor\) [Down]() + +```go +func (c *Cursor) Down(n int) +``` + +Down moves the cursor n lines down relative to the current position. + + +### func \(\*Cursor\) [Hide]() + +```go +func (c *Cursor) Hide() +``` + +Hide the cursor. Don't forget to show the cursor at least at the end of your application with Show. Otherwise the user might have a terminal with a permanently hidden cursor, until they reopen the terminal. + + +### func \(\*Cursor\) [HorizontalAbsolute]() + +```go +func (c *Cursor) HorizontalAbsolute(n int) +``` + +HorizontalAbsolute moves the cursor to n horizontally. The position n is absolute to the start of the line. + + +### func \(\*Cursor\) [Left]() + +```go +func (c *Cursor) Left(n int) +``` + +Left moves the cursor n characters to the left relative to the current position. + + +### func \(\*Cursor\) [Right]() + +```go +func (c *Cursor) Right(n int) +``` + +Right moves the cursor n characters to the right relative to the current position. + + +### func \(\*Cursor\) [Show]() + +```go +func (c *Cursor) Show() +``` + +Show the cursor if it was hidden previously. Don't forget to show the cursor at least at the end of your application. Otherwise the user might have a terminal with a permanently hidden cursor, until they reopen the terminal. + + +### func \(\*Cursor\) [Up]() + +```go +func (c *Cursor) Up(n int) +``` + +Up moves the cursor n lines up relative to the current position. + + +### func \(\*Cursor\) [WithWriter]() + +```go +func (c *Cursor) WithWriter(w Writer) *Cursor +``` + +WithWriter allows for any arbitrary Writer to be used for cursor movement abstracted. + + +## type [Writer]() + Writer is an expanded io.Writer interface with a file descriptor. +```go +type Writer interface { + io.Writer + Fd() uintptr +} +``` + +Generated by [gomarkdoc]() + + + + --- > [AtomicGo.dev](https://atomicgo.dev)  ·  diff --git a/vendor/atomicgo.dev/cursor/area.go b/vendor/atomicgo.dev/cursor/area.go index e8cd72d5..5b26b5db 100644 --- a/vendor/atomicgo.dev/cursor/area.go +++ b/vendor/atomicgo.dev/cursor/area.go @@ -1,49 +1,164 @@ package cursor import ( - "fmt" - "runtime" + "os" "strings" ) // Area displays content which can be updated on the fly. // You can use this to create live output, charts, dropdowns, etc. type Area struct { - height int + height int + writer Writer + cursor *Cursor + cursorPosY int } // NewArea returns a new Area. func NewArea() Area { - return Area{} + return Area{ + height: 0, + writer: os.Stdout, + cursor: cursor, + cursorPosY: 0, + } +} + +// WithWriter sets the custom writer. +func (area Area) WithWriter(writer Writer) Area { + area.writer = writer + area.cursor = area.cursor.WithWriter(writer) + + return area } // Clear clears the content of the Area. func (area *Area) Clear() { - Bottom() + // Initialize writer if not done yet + if area.writer == nil { + area.writer = os.Stdout + } + if area.height > 0 { - ClearLinesUp(area.height) + area.Bottom() + area.ClearLinesUp(area.height) + area.StartOfLine() + } else { + area.StartOfLine() + area.cursor.ClearLine() } } -// Update overwrites the content of the Area. +// Update overwrites the content of the Area and adjusts its height based on content. func (area *Area) Update(content string) { area.Clear() - lines := strings.Split(content, "\n") - - fmt.Println(strings.Repeat("\n", len(lines)-1)) // This appends space if the terminal is at the bottom - Up(len(lines)) + area.writeArea(content) + area.cursorPosY = 0 + area.height = strings.Count(content, "\n") +} - if runtime.GOOS == "windows" { - for _, line := range lines { - fmt.Print(line) - StartOfLineDown(1) +// Up moves the cursor of the area up one line. +func (area *Area) Up(n int) { + if n > 0 { + if area.cursorPosY+n > area.height { + n = area.height - area.cursorPosY } - } else { - for _, line := range lines { - fmt.Println(line) + + area.cursor.Up(n) + area.cursorPosY += n + } +} + +// Down moves the cursor of the area down one line. +func (area *Area) Down(n int) { + if n > 0 { + if area.cursorPosY-n < 0 { + n = area.height - area.cursorPosY } + + area.cursor.Down(n) + area.cursorPosY -= n } - height = 0 +} + +// Bottom moves the cursor to the bottom of the terminal. +// This is done by calculating how many lines were moved by Up and Down. +func (area *Area) Bottom() { + if area.cursorPosY > 0 { + area.Down(area.cursorPosY) + area.cursorPosY = 0 + } +} + +// Top moves the cursor to the top of the area. +// This is done by calculating how many lines were moved by Up and Down. +func (area *Area) Top() { + if area.cursorPosY < area.height { + area.Up(area.height - area.cursorPosY) + area.cursorPosY = area.height + } +} - area.height = len(lines) +// StartOfLine moves the cursor to the start of the current line. +func (area *Area) StartOfLine() { + area.cursor.HorizontalAbsolute(0) +} + +// StartOfLineDown moves the cursor down by n lines, then moves to cursor to the start of the line. +func (area *Area) StartOfLineDown(n int) { + area.Down(n) + area.StartOfLine() +} + +// StartOfLineUp moves the cursor up by n lines, then moves to cursor to the start of the line. +func (area *Area) StartOfLineUp(n int) { + area.Up(n) + area.StartOfLine() +} + +// UpAndClear moves the cursor up by n lines, then clears the line. +func (area *Area) UpAndClear(n int) { + area.Up(n) + area.cursor.ClearLine() +} + +// DownAndClear moves the cursor down by n lines, then clears the line. +func (area *Area) DownAndClear(n int) { + area.Down(n) + area.cursor.ClearLine() +} + +// Move moves the cursor relative by x and y. +func (area *Area) Move(x, y int) { + if x > 0 { + area.cursor.Right(x) + } else if x < 0 { + area.cursor.Left(-x) + } + + if y > 0 { + area.Up(y) + } else if y < 0 { + area.Down(-y) + } +} + +// ClearLinesUp clears n lines upwards from the current position and moves the cursor. +func (area *Area) ClearLinesUp(n int) { + area.StartOfLine() + area.cursor.ClearLine() + + for i := 0; i < n; i++ { + area.UpAndClear(1) + } +} + +// ClearLinesDown clears n lines downwards from the current position and moves the cursor. +func (area *Area) ClearLinesDown(n int) { + area.StartOfLine() + area.cursor.ClearLine() + + for i := 0; i < n; i++ { + area.DownAndClear(1) + } } diff --git a/vendor/atomicgo.dev/cursor/area_other.go b/vendor/atomicgo.dev/cursor/area_other.go new file mode 100644 index 00000000..b92390de --- /dev/null +++ b/vendor/atomicgo.dev/cursor/area_other.go @@ -0,0 +1,13 @@ +//go:build !windows +// +build !windows + +package cursor + +import ( + "fmt" +) + +// Update overwrites the content of the Area and adjusts its height based on content. +func (area *Area) writeArea(content string) { + fmt.Fprint(area.writer, content) +} diff --git a/vendor/atomicgo.dev/cursor/area_windows.go b/vendor/atomicgo.dev/cursor/area_windows.go new file mode 100644 index 00000000..de7dd292 --- /dev/null +++ b/vendor/atomicgo.dev/cursor/area_windows.go @@ -0,0 +1,21 @@ +//go:build windows +// +build windows + +package cursor + +import ( + "fmt" +) + +// writeArea is a helper for platform dependant output. +// For Windows newlines '\n' in the content are replaced by '\r\n' +func (area *Area) writeArea(content string) { + last := ' ' + for _, r := range content { + if r == '\n' && last != '\r' { + fmt.Fprint(area.writer, "\r\n") + continue + } + fmt.Fprint(area.writer, string(r)) + } +} diff --git a/vendor/atomicgo.dev/cursor/cursor.go b/vendor/atomicgo.dev/cursor/cursor.go index fb4c010b..89a3efcf 100644 --- a/vendor/atomicgo.dev/cursor/cursor.go +++ b/vendor/atomicgo.dev/cursor/cursor.go @@ -1,69 +1,26 @@ -//go:build !windows -// +build !windows - package cursor import ( - "fmt" "os" ) -var target Writer = os.Stdout - -// SetTarget allows for any arbitrary io.Writer to be used -// for cursor movement (will not work on Windows). -func SetTarget(w Writer) { - target = w +// Cursor displays content which can be updated on the fly. +// You can use this to create live output, charts, dropdowns, etc. +type Cursor struct { + writer Writer } -// Up moves the cursor n lines up relative to the current position. -func Up(n int) { - fmt.Fprintf(target, "\x1b[%dA", n) - height += n +// NewCursor creates a new Cursor instance writing to os.Stdout. +func NewCursor() *Cursor { + return &Cursor{writer: os.Stdout} } -// Down moves the cursor n lines down relative to the current position. -func Down(n int) { - fmt.Fprintf(target, "\x1b[%dB", n) - if height-n <= 0 { - height = 0 - } else { - height -= n +// WithWriter allows for any arbitrary Writer to be used +// for cursor movement abstracted. +func (c *Cursor) WithWriter(w Writer) *Cursor { + if w != nil { + c.writer = w } -} - -// Right moves the cursor n characters to the right relative to the current position. -func Right(n int) { - fmt.Fprintf(target, "\x1b[%dC", n) -} - -// Left moves the cursor n characters to the left relative to the current position. -func Left(n int) { - fmt.Fprintf(target, "\x1b[%dD", n) -} - -// HorizontalAbsolute moves the cursor to n horizontally. -// The position n is absolute to the start of the line. -func HorizontalAbsolute(n int) { - n += 1 // Moves the line to the character after n - fmt.Fprintf(target, "\x1b[%dG", n) -} - -// Show the cursor if it was hidden previously. -// Don't forget to show the cursor at least at the end of your application. -// Otherwise the user might have a terminal with a permanently hidden cursor, until they reopen the terminal. -func Show() { - fmt.Fprint(target, "\x1b[?25h") -} - -// Hide the cursor. -// Don't forget to show the cursor at least at the end of your application with Show. -// Otherwise the user might have a terminal with a permanently hidden cursor, until they reopen the terminal. -func Hide() { - fmt.Fprintf(target, "\x1b[?25l") -} -// ClearLine clears the current line and moves the cursor to it's start position. -func ClearLine() { - fmt.Fprintf(target, "\x1b[2K") + return c } diff --git a/vendor/atomicgo.dev/cursor/cursor_other.go b/vendor/atomicgo.dev/cursor/cursor_other.go new file mode 100644 index 00000000..7c185578 --- /dev/null +++ b/vendor/atomicgo.dev/cursor/cursor_other.go @@ -0,0 +1,67 @@ +//go:build !windows +// +build !windows + +package cursor + +import ( + "fmt" +) + +// Up moves the cursor n lines up relative to the current position. +func (c *Cursor) Up(n int) { + if n > 0 { + fmt.Fprintf(c.writer, "\x1b[%dA", n) + } +} + +// Down moves the cursor n lines down relative to the current position. +func (c *Cursor) Down(n int) { + if n > 0 { + fmt.Fprintf(c.writer, "\x1b[%dB", n) + } +} + +// Right moves the cursor n characters to the right relative to the current position. +func (c *Cursor) Right(n int) { + if n > 0 { + fmt.Fprintf(c.writer, "\x1b[%dC", n) + } +} + +// Left moves the cursor n characters to the left relative to the current position. +func (c *Cursor) Left(n int) { + if n > 0 { + fmt.Fprintf(c.writer, "\x1b[%dD", n) + } +} + +// HorizontalAbsolute moves the cursor to n horizontally. +// The position n is absolute to the start of the line. +func (c *Cursor) HorizontalAbsolute(n int) { + n++ // Moves the line to the character after n + fmt.Fprintf(c.writer, "\x1b[%dG", n) +} + +// Show the cursor if it was hidden previously. +// Don't forget to show the cursor at least at the end of your application. +// Otherwise the user might have a terminal with a permanently hidden cursor, until they reopen the terminal. +func (c *Cursor) Show() { + fmt.Fprint(c.writer, "\x1b[?25h") +} + +// Hide the cursor. +// Don't forget to show the cursor at least at the end of your application with Show. +// Otherwise the user might have a terminal with a permanently hidden cursor, until they reopen the terminal. +func (c *Cursor) Hide() { + fmt.Fprintf(c.writer, "\x1b[?25l") +} + +// ClearLine clears the current line and moves the cursor to it's start position. +func (c *Cursor) ClearLine() { + fmt.Fprintf(c.writer, "\x1b[2K") +} + +// Clear clears the current position and moves the cursor to the left. +func (c *Cursor) Clear() { + fmt.Fprintf(c.writer, "\x1b[K") +} diff --git a/vendor/atomicgo.dev/cursor/cursor_test_linux.go b/vendor/atomicgo.dev/cursor/cursor_test_linux.go index 25179b23..6a37f406 100644 --- a/vendor/atomicgo.dev/cursor/cursor_test_linux.go +++ b/vendor/atomicgo.dev/cursor/cursor_test_linux.go @@ -6,75 +6,93 @@ import ( "testing" ) +// TestCustomIOWriter tests the cursor functions with a custom Writer. func TestCustomIOWriter(t *testing.T) { tmpFile, err := os.CreateTemp("", "testingTmpFile-") + defer os.Remove(tmpFile.Name()) + if err != nil { log.Fatal(err) } - defer os.Remove(tmpFile.Name()) w := tmpFile SetTarget(w) Up(2) + expected := "\x1b[2A" actual := getFileContent(t, w.Name()) + if expected != actual { t.Errorf("wanted: %v, got %v", expected, actual) } clearFile(t, w) Down(2) + expected = "\x1b[2B" actual = getFileContent(t, w.Name()) + if expected != actual { t.Errorf("wanted: %v, got %v", expected, actual) } clearFile(t, w) Right(2) + expected = "\x1b[2C" actual = getFileContent(t, w.Name()) + if expected != actual { t.Errorf("wanted: %v, got %v", expected, actual) } clearFile(t, w) Left(2) + expected = "\x1b[2D" actual = getFileContent(t, w.Name()) + if expected != actual { t.Errorf("wanted: %v, got %v", expected, actual) } clearFile(t, w) Hide() + expected = "\x1b[?25l" actual = getFileContent(t, w.Name()) + if expected != actual { t.Errorf("wanted: %v, got %v", expected, actual) } clearFile(t, w) Show() + expected = "\x1b[?25h" actual = getFileContent(t, w.Name()) + if expected != actual { t.Errorf("wanted: %v, got %v", expected, actual) } clearFile(t, w) ClearLine() + expected = "\x1b[2K" actual = getFileContent(t, w.Name()) + if expected != actual { t.Errorf("wanted: %v, got %v", expected, actual) } clearFile(t, w) HorizontalAbsolute(3) + expected = "\x1b[4G" actual = getFileContent(t, w.Name()) + if expected != actual { t.Errorf("wanted: %v, got %v", expected, actual) } @@ -82,6 +100,7 @@ func TestCustomIOWriter(t *testing.T) { func getFileContent(t *testing.T, fileName string) string { t.Helper() + content, err := os.ReadFile(fileName) if err != nil { t.Errorf("failed to read file contents: %s", err) @@ -94,12 +113,14 @@ func getFileContent(t *testing.T, fileName string) string { func clearFile(t *testing.T, file *os.File) { t.Helper() + err := file.Truncate(0) if err != nil { t.Errorf("failed to clear file") return } + _, err = file.Seek(0, 0) if err != nil { t.Errorf("failed to clear file") diff --git a/vendor/atomicgo.dev/cursor/cursor_windows.go b/vendor/atomicgo.dev/cursor/cursor_windows.go index 0a3be0af..ebe2bc59 100644 --- a/vendor/atomicgo.dev/cursor/cursor_windows.go +++ b/vendor/atomicgo.dev/cursor/cursor_windows.go @@ -1,46 +1,35 @@ +//go:build windows +// +build windows + package cursor import ( - "os" "syscall" "unsafe" ) -var target Writer = os.Stdout - -// SetTarget allows for any arbitrary Writer to be used -func SetTarget(w Writer) { - target = w -} - // Up moves the cursor n lines up relative to the current position. -func Up(n int) { - move(0, -n) - height += n +func (c *Cursor) Up(n int) { + c.move(0, -n) } // Down moves the cursor n lines down relative to the current position. -func Down(n int) { - move(0, n) - if height-n <= 0 { - height = 0 - } else { - height -= n - } +func (c *Cursor) Down(n int) { + c.move(0, n) } // Right moves the cursor n characters to the right relative to the current position. -func Right(n int) { - move(n, 0) +func (c *Cursor) Right(n int) { + c.move(n, 0) } // Left moves the cursor n characters to the left relative to the current position. -func Left(n int) { - move(-n, 0) +func (c *Cursor) Left(n int) { + c.move(-n, 0) } -func move(x int, y int) { - handle := syscall.Handle(target.Fd()) +func (c *Cursor) move(x int, y int) { + handle := syscall.Handle(c.writer.Fd()) var csbi consoleScreenBufferInfo _, _, _ = procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) @@ -54,8 +43,8 @@ func move(x int, y int) { // HorizontalAbsolute moves the cursor to n horizontally. // The position n is absolute to the start of the line. -func HorizontalAbsolute(n int) { - handle := syscall.Handle(target.Fd()) +func (c *Cursor) HorizontalAbsolute(n int) { + handle := syscall.Handle(c.writer.Fd()) var csbi consoleScreenBufferInfo _, _, _ = procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) @@ -74,8 +63,8 @@ func HorizontalAbsolute(n int) { // Show the cursor if it was hidden previously. // Don't forget to show the cursor at least at the end of your application. // Otherwise the user might have a terminal with a permanently hidden cursor, until he reopens the terminal. -func Show() { - handle := syscall.Handle(target.Fd()) +func (c *Cursor) Show() { + handle := syscall.Handle(c.writer.Fd()) var cci consoleCursorInfo _, _, _ = procGetConsoleCursorInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&cci))) @@ -87,8 +76,8 @@ func Show() { // Hide the cursor. // Don't forget to show the cursor at least at the end of your application with Show. // Otherwise the user might have a terminal with a permanently hidden cursor, until he reopens the terminal. -func Hide() { - handle := syscall.Handle(target.Fd()) +func (c *Cursor) Hide() { + handle := syscall.Handle(c.writer.Fd()) var cci consoleCursorInfo _, _, _ = procGetConsoleCursorInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&cci))) @@ -97,9 +86,9 @@ func Hide() { _, _, _ = procSetConsoleCursorInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&cci))) } -// ClearLine clears the current line and moves the cursor to it's start position. -func ClearLine() { - handle := syscall.Handle(target.Fd()) +// ClearLine clears the current line and moves the cursor to its start position. +func (c *Cursor) ClearLine() { + handle := syscall.Handle(c.writer.Fd()) var csbi consoleScreenBufferInfo _, _, _ = procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) @@ -110,3 +99,20 @@ func ClearLine() { x = csbi.size.x _, _, _ = procFillConsoleOutputCharacter.Call(uintptr(handle), uintptr(' '), uintptr(x), uintptr(*(*int32)(unsafe.Pointer(&cursor))), uintptr(unsafe.Pointer(&w))) } + +// Clear clears the current position and moves the cursor to the left. +func (c *Cursor) Clear() { + handle := syscall.Handle(c.writer.Fd()) + + var csbi consoleScreenBufferInfo + _, _, _ = procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + + var w uint32 + cursor := csbi.cursorPosition + _, _, _ = procFillConsoleOutputCharacter.Call(uintptr(handle), uintptr(' '), uintptr(1), uintptr(*(*int32)(unsafe.Pointer(&cursor))), uintptr(unsafe.Pointer(&w))) + + if cursor.x > 0 { + cursor.x-- + } + _, _, _ = procSetConsoleCursorPosition.Call(uintptr(handle), uintptr(*(*int32)(unsafe.Pointer(&cursor)))) +} diff --git a/vendor/atomicgo.dev/cursor/go.work b/vendor/atomicgo.dev/cursor/go.work new file mode 100644 index 00000000..c71ff3ba --- /dev/null +++ b/vendor/atomicgo.dev/cursor/go.work @@ -0,0 +1,10 @@ +go 1.18 + +use . + +// replace git.neotel.at/go/c5rest => /home/rl/work/c5rest +// replace git.neotel.at/go/c5db => /home/rl/work/c5db + +// replace github.com/pterm/pterm => H:/work/github.com/pterm/pterm + +// replace atomicgo.dev/cursor => H:/github.com/atomicgo.dev/cursor diff --git a/vendor/atomicgo.dev/cursor/utils.go b/vendor/atomicgo.dev/cursor/utils.go index cde36686..4b75f09e 100644 --- a/vendor/atomicgo.dev/cursor/utils.go +++ b/vendor/atomicgo.dev/cursor/utils.go @@ -1,16 +1,92 @@ package cursor -import "io" +import ( + "io" + "os" +) -var height int +// +// Helpers for global cursor handling on os.Stdout +// + +var autoheight int +var cursor = &Cursor{writer: os.Stdout} + +// Writer is an expanded io.Writer interface with a file descriptor. +type Writer interface { + io.Writer + Fd() uintptr +} + +// SetTarget sets to output target of the default curser to the +// provided cursor.Writer (wrapping io.Writer). +func SetTarget(w Writer) { + cursor = cursor.WithWriter(w) +} + +// Up moves the cursor n lines up relative to the current position. +func Up(n int) { + cursor.Up(n) + autoheight += n +} + +// Down moves the cursor n lines down relative to the current position. +func Down(n int) { + cursor.Down(n) + + if autoheight > 0 { + autoheight -= n + } +} + +// Right moves the cursor n characters to the right relative to the current position. +func Right(n int) { + cursor.Right(n) +} + +// Left moves the cursor n characters to the left relative to the current position. +func Left(n int) { + cursor.Left(n) +} + +// HorizontalAbsolute moves the cursor to n horizontally. +// The position n is absolute to the start of the line. +func HorizontalAbsolute(n int) { + cursor.HorizontalAbsolute(n) +} + +// Show the cursor if it was hidden previously. +// Don't forget to show the cursor at least at the end of your application. +// Otherwise the user might have a terminal with a permanently hidden cursor, until they reopen the terminal. +func Show() { + cursor.Show() +} + +// Hide the cursor. +// Don't forget to show the cursor at least at the end of your application with Show. +// Otherwise the user might have a terminal with a permanently hidden cursor, until they reopen the terminal. +func Hide() { + cursor.Hide() +} + +// ClearLine clears the current line and moves the cursor to it's start position. +func ClearLine() { + cursor.ClearLine() +} + +// Clear clears the current position and moves the cursor to the left. +func Clear() { + cursor.Clear() +} // Bottom moves the cursor to the bottom of the terminal. // This is done by calculating how many lines were moved by Up and Down. func Bottom() { - if height > 0 { - Down(height) + if autoheight > 0 { + Down(autoheight) StartOfLine() - height = 0 + + autoheight = 0 } } @@ -73,9 +149,3 @@ func ClearLinesDown(n int) { DownAndClear(1) } } - -// Writer is an expanded io.Writer interface with a file descriptor. -type Writer interface { - io.Writer - Fd() uintptr -} diff --git a/vendor/atomicgo.dev/schedule/.golangci.yml b/vendor/atomicgo.dev/schedule/.golangci.yml index d5a1a2e1..796ca35c 100644 --- a/vendor/atomicgo.dev/schedule/.golangci.yml +++ b/vendor/atomicgo.dev/schedule/.golangci.yml @@ -17,54 +17,83 @@ linters-settings: - ptrToRefParam - paramTypeCombine - unnamedResult - misspell: - locale: US linters: disable-all: true enable: + # default linters - errcheck - gosimple - govet - ineffassign - staticcheck + - typecheck + - unused + # additional linters + - asasalint - asciicheck + - bidichk - bodyclose + - containedctx + - contextcheck + - decorder - dupl - durationcheck + - errchkjson + - errname - errorlint - exhaustive - - gci - - gocognit + - exhaustruct + - exportloopref + - forcetypeassert + - gocheckcompilerdirectives - gocritic - godot - godox - goerr113 - gofmt - - goimports - goprintffuncname - - misspell + - gosec + - gosmopolitan + - importas + - ireturn + - nakedret + - nestif - nilerr - - noctx + - nilnil - prealloc - predeclared + - revive + - rowserrcheck + - tagalign + - tenv - thelper + - tparallel - unconvert - unparam + - usestdlibvars - wastedassign + - whitespace - wrapcheck + - wsl + - gocyclo + - misspell issues: - # Excluding configuration per-path, per-linter, per-text and per-source + include: + - EXC0012 + - EXC0014 exclude-rules: - path: _test\.go linters: + - gocyclo - errcheck - dupl + - gosec - gocritic - - wrapcheck - - goerr113 - # https://github.com/go-critic/go-critic/issues/926 - linters: - gocritic text: "unnecessaryDefer:" + - linters: + - gocritic + text: "preferDecodeRune:" service: - golangci-lint-version: 1.39.x # use the fixed version to not introduce new linters unexpectedly + golangci-lint-version: 1.53.x diff --git a/vendor/atomicgo.dev/schedule/README.md b/vendor/atomicgo.dev/schedule/README.md index ca0b291f..3f7f9a84 100644 --- a/vendor/atomicgo.dev/schedule/README.md +++ b/vendor/atomicgo.dev/schedule/README.md @@ -1,13 +1,14 @@

AtomicGo | schedule

+Downloads Latest Release -Tests +Tests @@ -18,21 +19,19 @@ Unit test count - -Issues - - License: MIT + + +Go report +

---

-Get The Module -| Documentation | Contributing @@ -49,11 +48,6 @@

-
-
- ----------------------------------------------------------------------------------------------------- - -

@@ -61,11 +55,6 @@

-
-
- ----------------------------------------------------------------------------------------------------- - -

@@ -86,19 +75,20 @@ It can run a function at a given time, in a given duration, or repeatedly at a g ## Index -- [type Task](<#type-task>) - - [func After(d time.Duration, task func()) *Task](<#func-after>) - - [func At(t time.Time, task func()) *Task](<#func-at>) - - [func Every(interval time.Duration, task func()) *Task](<#func-every>) - - [func (s *Task) ExecutesIn() time.Duration](<#func-task-executesin>) - - [func (s *Task) IsActive() bool](<#func-task-isactive>) - - [func (s *Task) NextExecutionTime() time.Time](<#func-task-nextexecutiontime>) - - [func (s *Task) StartedAt() time.Time](<#func-task-startedat>) - - [func (s *Task) Stop()](<#func-task-stop>) - - [func (s *Task) Wait()](<#func-task-wait>) +- [type Task](<#Task>) + - [func After\(d time.Duration, task func\(\)\) \*Task](<#After>) + - [func At\(t time.Time, task func\(\)\) \*Task](<#At>) + - [func Every\(interval time.Duration, task func\(\) bool\) \*Task](<#Every>) + - [func \(s \*Task\) ExecutesIn\(\) time.Duration](<#Task.ExecutesIn>) + - [func \(s \*Task\) IsActive\(\) bool](<#Task.IsActive>) + - [func \(s \*Task\) NextExecutionTime\(\) time.Time](<#Task.NextExecutionTime>) + - [func \(s \*Task\) StartedAt\(\) time.Time](<#Task.StartedAt>) + - [func \(s \*Task\) Stop\(\)](<#Task.Stop>) + - [func \(s \*Task\) Wait\(\)](<#Task.Wait>) -## type Task + +## type [Task]() Task holds information about the running task and can be used to stop running tasks. @@ -108,7 +98,8 @@ type Task struct { } ``` -### func After + +### func [After]() ```go func After(d time.Duration, task func()) *Task @@ -119,6 +110,8 @@ After executes the task after the given duration. The function is non\-blocking.
Example

+ + ```go package main @@ -143,7 +136,8 @@ func main() {

-### func At + +### func [At]() ```go func At(t time.Time, task func()) *Task @@ -154,6 +148,8 @@ At executes the task at the given time. The function is non\-blocking. If you wa
Example

+ + ```go package main @@ -178,17 +174,20 @@ func main() {

-### func Every + +### func [Every]() ```go -func Every(interval time.Duration, task func()) *Task +func Every(interval time.Duration, task func() bool) *Task ``` -Every executes the task in the given interval. The function is non\-blocking. If you want to wait for the task to be executed, use the Task.Wait method. +Every executes the task in the given interval, as long as the task function returns true. The function is non\-blocking. If you want to wait for the task to be executed, use the Task.Wait method.
Example

+ + ```go package main @@ -200,8 +199,9 @@ import ( ) func main() { - task := schedule.Every(5*time.Second, func() { - fmt.Println("5 seconds are over!") + task := schedule.Every(time.Second, func() bool { + fmt.Println("1 second is over!") + return true // return false to stop the task }) fmt.Println("Some stuff happening...") @@ -215,7 +215,8 @@ func main() {

-### func \(\*Task\) ExecutesIn + +### func \(\*Task\) [ExecutesIn]() ```go func (s *Task) ExecutesIn() time.Duration @@ -223,7 +224,8 @@ func (s *Task) ExecutesIn() time.Duration ExecutesIn returns the duration until the next execution. -### func \(\*Task\) IsActive + +### func \(\*Task\) [IsActive]() ```go func (s *Task) IsActive() bool @@ -231,7 +233,8 @@ func (s *Task) IsActive() bool IsActive returns true if the scheduler is active. -### func \(\*Task\) NextExecutionTime + +### func \(\*Task\) [NextExecutionTime]() ```go func (s *Task) NextExecutionTime() time.Time @@ -239,7 +242,8 @@ func (s *Task) NextExecutionTime() time.Time NextExecutionTime returns the time when the next execution will happen. -### func \(\*Task\) StartedAt + +### func \(\*Task\) [StartedAt]() ```go func (s *Task) StartedAt() time.Time @@ -247,7 +251,8 @@ func (s *Task) StartedAt() time.Time StartedAt returns the time when the scheduler was started. -### func \(\*Task\) Stop + +### func \(\*Task\) [Stop]() ```go func (s *Task) Stop() @@ -255,7 +260,8 @@ func (s *Task) Stop() Stop stops the scheduler. -### func \(\*Task\) Wait + +### func \(\*Task\) [Wait]() ```go func (s *Task) Wait() @@ -263,8 +269,6 @@ func (s *Task) Wait() Wait blocks until the scheduler is stopped. After and At will stop automatically after the task is executed. - - Generated by [gomarkdoc]() diff --git a/vendor/atomicgo.dev/schedule/schedule.go b/vendor/atomicgo.dev/schedule/schedule.go index 1ab1c839..635d29d3 100644 --- a/vendor/atomicgo.dev/schedule/schedule.go +++ b/vendor/atomicgo.dev/schedule/schedule.go @@ -91,9 +91,9 @@ func At(t time.Time, task func()) *Task { return scheduler } -// Every executes the task in the given interval. +// Every executes the task in the given interval, as long as the task function returns true. // The function is non-blocking. If you want to wait for the task to be executed, use the Task.Wait method. -func Every(interval time.Duration, task func()) *Task { +func Every(interval time.Duration, task func() bool) *Task { scheduler := newTask() scheduler.nextExecution = time.Now().Add(interval) diff --git a/vendor/github.com/gookit/color/color_16.go b/vendor/github.com/gookit/color/color_16.go index 0b70efe4..eda226a1 100644 --- a/vendor/github.com/gookit/color/color_16.go +++ b/vendor/github.com/gookit/color/color_16.go @@ -41,15 +41,27 @@ func (o Opts) String() string { * Basic 16 color definition *************************************************************/ -// Base value for foreground/background color -// base: fg 30~37, bg 40~47 -// light: fg 90~97, bg 100~107 +const ( + // OptMax max option value. range: 0 - 9 + OptMax = 10 + // DiffFgBg diff foreground and background color + DiffFgBg = 10 +) + +// Boundary value for foreground/background color 16 +// +// - base: fg 30~37, bg 40~47 +// - light: fg 90~97, bg 100~107 const ( FgBase uint8 = 30 + FgMax uint8 = 37 BgBase uint8 = 40 + BgMax uint8 = 47 HiFgBase uint8 = 90 + HiFgMax uint8 = 97 HiBgBase uint8 = 100 + HiBgMax uint8 = 107 ) // Foreground colors. basic foreground colors 30 - 37 @@ -94,7 +106,7 @@ const ( BgDefault Color = 49 ) -// Extra background color 100 - 107(非标准) +// Extra background color 100 - 107 (non-standard) const ( BgDarkGray Color = iota + 100 BgLightRed @@ -108,7 +120,7 @@ const ( BgGray Color = 100 ) -// Option settings +// Option settings. range: 0 - 9 const ( OpReset Color = iota // 0 重置所有设置 OpBold // 1 加粗 @@ -248,9 +260,9 @@ func (c Color) Println(a ...any) { doPrintlnV2(c.String(), a) } // lightCyan := Cyan.Light() // lightCyan.Print("message") func (c Color) Light() Color { - val := int(c) + val := uint8(c) if val >= 30 && val <= 47 { - return Color(uint8(c) + 60) + return Color(val + 60) } // don't change @@ -264,9 +276,9 @@ func (c Color) Light() Color { // cyan := LightCyan.Darken() // cyan.Print("message") func (c Color) Darken() Color { - val := int(c) + val := uint8(c) if val >= 90 && val <= 107 { - return Color(uint8(c) - 60) + return Color(val - 60) } // don't change @@ -324,7 +336,7 @@ func (c Color) RGB() RGBColor { return emptyRGBColor } - return HEX(Basic2hex(val)) + return HEX(Basic2hex(val), c.IsBg()) } // Code convert to code string. eg "35" @@ -337,8 +349,23 @@ func (c Color) String() string { return strconv.FormatInt(int64(c), 10) } +// IsBg check is background color +func (c Color) IsBg() bool { + val := uint8(c) + return val >= BgBase && val <= BgMax || val >= HiBgBase && val <= HiBgMax +} + +// IsFg check is foreground color +func (c Color) IsFg() bool { + val := uint8(c) + return val >= FgBase && val <= FgMax || val >= HiFgBase && val <= HiFgMax +} + +// IsOption check is option code: 0-9 +func (c Color) IsOption() bool { return uint8(c) < OptMax } + // IsValid color value -func (c Color) IsValid() bool { return c < 107 } +func (c Color) IsValid() bool { return uint8(c) < HiBgMax } /************************************************************* * basic color maps diff --git a/vendor/github.com/gookit/color/color_256.go b/vendor/github.com/gookit/color/color_256.go index 991e604c..79ae5f8d 100644 --- a/vendor/github.com/gookit/color/color_256.go +++ b/vendor/github.com/gookit/color/color_256.go @@ -43,7 +43,8 @@ const ( * 8bit(256) Color: Bit8Color Color256 *************************************************************/ -// Color256 256 color (8 bit), uint8 range at 0 - 255 +// Color256 256 color (8 bit), uint8 range at 0 - 255. +// Support 256 color on windows CMD, PowerShell // // 颜色值使用10进制和16进制都可 0x98 = 152 // @@ -54,10 +55,9 @@ const ( // // example: // -// fg color: [152, 0] -// bg color: [152, 1] +// fg color: [152, 0] +// bg color: [152, 1] // -// NOTICE: now support 256 color on windows CMD, PowerShell // lint warn - Name starts with package name type Color256 [2]uint8 type Bit8Color = Color256 // alias @@ -164,9 +164,7 @@ func (c Color256) String() string { } // IsFg color -func (c Color256) IsFg() bool { - return c[1] == AsFg -} +func (c Color256) IsFg() bool { return c[1] == AsFg } // ToFg 256 color func (c Color256) ToFg() Color256 { @@ -175,9 +173,7 @@ func (c Color256) ToFg() Color256 { } // IsBg color -func (c Color256) IsBg() bool { - return c[1] == AsBg -} +func (c Color256) IsBg() bool { return c[1] == AsBg } // ToBg 256 color func (c Color256) ToBg() Color256 { @@ -186,9 +182,7 @@ func (c Color256) ToBg() Color256 { } // IsEmpty value -func (c Color256) IsEmpty() bool { - return c[1] > 1 -} +func (c Color256) IsEmpty() bool { return c[1] > 1 } /************************************************************* * 8bit(256) Style diff --git a/vendor/github.com/gookit/color/color_rgb.go b/vendor/github.com/gookit/color/color_rgb.go index 724cf665..bc129b71 100644 --- a/vendor/github.com/gookit/color/color_rgb.go +++ b/vendor/github.com/gookit/color/color_rgb.go @@ -44,6 +44,7 @@ const ( *************************************************************/ // RGBColor definition. +// Support RGB color on Windows CMD, PowerShell // // The first to third digits represent the color value. // The last digit represents the foreground(0), background(1), >1 is unset value @@ -54,8 +55,6 @@ const ( // // 3rd: Fg=0, Bg=1, >1: unset value // RGBColor{30,144,255, 0} // RGBColor{30,144,255, 1} -// -// NOTICE: now support RGB color on Windows CMD, PowerShell type RGBColor [4]uint8 // create an empty RGBColor @@ -251,6 +250,18 @@ func (c RGBColor) String() string { return "" } +// ToBg convert to background color +func (c RGBColor) ToBg() RGBColor { + c[3] = AsBg + return c +} + +// ToFg convert to foreground color +func (c RGBColor) ToFg() RGBColor { + c[3] = AsFg + return c +} + // IsEmpty value func (c RGBColor) IsEmpty() bool { return c[3] > AsBg diff --git a/vendor/github.com/gookit/color/convert.go b/vendor/github.com/gookit/color/convert.go index 39aac7d2..c7103536 100644 --- a/vendor/github.com/gookit/color/convert.go +++ b/vendor/github.com/gookit/color/convert.go @@ -52,6 +52,7 @@ var ( // ---------- basic(16) <=> RGB color convert ---------- // refer from Hyper app + // Tip: only keep foreground color, background color need convert to foreground color for convert to RGB basic2hexMap = map[uint8]string{ 30: "000000", // black 31: "c51e14", // red @@ -61,7 +62,7 @@ var ( 35: "c839c5", // magenta 36: "20c5c6", // cyan 37: "c7c7c7", // white - // - don't add bg color + // - don't add bg color, convert to fg color for convert to RGB // 40: "000000", // black // 41: "c51e14", // red // 42: "1dc121", // green @@ -428,10 +429,11 @@ func HexToRGB(hex string) []int { return HexToRgb(hex) } // HexToRgb convert hex color string to RGB numbers // // Usage: -// rgb := HexToRgb("ccc") // rgb: [204 204 204] -// rgb := HexToRgb("aabbcc") // rgb: [170 187 204] -// rgb := HexToRgb("#aabbcc") // rgb: [170 187 204] -// rgb := HexToRgb("0xad99c0") // rgb: [170 187 204] +// +// rgb := HexToRgb("ccc") // rgb: [204 204 204] +// rgb := HexToRgb("aabbcc") // rgb: [170 187 204] +// rgb := HexToRgb("#aabbcc") // rgb: [170 187 204] +// rgb := HexToRgb("0xad99c0") // rgb: [170 187 204] func HexToRgb(hex string) (rgb []int) { hex = strings.TrimSpace(hex) if hex == "" { @@ -474,6 +476,7 @@ func Rgb2hex(rgb []int) string { return RgbToHex(rgb) } // RgbToHex convert RGB-code to hex-code // // Usage: +// // hex := RgbToHex([]int{170, 187, 204}) // hex: "aabbcc" func RgbToHex(rgb []int) string { hexNodes := make([]string, len(rgb)) @@ -488,10 +491,15 @@ func RgbToHex(rgb []int) string { * 4bit(16) color <=> RGB/True color *************************************************************/ +// BasicToHex convert basic color to hex string. +func BasicToHex(val uint8) string { + val = Bg2Fg(val) + return basic2hexMap[val] +} + // Basic2hex convert basic color to hex string. func Basic2hex(val uint8) string { - val = Fg2Bg(val) - return basic2hexMap[val] + return BasicToHex(val) } // Hex2basic convert hex string to basic color code. @@ -663,6 +671,7 @@ func C256ToRgbV1(val uint8) (rgb []uint8) { // returns r, g, and b in the set [0, 255]. // // Usage: +// // HslIntToRgb(0, 100, 50) // red // HslIntToRgb(120, 100, 50) // lime // HslIntToRgb(120, 100, 25) // dark green @@ -677,6 +686,7 @@ func HslIntToRgb(h, s, l int) (rgb []uint8) { // returns r, g, and b in the set [0, 255]. // // Usage: +// // rgbVals := HslToRgb(0, 1, 0.5) // red func HslToRgb(h, s, l float64) (rgb []uint8) { var r, g, b float64 diff --git a/vendor/github.com/gookit/color/style.go b/vendor/github.com/gookit/color/style.go index a009d1d6..353d39f1 100644 --- a/vendor/github.com/gookit/color/style.go +++ b/vendor/github.com/gookit/color/style.go @@ -37,7 +37,8 @@ func (s *Style) Add(cs ...Color) { *s = append(*s, cs...) } -// Render render text +// Render colored text +// // Usage: // // color.New(color.FgGreen).Render("text") @@ -46,8 +47,9 @@ func (s Style) Render(a ...any) string { return RenderCode(s.String(), a...) } -// Renderln render text line. +// Renderln render text with newline. // like Println, will add spaces for each argument +// // Usage: // // color.New(color.FgGreen).Renderln("text", "more") diff --git a/vendor/github.com/pterm/pterm/.gitignore b/vendor/github.com/pterm/pterm/.gitignore index e4354651..dc83dde7 100644 --- a/vendor/github.com/pterm/pterm/.gitignore +++ b/vendor/github.com/pterm/pterm/.gitignore @@ -15,7 +15,7 @@ vendor/ # This is where we test stuff -/experimenting/ +/experimenting/* /.history /.vscode diff --git a/vendor/github.com/pterm/pterm/.golangci.yml b/vendor/github.com/pterm/pterm/.golangci.yml index 57ba35d8..a964631f 100644 --- a/vendor/github.com/pterm/pterm/.golangci.yml +++ b/vendor/github.com/pterm/pterm/.golangci.yml @@ -28,7 +28,6 @@ linters: - gosec - govet - ineffassign - - interfacer - unconvert - gosimple - godox diff --git a/vendor/github.com/pterm/pterm/CHANGELOG.md b/vendor/github.com/pterm/pterm/CHANGELOG.md deleted file mode 100644 index 2e494cbe..00000000 --- a/vendor/github.com/pterm/pterm/CHANGELOG.md +++ /dev/null @@ -1,1274 +0,0 @@ - -## [Unreleased] - -### Bug Fixes -- fixed not being able to add a custom graceful shutdown - - - -## [v0.12.61] - 2023-05-14 -### Bug Fixes -- **table:** fixed table when a column contained a whitespace at the start or end - - - -## [v0.12.60] - 2023-05-11 -### Features -- **progressbar:** various progressbar improvements -- **progressbar:** various progressbar improvements -- **progressbar:** various progressbar improvements -- **rgb:** added RGBStyle - -### Test -- **rgb:** added RGBStyle tests - -### Code Refactoring -- **rgb:** removed 'GetValues' for 'RGBStyle' - - - -## [v0.12.59] - 2023-04-15 -### Features -- add optional mask to InteractiveTextInputPrinter - - - -## [v0.12.58] - 2023-04-03 -### Features -- **logger:** implemented structured logging -- **logger:** implemented structured logging -- **logger:** implemented structured logging -- **logger:** added logger -- **logger:** create logger -- **rgb:** made it possible to use RGB colors as background -- **rgb:** made it possible to use RGB colors as background -- **rgb:** made it possible to use RGB colors as background - -### Bug Fixes -- **rgb:** fix Fade maxValue == current not displaying the last color - - - -## [v0.12.57] - 2023-03-28 -### Code Refactoring -- use `pterm.Print` instead of `fmt.Print` functions - - - -## [v0.12.56] - 2023-03-14 -### Bug Fixes -- **table:** fixed panic when multiple lines contained color in a single row - - - -## [v0.12.55] - 2023-03-04 -### Features -- **table:** multiline support for table printer -- **table:** multiline support for table printer - -### Code Refactoring -- **table:** fixed linting - - - -## [v0.12.54] - 2023-01-22 -### Bug Fixes -- **tree:** print top node [#443](https://github.com/pterm/pterm/issues/443) - - - -## [v0.12.53] - 2023-01-05 -### Features -- **color:** added `color.ToStyle()` -- **color:** added `color.ToStyle()` -- **progressbar:** added optional title to `Start` method - -### Bug Fixes -- **prefix:** fixed line numbers in different print functions - - - -## [v0.12.52] - 2023-01-05 -### Features -- **multiselect:** added theme support for checkmarks -- **multiselect:** added theme support for checkmarks - -### Test -- **multiselect:** fixed test - -### Code Refactoring -- **progressbar:** make add more safe - - - -## [v0.12.51] - 2022-12-24 -### Bug Fixes -- Make sure the confirm printer can clean up after Ctrl+C - - - -## [v0.12.50] - 2022-11-22 -### Bug Fixes -- revert original test & add new test -- slice bounds out of range on select printer - - - -## [v0.12.49] - 2022-10-03 - - -## [v0.12.48] - 2022-10-02 -### Features -- custom select/confirm key for interactive printer -- add flag to disable filter/search for interactive printer - - - -## [v0.12.47] - 2022-09-19 -### Features -- adding interactive continue printer - -### Bug Fixes -- typo -- append the selected value to the prompt - -### Code Refactoring -- ignore invalid custom handles -- initiazile handles on getSuffix -- comment format -- address renaming PR comments -- show full handles by default -- use a map for the options - -### Reverts -- refactor: use a map for the options - - - -## [v0.12.46] - 2022-09-05 -### Features -- **putils:** add `CenterText` in putils - -### Bug Fixes -- **textinput:** fixed overwriting the default values - - - -## [v0.12.45] - 2022-07-26 -### Bug Fixes -- make sure the interactive printers can cleanup after Ctrl+C -- the interactive confirm answers should match the confirm/reject text - -### Test -- add tests for custom answers - - - -## [v0.12.44] - 2022-07-22 - - -## [v0.12.43] - 2022-07-17 -### Bug Fixes -- **spinner:** fix line didn't clear properly -- **table:** fixed column length calculation for Chinese strings - - - -## [v0.12.42] - 2022-06-21 -### Features -- **input:** added text input printer - - - -## [v0.12.41] - 2022-04-12 - - -## [v0.12.40] - 2022-03-28 -### Features -- added a custom writer for all printers - - - -## [v0.12.39] - 2022-03-18 -### Features -- use fallback color in `BigTextPrinter` when `RGB` is not supported - -### Test -- fix `BigTextPrinter` test -- removed `testdata` -- removed snapshot testing - - - -## [v0.12.38] - 2022-03-09 -### Features -- added `NewLettersFromStringWithRGB` -- added `NewLettersFromStringWithRGB` - -### Test -- **bigtext:** fix formatting error in bigtext test - - - -## [v0.12.37] - 2022-02-17 -### Features -- **progressbar:** Add option to set the `MaxWidth` of the progressbar - -### Test -- **progressbar:** added 100% test coverage for new features - -### Code Refactoring -- **putils:** Improved styling - - - -## [v0.12.36] - 2022-02-01 -### Features -- proposal horizontal table header row and row separators fixes -- proposal horizontal table header row and row separators changes -- proposal horizontal table header row and row separators changes -- proposal horizontal table header row and row separators changes -- proposal horizontal table header row and row separators changes -- proposal horizontal table header row and row separators changes -- proposal horizontal table header row and row separators -- proposal horizontal table header row and row separators changes -- proposal horizontal table header row and row separators changes -- proposal horizontal table header row and row separators -- proposal horizontal table header row and row separators -- proposal horizontal table header row and row separators -- proposal horizontal table header row and row separators -- proposal horizontal table header row and row separators -- proposal horizontal table header row and row separators -- proposal horizontal table header row and row separators -- proposal horizontal table header row and row separators - - - -## [v0.12.35] - 2022-02-01 -### Code Refactoring -- fix linting -- regenerate snapshots - - - -## [v0.12.34] - 2022-01-16 -### Bug Fixes -- **progressbar:** refresh progressbars on every PTerm print ([#302](https://github.com/pterm/pterm/issues/302)) - -### Test -- removed `AreaPrinter` test output -- **table:** changed mock reader from `os.Stdin` to `outBuf` - - - -## [v0.12.33] - 2021-10-24 -### Features -- add `PrintOnErrorf` for every `TextPrinter` ([#279](https://github.com/pterm/pterm/issues/279)) -- **coverage:** add unit test -- **progressbar:** made updating the progressbar title easier. ([#267](https://github.com/pterm/pterm/issues/267)) -- **table:** increase test coverage -- **table:** revamp to follow practice -- **table:** add support for right data alignment - -### Bug Fixes -- **idea:** revert unwanted config changes -- **linter:** do linter recommendation to delete fallthrough - - - -## [v0.12.32] - 2021-10-15 -### Features -- added `AreaPrinter.Clear()` - -### Bug Fixes -- progressbar method name -- **header:** fixed length calculation for Chinese strings - -### Code Refactoring -- change bitSize size - - - -## [v0.12.31] - 2021-09-21 -### Features -- **prefix:** added `LineNumberOffset` to `PrefixPrinter` - - - -## [v0.12.30] - 2021-08-16 -### Bug Fixes -- **style:** resetting to previous color also resets attributes - -### Code Refactoring -- adapt new testza function name - - - -## [v0.12.29] - 2021-07-19 -### Features -- **putils:** add `PrintAverageExecutionTime` - -### Test -- fix rgb error test -- fix internal test import cycle -- move tests into own package - -### Code Refactoring -- replace `testify` with `testza` - - - -## [v0.12.28] - 2021-07-17 -### Features -- **spinner:** add option to show a timer - -### Bug Fixes -- **bar chart:** fix panic when rendering empty horizontal bar chart - -### Test -- **spinner:** try to fix RawOutput text -- **spinner:** add raw output test - -### Code Refactoring -- **spinner:** better raw output logic -- **spinner:** refactor - - - -## [v0.12.27] - 2021-07-05 -### Bug Fixes -- **style:** fix multiline style coloring - -### Test -- **style:** fix multiline style coloring -- **style:** fix multiline style coloring - - - -## [v0.12.26] - 2021-07-01 -### Bug Fixes -- **spinner:** Override previous text in `UpdateText` - - - -## [v0.12.25] - 2021-07-01 -### Features -- **table:** add `Boxed` option - -### Test -- add tests for boxed `TablePrinter` - - - -## [v0.12.24] - 2021-06-13 -### Features -- **boxprinter:** replace line breaks in title with space -- **boxprinter:** add title center position to `BoxPrinter` -- **boxprinter:** add title & title position to `BoxPrinter` -- **boxprinter:** add title & title position to `BoxPrinter` -- **putils:** add `TableDataFromSeparatedValues` -- **putils:** add `TableDataFromTSV` -- **putils:** add `TableDataFromCSV` -- **putils:** add function to convert TSV to `TableData` -- **putils:** add function to convert CSV to `TableData` - -### Test -- add test for putils `TableData` generation -- **boxprinter:** add tests for title center position to `BoxPrinter` -- **boxprinter:** add tests for title & title position - -### Code Refactoring -- **boxprinter:** prefix title positions with `Title` -- **putils:** add `rowSeparator` to `TableFromSeparatedValues` - - - -## [v0.12.23] - 2021-06-07 -### Features -- Add util functions to create tables from slices of structs ([#217](https://github.com/pterm/pterm/issues/217)) - -### Bug Fixes -- **headerprinter:** don't panic if content width > terminal width - -### Test -- **prefix:** `pterm.Error` default no line number shown - -### Code Refactoring -- **prefix:** `pterm.Error` default no line number shown - - - -## [v0.12.22] - 2021-05-30 -### Features -- make spinner update faster - -### Performance Improvements -- improve performance of `SpinnerPrinter` - - - -## [v0.12.21] - 2021-05-30 -### Features -- print lines above active spinners -- **putils:** add `DownloadFileWithProgressbar` - -### Test -- clear active spinners after tests complete - -### Code Refactoring -- **putils:** change internal variable name - - - -## [v0.12.20] - 2021-05-29 -### Features -- force color output by default - - - -## [v0.12.19] - 2021-05-29 -### Features -- add `PrintOnError` for all printers and interface -- **putils:** add `putils` package ([#206](https://github.com/pterm/pterm/issues/206)) - -### Bug Fixes -- **header:** fix multiline header - -### Test -- add tests for all printers for `PrintOnError` - -### Code Refactoring -- make `PrintOnError` return `*TextPrinter` -- **area:** better height calculation - - - -## [v0.12.18] - 2021-05-22 -### Features -- add `AreaPrinter` -- **area:** add `Center` option -- **area:** add `Fullscreen` option -- **area:** add `GetContent` function -- **area:** add `AreaPrinter` - -### Test -- **area:** fix tests for `AreaPrinter` -- **area:** add `AreaPrinter` tests - -### Code Refactoring -- fix linting errors - - - -## [v0.12.17] - 2021-05-14 -### Bug Fixes -- fix `pterm.Fatal.Printfln` not panicking -- **prefix:** fix `pterm.Fatal.Printfln` not panicking and had output in debug mode - -### Test -- **prefix:** add tests for `Sprintfln` and `Printfln` function when in debug mode - - - -## [v0.12.16] - 2021-05-13 -### Code Refactoring -- **prefix:** make `PrintOnError` accept multiple inputs - - - -## [v0.12.15] - 2021-05-13 -### Features -- add raw output mode for `BarChart` -- add disable styling boolean option -- **bigtext:** add raw output mode -- **centerprinter:** add raw output mode -- **headerprinter:** add raw output mode -- **panelprinter:** add raw output mode -- **paragraph:** add raw output mode -- **prefix:** add `PrintIfError` -- **prefix:** add raw output mode -- **progressbar:** add raw output mode -- **spinner:** add raw output mode - -### Bug Fixes -- **prefix:** fix `PrintOnError` - -### Test -- add tests with `RawOutput` enabled -- add interface tests for `Color` and `RGB` -- added tests for `DisableStyling` and `EnableStyling` - -### Code Refactoring -- correct behaviour of Enable-/DisableStyling -- fix variable names - - - -## [v0.12.14] - 2021-05-09 -### Features -- **basic-text:** add `Sprintfln` and `Printfln` function -- **boxprinter:** add `Sprintfln` and `Printfln` function -- **centerprinter:** add `Sprintfln` and `Printfln` function -- **color:** add `Sprintfln` and `Printfln` function -- **header:** add `Sprintfln` and `Printfln` function -- **paragraph:** add `Sprintfln` and `Printfln` function -- **prefix:** add `Sprintfln` and `Printfln` function -- **print:** add `Sprintfln` and `Printfln` function -- **printer-interface:** add `Sprintfln` and `Printfln` to the interface -- **rgb:** add `Sprintfln` and `Printfln` function -- **section:** add `Sprintfln` and `Printfln` function - -### Bug Fixes -- **header:** fix inline color in `Header` - -### Test -- add tests for `Sprintfln` and `Printfln` function - -### Code Refactoring -- refactor `Sprintfln` and `Printfln` func. for better performance - -### Reverts -- ci: change color scheme for rendered examples - - - -## [v0.12.13] - 2021-04-10 -### Bug Fixes -- **bigtext:** fix height of some characters [#180](https://github.com/pterm/pterm/issues/180) -- **color:** make color implement `TextPrinter` - -### Test -- add interface tests - -### Code Refactoring -- **examples:** center the intro of `demo` -- **examples:** add note to box printer - - - -## [v0.12.12] - 2021-03-01 -### Features -- **prefixprinter:** Add option to show line number of caller - -### Code Refactoring -- **examples:** Update `PrefixPrinter` example - - - -## [v0.12.11] - 2021-02-26 -### Code Refactoring -- refactor print logic of `BoxPrinter` -- refactor print logic of `CenterPrinter` - - - -## [v0.12.10] - 2021-02-26 -### Bug Fixes -- correct `pterm.Println()` behaviour to fit to `fmt.Println()` - - - -## [v0.12.9] - 2021-02-23 -### Bug Fixes -- correct `pterm.Println()` behaviour to fit to `fmt.Println()` -- change terminal package import path to updated version - - - -## [v0.12.8] - 2020-12-11 -### Features -- **boxprinter:** add `WithHorizontalString` to `BoxPrinter` -- **boxprinter:** add `BoxPrinter` -- **panel:** add optional border for `Panel` -- **panelprinter:** add theme support to `PanelPrinter` -- **theme:** add `BoxStyle` and `BoxTextStyle` -- **theme:** add optional theme for border in `Panel` - -### Bug Fixes -- revert change horizontal string change - -### Test -- **boxprinter:** add test -- **boxprinter:** test multiple lines in one box -- **boxprinter:** add tests for `BoxPrinter` -- **panelprinter:** add tests for adding box printer -- **panelprinter:** add tests for optional border for `Panel` -- **theme:** add tests for `BoxStyle` and `BoxTextStyle` - -### Code Refactoring -- remove analytics -- **boxprinter:** return theme when style is nil -- **boxprinter:** change `DefaultBox` top and bottom padding to 0 -- **boxprinter:** fix spacing between boxes and in boxes -- **boxprinter:** refactor code -- **boxprinter:** change from `RenderablePrinter` to `TextPrinter` -- **panelprinter:** add `BoxPrinter` to surround panels with a fully custom box -- **panelprinter:** optional border for `Panel` - - - -## [v0.12.7] - 2020-11-24 -### Features -- add values to chart -- add horizontal `BarChartPrinter` -- add `BarChartPrinter` -- add `BarChartPrinter` -- add `BarChartPrinter` -- **theme:** add theme support to `BarChart` - -### Bug Fixes -- center bars over colored labels in `BarChart` - -### Test -- add tests to `BarChartPrinter` - - - -## [v0.12.6] - 2020-11-17 -### Bug Fixes -- disabling output works as expected now ([#149](https://github.com/pterm/pterm/issues/149)) - - - -## [v0.12.5] - 2020-11-17 -### Bug Fixes -- fix `PrefixPrinter` with multiple trailing newline endings. - - - -## [v0.12.4] - 2020-11-17 -### Bug Fixes -- fix `Printf` of `PrefixPrinter` - - - -## [v0.12.3] - 2020-11-12 -### Test -- reduce tests -- different test logic for rgb printing -- add better test names for `RGB` tests - - - -## [v0.12.2] - 2020-11-05 -### Features -- color each line separately when using multi line input - -### Bug Fixes -- fix internal `GetStringMaxWidth` max width - -### Test -- **basictext:** proxy print functions to DevNull -- **progressbar:** proxy print functions to DevNull - -### Code Refactoring -- use `pterm.Sprint` to print - - - -## [v0.12.1] - 2020-11-04 -### Bug Fixes -- **panel:** Fix output when input is colored - -### Performance Improvements -- **header:** calculate margin faster - - - -## [v0.12.0] - 2020-11-04 -### Features -- **panel:** add an option to make a padding beneath `panel` -- **panel:** add an option to make columns the same length - -### Bug Fixes -- **panel:** add invalid check for `padding` in `panel` - -### Test -- **bulletlist:** `BulletListItem` remove `Render` and `Srender` -- **bulletlist:** change `BulletList` to `BulletListPrinter` -- **panel:** add invalid check for `padding` in `panel` -- **panel:** add test for `WithBottomPadding` -- **panel:** add test for `WithSameColumnWidth` & multiple `panel` -- **panel:** add test for `WithSameColumnWidth` -- **progressbar:** change directory name `progressbar_test` to `progressbar_printer_test` -- **progressbar:** change `Progressbar` to `ProgressbarPrinter` -- **spinner:** change directory name `spinner_test` to `spinner_printer_test` -- **spinner:** change `Spinner` to `SpinnerPrinter` -- **table:** change `Table` to `TablePrinter` -- **tree:** change `Tree` to `TreePrinter` - -### Code Refactoring -- make all printer names end with `Printer` ([#134](https://github.com/pterm/pterm/issues/134)) -- **bulletlist:** remove `DefaultBulletListItem` -- **bulletlist:** `BulletListItem` remove `Render` and `Srender` -- **bulletlist:** `BulletListItem` is no renderable anymore -- **bulletlist:** change `BulletList` to `BulletListPrinter` -- **progressbar:** change `ActiveProgressbars` to `ActiveProgressbarPrinters` -- **progressbar:** change directory name `progressbar` to `progressbar_printer` -- **progressbar:** change `Progressbar` to `ProgressbarPrinter` -- **spinner:** change directory name `spinner` to `spinner_printer` -- **spinner:** change `Spinner` to `SpinnerPrinter` -- **table:** change `Table` to `TablePrinter` -- **tree:** change `Tree` to `TreePrinter` - -### BREAKING CHANGE - -Removed `DefaultBulletListItem`. - -Change names of printers which didn't end with `Printer`. Every printer name ends with `Printer` now to fit into the new naming convention. - -change `ActiveProgressbars` to `ActiveProgressbarPrinters` - -`BulletListItem` is no renderable anymore, removed `Render` and `Srender` - -`BulletListItem` is no renderable anymore, removed `Render` and `Srender` - -`BulletListItem` is no renderable anymore - -change `Tree` to `TreePrinter` to unify the naming scheme - -change `Tree` to `TreePrinter` to unify the naming scheme - -change `Table` to `TablePrinter` to unify the naming scheme - -change `Table` to `TablePrinter` to unify the naming scheme - -change `Spinner` to `SpinnerPrinter` to unify the naming scheme - -change `Spinner` to `SpinnerPrinter` to unify the naming scheme - -change `Progressbar` to `ProgressbarPrinter` to unify the naming scheme - -change `Progressbar` to `ProgressbarPrinter` to unify the naming scheme - -change `BulletList` to `BulletListPrinter` to unify the naming scheme - -change `BulletList` to `BulletListPrinter` to unify the naming scheme - - - -## [v0.11.0] - 2020-11-03 -### Features -- add `PanelPrinter` - -### Bug Fixes -- **centerprinter:** make centerprinter func return pointer - -### BREAKING CHANGE - -make centerprinter func `WithCenterEachLineSeparately` return a pointer of centerprinter - - - -## [v0.10.1] - 2020-11-02 -### Features -- add `CenterPrinter` - - - -## [v0.10.0] - 2020-11-01 -### Features -- make printers return errors -- add `DisableOutput()` and `EnableOutput()` ([#108](https://github.com/pterm/pterm/issues/108)) - -### Code Refactoring -- ignore errors where no errors can occur -- **theme:** change `ListTextStyle` to `BulletListTextStyle` ([#104](https://github.com/pterm/pterm/issues/104)) -- **theme:** change `ProgressbarBarStyle` to `FgCyan` ([#106](https://github.com/pterm/pterm/issues/106)) -- **theme:** change white to default color in `Theme` ([#103](https://github.com/pterm/pterm/issues/103)) - -### BREAKING CHANGE - -Interface of `RenderablePrinter` and `LivePrinter` changed. - -The global variable `DisableOutput` was renamed to `Output`. - - - -## [v0.9.3] - 2020-10-31 -### Features -- add a levelList converter for TreeListPrinter -- add `TreeListPrinter` as a renderable printer -- add `TreeListPrinter` as a renderable printer -- **theme:** add theme support for `Tree` - -### Test -- **tree:** add `Tree` tests - -### Code Refactoring -- clean up `Tree` -- **theme:** change `TreeTextStyle` to `FgDefault` -- **tree:** add Indent to control the spacing between levels and changed docs(examples) -- **tree:** add more spacing between levels -- **tree:** refactor `Tree` code and write tests for `Tree` -- **tree:** refactor `Tree` code and write tests for `Tree` -- **tree:** refactor `Tree` code -- **tree:** refactor `Tree` code -- **tree:** refactor `Tree` code - - - -## [v0.9.2] - 2020-10-29 -### Features -- add option to disable and enable colors - - - -## [v0.9.1] - 2020-10-27 -### Code Refactoring -- make the prefix of `Info` smaller again - - - -## [v0.9.0] - 2020-10-27 -### Features -- add `Debug` `PrefixPrinter` -- add support for enabling and disabling debug messages - -### Bug Fixes -- progressbar disappears when done and something is printed after - -### Test -- add debugger tests to `PrefixPrinter` -- add progressbar tests - -### Code Refactoring -- remove `UpdateDelay` from `Progressbar` -- change `NewList` to `NewBulletList` -- change `NewList` to `NewBulletList` -- deprecate `UpdateDelay` in `Progressbar` - -### BREAKING CHANGE - -Removed `UpdateDelay` from `Progressbar`. It's no longer used. The Progressbar automatically updates on every change to the current value. - -Changed `NewList` to `NewBulletList`. - - - -## [v0.8.1] - 2020-10-26 -### Features -- add fade from one RGB over several RGBs to another RGB - -### Code Refactoring -- refactor doc -- refactor code - - - -## [v0.8.0] - 2020-10-24 -### Features -- add `BigTextPrinter` ([#75](https://github.com/pterm/pterm/issues/75)) -- use level of section printer -- add `BulletListPrinter` ([#67](https://github.com/pterm/pterm/issues/67)) - -### Test -- test that `%s` won't fail to print - -### Code Refactoring -- make `BigTextPrinter` release ready -- change `LineCharacter` to `BarCharacter` ([#70](https://github.com/pterm/pterm/issues/70)) - -### BREAKING CHANGE - -Changed `LineCharacter` to `BarCharacter`. - - - -## [v0.7.0] - 2020-10-20 -### Features -- **progressbar:** add RemoveWhenDone - -### Bug Fixes -- make theme accept pointer styles -- make Spinner accept pointer Style -- make WithMessageStyle accept Style pointer -- add nil check to SectionPrinter Style -- section printer Style to pointer - -### Test -- add tests color and style -- add tests to root print functions -- add tests to progressbar -- add tests to terminal -- add tests to theme -- fix internal percentage test -- add tests to Spinner -- add tests for TablePrinter -- special tests for special statements -- complete PrefixPrinter tests -- add PrefixPrinter tests -- rename HeaderPrinter tests -- complete HeaderPrinter tests -- add ParagraphPrinter tests -- add HeaderPrinter tests -- make unit test system check different types -- add SectionPrinter tests -- implement test utils -- add rgb tests - -### Code Refactoring -- use log output -- remove obsolete if -- fit progressbar to new percentage calculation method -- make fatal panic -- rename parameters -- don't show empty line when removing a progressbar - - - -## [v0.6.1] - 2020-10-20 -### Bug Fixes -- fix RGB methods - - - -## [v0.6.0] - 2020-10-19 -### Features -- add BasicTextPrinter -- add theme support to section and table printer -- add theme support to spinner -- add theme support to headers -- add template support for progressbars -- add default theme - -### Test -- **benchmark:** fix spinner benchmark - -### Code Refactoring -- make printers accept pointers to styles -- remove emojis to comply with cross-platform policy -- change LivePrinter interface to pointer output -- change TextPrinter interface to pointer output - -### BREAKING CHANGE - -All printers only accept pointers as any `Style` attribute. - -LivePrinter now requires to return a pointer. - -TextPrinter now requires to return a pointer. - - - -## [v0.5.1] - 2020-10-14 -### Features -- add ability to disable output ([#44](https://github.com/pterm/pterm/issues/44)) -- add `Srender` to `RenderPrinter` interface -- add csv table support ([#42](https://github.com/pterm/pterm/issues/42)) -- add HEX to RGB converter in `RGB` ([#41](https://github.com/pterm/pterm/issues/41)) -- add theme to generated animations -- add color fade example ([#38](https://github.com/pterm/pterm/issues/38)) -- implement `TextPrinter` into `RGB` -- implement color fade to `Progressbar` ([#37](https://github.com/pterm/pterm/issues/37)) -- add color fade function and `RBG` ([#34](https://github.com/pterm/pterm/issues/34)) -- change `Section` style - -### Code Refactoring -- declare function name as `WithCSVReader` - - - -## [v0.5.0] - 2020-10-08 -### Features -- implement `LivePrinter` in `Spinner` -- add `BottomPadding` to `SectionPrinter` -- add `RenderPrinter` interface -- implement `LivePrinter` in `Progressbar` -- add `LivePrinter` interface -- add `TablePrinter` ([#27](https://github.com/pterm/pterm/issues/27)) -- add `ParagraphPrinter` ([#24](https://github.com/pterm/pterm/issues/24)) - -### Test -- add `Print` equals `Sprint` tests for `GenericPrinter` -- add `Spinner` benchmarks - -### Code Refactoring -- rename spinner_printer.go to spinner.go -- rename `GenericPrinter` to `TextPrinter` - -### BREAKING CHANGE - -The `GenericPrinter` is now called `TextPrinter`. - - - -## [v0.4.1] - 2020-10-07 - - -## [v0.4.0] - 2020-10-07 -### Features -- add `Add` to `Style` -- add options shorthands to `SectionPrinter` - -### Test -- ignore writer close errors in stdout capture - -### Code Refactoring -- use `Style` instead of colors -- refactor function parameters to fit expectation -- rename `RemoveColors` to `RemoveColorFromString` - -### BREAKING CHANGE - -use `Style` instead of colors - -Refactor function parameters to fit expectation. -Affects: `WithStyle(colors -> style)`, `WithScope(string, colors -> scope)` - -rename `RemoveColors` to `RemoveColorFromString` - - - -## [v0.3.2] - 2020-10-06 -### Features -- add `SectionPrinter` - -### Bug Fixes -- fix `Sprintf` function of `HeaderPrinter` - -### Test -- add tests for `HeaderPrinter` and `SectionPrinter` - - - -## [v0.3.1] - 2020-10-06 -### Features -- add `BarFiller` to `Progressbar` - -### Test -- fix import cycle -- change to inbuilt `SetDefaultOutput` option -- add more benchmarks -- add benchmarks -- add tests to `GenericPrinter` and default print methods - -### Code Refactoring -- set default `BarFiller` to space -- move tests directly into `pterm` module - - - -## [v0.3.0] - 2020-10-05 -### Bug Fixes -- fix `WithXYZ(b ...bool)` to detect booleans correctly - -### Code Refactoring -- remove `Version` constant -- change `WithXXX(b bool)` to `WithXXX(b ...bool)` -- change `SetXXX` to `WithXXX` -- change `Header` to `DefaultHeader` - -### BREAKING CHANGE - -remove `Version` constant - -rename `SetXXX` to `WithXXX` - -rename `Header` to `DefaultHeader` - - - -## [v0.2.4] - 2020-10-04 -### Bug Fixes -- `Printf` works again - - - -## [v0.2.3] - 2020-10-04 -### Features -- automatically print above `Progressbar` - -### Code Refactoring -- remove goroutine from `Progressbar` - - - -## [v0.2.2] - 2020-10-04 -### Features -- add `Fatal` printer - - - -## [v0.2.1] - 2020-10-04 -### Features -- make progressbar configurable -- add percentage helper -- add `RemoveColors` -- add `Progressbar` ([#5](https://github.com/pterm/pterm/issues/5)) -- add `Progressbar` -- add fatal to `PrefixPrinter` ([#4](https://github.com/pterm/pterm/issues/4)) -- **progressbar:** fade percentage color according to value - -### Code Refactoring -- bump version to "v0.2.1" - - - -## [v0.2.0] - 2020-09-30 -### Features -- change style of `Description` printer -- add color in color support -- add `RemoveWhenDone` to `Spinner` -- add multiline support to `PrefixPrinter` -- add `UpdateText` to spinner - -### Bug Fixes -- spinners spin evenly when multiple spinners are started - -### Performance Improvements -- improve spinner performance - -### Code Refactoring -- bump version to "v0.2.0" -- change `WithXXX` to `SetXXX` -- removed `Println` aliases - -### BREAKING CHANGE - -every `WithXXX` is renamed to `SetXXX` - -remove `GetFormattedMessage` from `PrefixPrinter` - -removed `Println` aliases - - - -## [v0.1.0] - 2020-09-28 -### Features -- add spinners -- shorten printer names and add builder methods to printers -- add `Printo` to override printed text -- add `FullWidth` to `HeaderPrinter` -- add terminal size detection - -### Code Refactoring -- bump version to "v0.1.0" -- consistent example code for `Printo` -- better comments for `Printo` -- simplify `HeaderPrinter` - -### BREAKING CHANGE - -printer names changed - -removed `Header` and put it's content directly into `HeaderPrinter` - - - -## [v0.0.1] - 2020-09-21 -### Features -- add aliases to default printers -- add header example -- integrate ci -- add `HeaderPrinter` -- add exported version variable -- add example `override-default-printer` -- change prefix text color to `LightWhite` - -### Bug Fixes -- header should now work in CI - -### Code Refactoring -- bump version to "v0.0.1" -- refactor project -- add comments to functions - - - -## v0.0.0 - 2020-09-18 -### Features -- add changelog template -- configs -- initial commit - - -[Unreleased]: https://github.com/pterm/pterm/compare/v0.12.61...HEAD -[v0.12.61]: https://github.com/pterm/pterm/compare/v0.12.60...v0.12.61 -[v0.12.60]: https://github.com/pterm/pterm/compare/v0.12.59...v0.12.60 -[v0.12.59]: https://github.com/pterm/pterm/compare/v0.12.58...v0.12.59 -[v0.12.58]: https://github.com/pterm/pterm/compare/v0.12.57...v0.12.58 -[v0.12.57]: https://github.com/pterm/pterm/compare/v0.12.56...v0.12.57 -[v0.12.56]: https://github.com/pterm/pterm/compare/v0.12.55...v0.12.56 -[v0.12.55]: https://github.com/pterm/pterm/compare/v0.12.54...v0.12.55 -[v0.12.54]: https://github.com/pterm/pterm/compare/v0.12.53...v0.12.54 -[v0.12.53]: https://github.com/pterm/pterm/compare/v0.12.52...v0.12.53 -[v0.12.52]: https://github.com/pterm/pterm/compare/v0.12.51...v0.12.52 -[v0.12.51]: https://github.com/pterm/pterm/compare/v0.12.50...v0.12.51 -[v0.12.50]: https://github.com/pterm/pterm/compare/v0.12.49...v0.12.50 -[v0.12.49]: https://github.com/pterm/pterm/compare/v0.12.48...v0.12.49 -[v0.12.48]: https://github.com/pterm/pterm/compare/v0.12.47...v0.12.48 -[v0.12.47]: https://github.com/pterm/pterm/compare/v0.12.46...v0.12.47 -[v0.12.46]: https://github.com/pterm/pterm/compare/v0.12.45...v0.12.46 -[v0.12.45]: https://github.com/pterm/pterm/compare/v0.12.44...v0.12.45 -[v0.12.44]: https://github.com/pterm/pterm/compare/v0.12.43...v0.12.44 -[v0.12.43]: https://github.com/pterm/pterm/compare/v0.12.42...v0.12.43 -[v0.12.42]: https://github.com/pterm/pterm/compare/v0.12.41...v0.12.42 -[v0.12.41]: https://github.com/pterm/pterm/compare/v0.12.40...v0.12.41 -[v0.12.40]: https://github.com/pterm/pterm/compare/v0.12.39...v0.12.40 -[v0.12.39]: https://github.com/pterm/pterm/compare/v0.12.38...v0.12.39 -[v0.12.38]: https://github.com/pterm/pterm/compare/v0.12.37...v0.12.38 -[v0.12.37]: https://github.com/pterm/pterm/compare/v0.12.36...v0.12.37 -[v0.12.36]: https://github.com/pterm/pterm/compare/v0.12.35...v0.12.36 -[v0.12.35]: https://github.com/pterm/pterm/compare/v0.12.34...v0.12.35 -[v0.12.34]: https://github.com/pterm/pterm/compare/v0.12.33...v0.12.34 -[v0.12.33]: https://github.com/pterm/pterm/compare/v0.12.32...v0.12.33 -[v0.12.32]: https://github.com/pterm/pterm/compare/v0.12.31...v0.12.32 -[v0.12.31]: https://github.com/pterm/pterm/compare/v0.12.30...v0.12.31 -[v0.12.30]: https://github.com/pterm/pterm/compare/v0.12.29...v0.12.30 -[v0.12.29]: https://github.com/pterm/pterm/compare/v0.12.28...v0.12.29 -[v0.12.28]: https://github.com/pterm/pterm/compare/v0.12.27...v0.12.28 -[v0.12.27]: https://github.com/pterm/pterm/compare/v0.12.26...v0.12.27 -[v0.12.26]: https://github.com/pterm/pterm/compare/v0.12.25...v0.12.26 -[v0.12.25]: https://github.com/pterm/pterm/compare/v0.12.24...v0.12.25 -[v0.12.24]: https://github.com/pterm/pterm/compare/v0.12.23...v0.12.24 -[v0.12.23]: https://github.com/pterm/pterm/compare/v0.12.22...v0.12.23 -[v0.12.22]: https://github.com/pterm/pterm/compare/v0.12.21...v0.12.22 -[v0.12.21]: https://github.com/pterm/pterm/compare/v0.12.20...v0.12.21 -[v0.12.20]: https://github.com/pterm/pterm/compare/v0.12.19...v0.12.20 -[v0.12.19]: https://github.com/pterm/pterm/compare/v0.12.18...v0.12.19 -[v0.12.18]: https://github.com/pterm/pterm/compare/v0.12.17...v0.12.18 -[v0.12.17]: https://github.com/pterm/pterm/compare/v0.12.16...v0.12.17 -[v0.12.16]: https://github.com/pterm/pterm/compare/v0.12.15...v0.12.16 -[v0.12.15]: https://github.com/pterm/pterm/compare/v0.12.14...v0.12.15 -[v0.12.14]: https://github.com/pterm/pterm/compare/v0.12.13...v0.12.14 -[v0.12.13]: https://github.com/pterm/pterm/compare/v0.12.12...v0.12.13 -[v0.12.12]: https://github.com/pterm/pterm/compare/v0.12.11...v0.12.12 -[v0.12.11]: https://github.com/pterm/pterm/compare/v0.12.10...v0.12.11 -[v0.12.10]: https://github.com/pterm/pterm/compare/v0.12.9...v0.12.10 -[v0.12.9]: https://github.com/pterm/pterm/compare/v0.12.8...v0.12.9 -[v0.12.8]: https://github.com/pterm/pterm/compare/v0.12.7...v0.12.8 -[v0.12.7]: https://github.com/pterm/pterm/compare/v0.12.6...v0.12.7 -[v0.12.6]: https://github.com/pterm/pterm/compare/v0.12.5...v0.12.6 -[v0.12.5]: https://github.com/pterm/pterm/compare/v0.12.4...v0.12.5 -[v0.12.4]: https://github.com/pterm/pterm/compare/v0.12.3...v0.12.4 -[v0.12.3]: https://github.com/pterm/pterm/compare/v0.12.2...v0.12.3 -[v0.12.2]: https://github.com/pterm/pterm/compare/v0.12.1...v0.12.2 -[v0.12.1]: https://github.com/pterm/pterm/compare/v0.12.0...v0.12.1 -[v0.12.0]: https://github.com/pterm/pterm/compare/v0.11.0...v0.12.0 -[v0.11.0]: https://github.com/pterm/pterm/compare/v0.10.1...v0.11.0 -[v0.10.1]: https://github.com/pterm/pterm/compare/v0.10.0...v0.10.1 -[v0.10.0]: https://github.com/pterm/pterm/compare/v0.9.3...v0.10.0 -[v0.9.3]: https://github.com/pterm/pterm/compare/v0.9.2...v0.9.3 -[v0.9.2]: https://github.com/pterm/pterm/compare/v0.9.1...v0.9.2 -[v0.9.1]: https://github.com/pterm/pterm/compare/v0.9.0...v0.9.1 -[v0.9.0]: https://github.com/pterm/pterm/compare/v0.8.1...v0.9.0 -[v0.8.1]: https://github.com/pterm/pterm/compare/v0.8.0...v0.8.1 -[v0.8.0]: https://github.com/pterm/pterm/compare/v0.7.0...v0.8.0 -[v0.7.0]: https://github.com/pterm/pterm/compare/v0.6.1...v0.7.0 -[v0.6.1]: https://github.com/pterm/pterm/compare/v0.6.0...v0.6.1 -[v0.6.0]: https://github.com/pterm/pterm/compare/v0.5.1...v0.6.0 -[v0.5.1]: https://github.com/pterm/pterm/compare/v0.5.0...v0.5.1 -[v0.5.0]: https://github.com/pterm/pterm/compare/v0.4.1...v0.5.0 -[v0.4.1]: https://github.com/pterm/pterm/compare/v0.4.0...v0.4.1 -[v0.4.0]: https://github.com/pterm/pterm/compare/v0.3.2...v0.4.0 -[v0.3.2]: https://github.com/pterm/pterm/compare/v0.3.1...v0.3.2 -[v0.3.1]: https://github.com/pterm/pterm/compare/v0.3.0...v0.3.1 -[v0.3.0]: https://github.com/pterm/pterm/compare/v0.2.4...v0.3.0 -[v0.2.4]: https://github.com/pterm/pterm/compare/v0.2.3...v0.2.4 -[v0.2.3]: https://github.com/pterm/pterm/compare/v0.2.2...v0.2.3 -[v0.2.2]: https://github.com/pterm/pterm/compare/v0.2.1...v0.2.2 -[v0.2.1]: https://github.com/pterm/pterm/compare/v0.2.0...v0.2.1 -[v0.2.0]: https://github.com/pterm/pterm/compare/v0.1.0...v0.2.0 -[v0.1.0]: https://github.com/pterm/pterm/compare/v0.0.1...v0.1.0 -[v0.0.1]: https://github.com/pterm/pterm/compare/v0.0.0...v0.0.1 diff --git a/vendor/github.com/pterm/pterm/README.md b/vendor/github.com/pterm/pterm/README.md index b874ef12..6a9cd784 100644 --- a/vendor/github.com/pterm/pterm/README.md +++ b/vendor/github.com/pterm/pterm/README.md @@ -44,8 +44,8 @@ PTerm -

Show Demo Code

+

Show Demo Code

@@ -92,25 +92,30 @@ go get github.com/pterm/pterm ### Printers (Components) +
+ | Feature | Feature | Feature | Feature | Feature | | :-------: | :-------: | :-------: | :-------: | :-------: | | Area
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/area) |Barchart
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/barchart) |Basictext
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/basictext) |Bigtext
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/bigtext) |Box
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/box) | -| Bulletlist
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/bulletlist) |Center
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/center) |Coloring
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/coloring) |Demo
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/demo) |Header
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/header) | +| Bulletlist
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/bulletlist) |Center
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/center) |Coloring
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/coloring) |Header
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/header) |Heatmap
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/heatmap) | | Interactive confirm
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/interactive_confirm) |Interactive continue
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/interactive_continue) |Interactive multiselect
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/interactive_multiselect) |Interactive select
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/interactive_select) |Interactive textinput
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/interactive_textinput) | -| Logger
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/logger) |Panel
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/panel) |Paragraph
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/paragraph) |Prefix
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/prefix) |Progressbar
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/progressbar) | -| Section
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/section) |Spinner
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/spinner) |Style
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/style) |Table
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/table) |Theme
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/theme) | -| Tree
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/tree) | | | | | +| Logger
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/logger) |Multiple-live-printers
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/multiple-live-printers) |Panel
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/panel) |Paragraph
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/paragraph) |Prefix
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/prefix) | +| Progressbar
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/progressbar) |Section
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/section) |Slog
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/slog) |Spinner
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/spinner) |Style
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/style) | +| Table
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/table) |Theme
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/theme) |Tree
[(Examples)](https://github.com/pterm/pterm/tree/master/_examples/tree) | | | +
+ +---
-### 🦸‍♂️ Supporters +### 🦸‍♂️ Sponsors + + -|-|User|💸| -|---|---|---| -|![Jens Lauterbach](https://avatars.githubusercontent.com/u/1292368?s=25)|[@jenslauterbach](https://github.com/jenslauterbach)|25$| +---
@@ -130,9 +135,9 @@ go get github.com/pterm/pterm

-### area/center +### area/demo -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/area/center/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/area/demo/animation.svg)
@@ -145,16 +150,37 @@ import ( "time" "github.com/pterm/pterm" + "github.com/pterm/pterm/putils" ) func main() { + // Print an informational message using PTerm's Info printer. + // This message will stay in place while the area updates. + pterm.Info.Println("The previous text will stay in place, while the area updates.") + + // Print two new lines as spacer. + pterm.Print("\n\n") + + // Start the Area printer from PTerm's DefaultArea, with the Center option. + // The Area printer allows us to update a specific area of the console output. + // The returned 'area' object is used to control the area updates. area, _ := pterm.DefaultArea.WithCenter().Start() - for i := 0; i < 5; i++ { - area.Update(pterm.Sprintf("Current count: %d\nAreas can update their content dynamically!", i)) + // Loop 10 times to update the area with the current time. + for i := 0; i < 10; i++ { + // Get the current time, format it as "15:04:05" (hour:minute:second), and convert it to a string. + // Then, create a BigText from the time string using PTerm's DefaultBigText and putils NewLettersFromString. + // The Srender() function is used to save the BigText as a string. + str, _ := pterm.DefaultBigText.WithLetters(putils.LettersFromString(time.Now().Format("15:04:05"))).Srender() + + // Update the Area contents with the current time string. + area.Update(str) + + // Sleep for a second before the next update. time.Sleep(time.Second) } + // Stop the Area printer after all updates are done. area.Stop() } @@ -162,9 +188,9 @@ func main() {
-### area/default +### area/center -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/area/default/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/area/center/animation.svg)
@@ -180,13 +206,21 @@ import ( ) func main() { - area, _ := pterm.DefaultArea.Start() + // Start a new default area in the center of the terminal. + // The Start() function returns the created area and an error. + area, _ := pterm.DefaultArea.WithCenter().Start() + // Loop 5 times to simulate a dynamic update. for i := 0; i < 5; i++ { + // Update the content of the area with the current count. + // The Sprintf function is used to format the string. area.Update(pterm.Sprintf("Current count: %d\nAreas can update their content dynamically!", i)) + + // Pause for a second to simulate a time-consuming task. time.Sleep(time.Second) } + // Stop the area after all updates are done. area.Stop() } @@ -194,9 +228,9 @@ func main() {
-### area/demo +### area/default -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/area/demo/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/area/default/animation.svg)
@@ -212,15 +246,22 @@ import ( ) func main() { - pterm.Info.Println("The previous text will stay in place, while the area updates.") - pterm.Print("\n\n") // Add two new lines as spacer. + // Start a new default area and get a reference to it. + // The second return value is an error which is ignored here. + area, _ := pterm.DefaultArea.Start() - area, _ := pterm.DefaultArea.WithCenter().Start() // Start the Area printer, with the Center option. - for i := 0; i < 10; i++ { - str, _ := pterm.DefaultBigText.WithLetters(pterm.NewLettersFromString(time.Now().Format("15:04:05"))).Srender() // Save current time in str. - area.Update(str) // Update Area contents. + // Loop 5 times + for i := 0; i < 5; i++ { + // Update the content of the area dynamically. + // Here we're just displaying the current count. + area.Update(pterm.Sprintf("Current count: %d\nAreas can update their content dynamically!", i)) + + // Pause for a second before the next update. time.Sleep(time.Second) } + + // Stop the area after all updates are done. + // This will clean up and free resources used by the area. area.Stop() } @@ -246,23 +287,35 @@ import ( ) func main() { + // Start a new fullscreen centered area. + // This area will be used to display the bar chart. area, _ := pterm.DefaultArea.WithFullscreen().WithCenter().Start() + // Ensure the area stops updating when we're done. defer area.Stop() + // Loop to update the bar chart 10 times. for i := 0; i < 10; i++ { + // Create a new bar chart with dynamic bars. + // The bars will change based on the current iteration. barchart := pterm.DefaultBarChart.WithBars(dynamicBars(i)) + // Render the bar chart to a string. + // This string will be used to update the area. content, _ := barchart.Srender() + // Update the area with the new bar chart. area.Update(content) + // Wait for half a second before the next update. time.Sleep(500 * time.Millisecond) } } +// dynamicBars generates a set of bars for the bar chart. +// The bars will change based on the current iteration. func dynamicBars(i int) pterm.Bars { return pterm.Bars{ - {Label: "A", Value: 10}, - {Label: "B", Value: 20 * i}, - {Label: "C", Value: 30}, - {Label: "D", Value: 40 + i}, + {Label: "A", Value: 10}, // A static bar. + {Label: "B", Value: 20 * i}, // A bar that grows with each iteration. + {Label: "C", Value: 30}, // Another static bar. + {Label: "D", Value: 40 + i}, // A bar that grows slowly with each iteration. } } @@ -288,13 +341,21 @@ import ( ) func main() { + // Start a new fullscreen area. This will return an area instance and an error. + // The underscore (_) is used to ignore the error. area, _ := pterm.DefaultArea.WithFullscreen().Start() + // Loop 5 times to update the area content. for i := 0; i < 5; i++ { + // Update the content of the area with the current count. + // The Sprintf function is used to format the string. area.Update(pterm.Sprintf("Current count: %d\nAreas can update their content dynamically!", i)) + + // Pause for a second before the next update. time.Sleep(time.Second) } + // Stop the area after all updates are done. area.Stop() } @@ -320,13 +381,22 @@ import ( ) func main() { + // Initialize a new PTerm area with fullscreen and center options + // The Start() function returns the created area and an error (ignored here) area, _ := pterm.DefaultArea.WithFullscreen().WithCenter().Start() + // Loop 5 times to demonstrate dynamic content update for i := 0; i < 5; i++ { + // Update the content of the area with the current count + // The Sprintf function is used to format the string with the count area.Update(pterm.Sprintf("Current count: %d\nAreas can update their content dynamically!", i)) + + // Pause for a second time.Sleep(time.Second) } + // Stop the area after all updates are done + // This will clear the area and return the terminal to its normal state area.Stop() } @@ -334,9 +404,9 @@ func main() {
-### barchart/custom-height +### barchart/demo -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/barchart/custom-height/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/barchart/demo/animation.svg)
@@ -345,29 +415,39 @@ func main() { ```go package main -import "github.com/pterm/pterm" +import ( + "github.com/pterm/pterm" +) func main() { - pterm.DefaultBarChart.WithBars([]pterm.Bar{ - {Label: "A", Value: 10}, - {Label: "B", Value: 20}, - {Label: "C", Value: 30}, - {Label: "D", Value: 40}, - {Label: "E", Value: 50}, - {Label: "F", Value: 40}, - {Label: "G", Value: 30}, - {Label: "H", Value: 20}, - {Label: "I", Value: 10}, - }).WithHeight(5).Render() + // Define the bars for the chart + bars := []pterm.Bar{ + {Label: "Bar 1", Value: 5}, + {Label: "Bar 2", Value: 3}, + {Label: "Longer Label", Value: 7}, + } + + // Print an informational message + pterm.Info.Println("Chart example with positive only values (bars use 100% of chart area)") + + // Create a bar chart with the defined bars and render it + // The DefaultBarChart is used as a base, and the bars are added with the WithBars option + // The Render function is then called to display the chart + pterm.DefaultBarChart.WithBars(bars).Render() + + // Create a horizontal bar chart with the defined bars and render it + // The DefaultBarChart is used as a base, the chart is made horizontal with the WithHorizontal option, and the bars are added with the WithBars option + // The Render function is then called to display the chart + pterm.DefaultBarChart.WithHorizontal().WithBars(bars).Render() } ```
-### barchart/custom-width +### barchart/custom-height -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/barchart/custom-width/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/barchart/custom-height/animation.svg)
@@ -379,7 +459,9 @@ package main import "github.com/pterm/pterm" func main() { - pterm.DefaultBarChart.WithBars([]pterm.Bar{ + // Define a slice of Bar structs. Each struct represents a bar in the chart. + // The Label field is the name of the bar and the Value field is the height of the bar. + bars := []pterm.Bar{ {Label: "A", Value: 10}, {Label: "B", Value: 20}, {Label: "C", Value: 30}, @@ -389,16 +471,22 @@ func main() { {Label: "G", Value: 30}, {Label: "H", Value: 20}, {Label: "I", Value: 10}, - }).WithHorizontal().WithWidth(5).Render() + } + + // Create and render a bar chart with the defined bars and a height of 5. + // The WithBars method is used to set the bars of the chart. + // The WithHeight method is used to set the height of the chart. + // The Render method is used to display the chart in the terminal. + pterm.DefaultBarChart.WithBars(bars).WithHeight(5).Render() } ```
-### barchart/default +### barchart/custom-width -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/barchart/default/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/barchart/custom-width/animation.svg)
@@ -410,7 +498,8 @@ package main import "github.com/pterm/pterm" func main() { - pterm.DefaultBarChart.WithBars([]pterm.Bar{ + // Define the data for the bar chart + barData := []pterm.Bar{ {Label: "A", Value: 10}, {Label: "B", Value: 20}, {Label: "C", Value: 30}, @@ -420,16 +509,21 @@ func main() { {Label: "G", Value: 30}, {Label: "H", Value: 20}, {Label: "I", Value: 10}, - }).Render() + } + + // Create a bar chart with the defined data + // The chart is horizontal and has a width of 5 + // The Render() function is called to display the chart + pterm.DefaultBarChart.WithBars(barData).WithHorizontal().WithWidth(5).Render() } ```
-### barchart/demo +### barchart/default -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/barchart/demo/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/barchart/default/animation.svg)
@@ -438,29 +532,27 @@ func main() { ```go package main -import ( - "github.com/pterm/pterm" -) +import "github.com/pterm/pterm" func main() { - positiveBars := pterm.Bars{ - pterm.Bar{ - Label: "Bar 1", - Value: 5, - }, - pterm.Bar{ - Label: "Bar 2", - Value: 3, - }, - pterm.Bar{ - Label: "Longer Label", - Value: 7, - }, + // Define the data for the bar chart. Each bar is represented by a `pterm.Bar` struct. + // The `Label` field represents the label of the bar, and the `Value` field represents the value of the bar. + bars := []pterm.Bar{ + {Label: "A", Value: 10}, + {Label: "B", Value: 20}, + {Label: "C", Value: 30}, + {Label: "D", Value: 40}, + {Label: "E", Value: 50}, + {Label: "F", Value: 40}, + {Label: "G", Value: 30}, + {Label: "H", Value: 20}, + {Label: "I", Value: 10}, } - pterm.Info.Println("Chart example with positive only values (bars use 100% of chart area)") - _ = pterm.DefaultBarChart.WithBars(positiveBars).Render() - _ = pterm.DefaultBarChart.WithHorizontal().WithBars(positiveBars).Render() + // Use the `DefaultBarChart` from the `pterm` package to create a bar chart. + // The `WithBars` method is used to set the bars of the chart. + // The `Render` method is used to display the chart. + pterm.DefaultBarChart.WithBars(bars).Render() } ``` @@ -481,7 +573,8 @@ package main import "github.com/pterm/pterm" func main() { - pterm.DefaultBarChart.WithBars([]pterm.Bar{ + // Define the data for the bar chart + bars := []pterm.Bar{ {Label: "A", Value: 10}, {Label: "B", Value: 20}, {Label: "C", Value: 30}, @@ -491,7 +584,12 @@ func main() { {Label: "G", Value: 30}, {Label: "H", Value: 20}, {Label: "I", Value: 10}, - }).WithHorizontal().Render() + } + + // Create a bar chart with the defined data + // The chart is displayed horizontally + // The Render() function is called to display the chart + pterm.DefaultBarChart.WithBars(bars).WithHorizontal().Render() } ``` @@ -512,7 +610,8 @@ package main import "github.com/pterm/pterm" func main() { - pterm.DefaultBarChart.WithBars([]pterm.Bar{ + // Define the data for the bar chart + barData := []pterm.Bar{ {Label: "A", Value: 10}, {Label: "B", Value: 20}, {Label: "C", Value: 30}, @@ -522,7 +621,12 @@ func main() { {Label: "G", Value: 30}, {Label: "H", Value: 20}, {Label: "I", Value: 10}, - }).WithHorizontal().WithShowValue().Render() + } + + // Create a bar chart with the defined data + // The chart is horizontal and displays the value of each bar + // The Render() function is called to display the chart + pterm.DefaultBarChart.WithBars(barData).WithHorizontal().WithShowValue().Render() } ``` @@ -545,32 +649,29 @@ import ( ) func main() { - mixedBars := pterm.Bars{ - pterm.Bar{ - Label: "Bar 1", - Value: 2, - }, - pterm.Bar{ - Label: "Bar 2", - Value: -3, - }, - pterm.Bar{ - Label: "Bar 3", - Value: -2, - }, - pterm.Bar{ - Label: "Bar 4", - Value: 5, - }, - pterm.Bar{ - Label: "Longer Label", - Value: 7, - }, + // Define a set of bars for the chart. + // Each bar has a label and a value. + bars := []pterm.Bar{ + {Label: "Bar 1", Value: 2}, + {Label: "Bar 2", Value: -3}, + {Label: "Bar 3", Value: -2}, + {Label: "Bar 4", Value: 5}, + {Label: "Longer Label", Value: 7}, } + // Print a section header. + // This is useful for separating different parts of the output. pterm.DefaultSection.Println("Chart example with mixed values (note screen space usage in case when ABSOLUTE values of negative and positive parts are differ too much)") - _ = pterm.DefaultBarChart.WithBars(mixedBars).WithShowValue().Render() - _ = pterm.DefaultBarChart.WithHorizontal().WithBars(mixedBars).WithShowValue().Render() + + // Create a bar chart with the defined bars. + // The chart will display the value of each bar. + // The Render() function is called to display the chart. + pterm.DefaultBarChart.WithBars(bars).WithShowValue().Render() + + // Create a horizontal bar chart with the same bars. + // The chart will display the value of each bar. + // The Render() function is called to display the chart. + pterm.DefaultBarChart.WithHorizontal().WithBars(bars).WithShowValue().Render() } ``` @@ -593,23 +694,25 @@ import ( ) func main() { + // Define a set of bars with negative values. + // Each bar is represented by a struct with a label and a value. negativeBars := pterm.Bars{ - pterm.Bar{ - Label: "Bar 1", - Value: -5, - }, - pterm.Bar{ - Label: "Bar 2", - Value: -3, - }, - pterm.Bar{ - Label: "Longer Label", - Value: -7, - }, + {Label: "Bar 1", Value: -5}, + {Label: "Bar 2", Value: -3}, + {Label: "Longer Label", Value: -7}, } + // Print an informational message to the console. pterm.Info.Println("Chart example with negative only values (bars use 100% of chart area)") + + // Create a vertical bar chart with the defined bars. + // The WithShowValue() option is used to display the value of each bar in the chart. + // The Render() method is called to draw the chart. _ = pterm.DefaultBarChart.WithBars(negativeBars).WithShowValue().Render() + + // Create a horizontal bar chart with the same bars. + // The WithHorizontal() option is used to orient the chart horizontally. + // The WithShowValue() option and Render() method are used in the same way as before. _ = pterm.DefaultBarChart.WithHorizontal().WithBars(negativeBars).WithShowValue().Render() } @@ -631,7 +734,10 @@ package main import "github.com/pterm/pterm" func main() { - pterm.DefaultBarChart.WithBars([]pterm.Bar{ + // Define a slice of bars for the bar chart. Each bar is represented by a struct + // with a Label and a Value. The Label is a string that represents the name of the bar, + // and the Value is an integer that represents the height of the bar. + bars := []pterm.Bar{ {Label: "A", Value: 10}, {Label: "B", Value: 20}, {Label: "C", Value: 30}, @@ -641,7 +747,13 @@ func main() { {Label: "G", Value: 30}, {Label: "H", Value: 20}, {Label: "I", Value: 10}, - }).WithShowValue().Render() + } + + // Create a bar chart with the defined bars using the DefaultBarChart object from PTerm. + // Chain the WithBars method to set the bars of the chart. + // Chain the WithShowValue method to display the value of each bar on the chart. + // Finally, call the Render method to display the chart. + pterm.DefaultBarChart.WithBars(bars).WithShowValue().Render() } ``` @@ -662,22 +774,24 @@ package main import "github.com/pterm/pterm" func main() { - // A BasicText printer is used to print text, without special formatting. - // As it implements the TextPrinter interface, you can use it in combination with other printers. + // The DefaultBasicText is a basic text printer provided by PTerm. + // It is used to print text without any special formatting. pterm.DefaultBasicText.Println("Default basic text printer.") + + // The DefaultBasicText can be used in any context that requires a TextPrinter. + // Here, we're using it with the LightMagenta function to color a portion of the text. pterm.DefaultBasicText.Println("Can be used in any" + pterm.LightMagenta(" TextPrinter ") + "context.") - pterm.DefaultBasicText.Println("For example to resolve progressbars and spinners.") - // If you just want to print text, you should use this instead: - // pterm.Println("Hello, World!") + + // The DefaultBasicText is also useful for resolving progress bars and spinners. } ```
-### bigtext/colored +### bigtext/demo -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/bigtext/colored/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/bigtext/demo/animation.svg)
@@ -692,19 +806,33 @@ import ( ) func main() { + // Create a large text with the LetterStyle from the standard theme. + // This is useful for creating title screens. + pterm.DefaultBigText.WithLetters(putils.LettersFromString("PTerm")).Render() + + // Create a large text with differently colored letters. + // Here, the first letter 'P' is colored cyan and the rest 'Term' is colored light magenta. + // This can be used to highlight specific parts of the text. pterm.DefaultBigText.WithLetters( putils.LettersFromStringWithStyle("P", pterm.FgCyan.ToStyle()), - putils.LettersFromStringWithStyle("Term", pterm.FgLightMagenta.ToStyle())). - Render() + putils.LettersFromStringWithStyle("Term", pterm.FgLightMagenta.ToStyle()), + ).Render() + + // Create a large text with a specific RGB color. + // This can be used when you need a specific color that is not available in the standard colors. + // Here, the color is gold (RGB: 255, 215, 0). + pterm.DefaultBigText.WithLetters( + putils.LettersFromStringWithRGB("PTerm", pterm.NewRGB(255, 215, 0)), + ).Render() } ```
-### bigtext/default +### bigtext/colored -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/bigtext/default/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/bigtext/colored/animation.svg)
@@ -719,16 +847,21 @@ import ( ) func main() { - pterm.DefaultBigText.WithLetters(putils.LettersFromString("PTerm")).Render() + // Initialize a big text display with the letters "P" and "Term" + // "P" is displayed in cyan and "Term" is displayed in light magenta + pterm.DefaultBigText.WithLetters( + putils.LettersFromStringWithStyle("P", pterm.FgCyan.ToStyle()), + putils.LettersFromStringWithStyle("Term", pterm.FgLightMagenta.ToStyle())). + Render() // Render the big text to the terminal } ```
-### bigtext/demo +### bigtext/default -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/bigtext/demo/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/bigtext/default/animation.svg)
@@ -743,29 +876,23 @@ import ( ) func main() { - // Print a large text with the LetterStyle from the standard theme. - // Useful for title screens. - pterm.DefaultBigText.WithLetters(putils.LettersFromString("PTerm")).Render() + // Define the text to be rendered + var text = "PTerm" - // Print a large text with differently colored letters. - pterm.DefaultBigText.WithLetters( - putils.LettersFromStringWithStyle("P", pterm.FgCyan.ToStyle()), - putils.LettersFromStringWithStyle("Term", pterm.FgLightMagenta.ToStyle())). - Render() + // Convert the text into a format suitable for PTerm + var letters = putils.LettersFromString(text) - // LettersFromStringWithRGB can be used to create a large text with a specific RGB color. - pterm.DefaultBigText.WithLetters( - putils.LettersFromStringWithRGB("PTerm", pterm.NewRGB(255, 215, 0))). - Render() + // Render the text using PTerm's default big text style + pterm.DefaultBigText.WithLetters(letters).Render() } ```
-### box/custom-padding +### box/demo -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/box/custom-padding/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/box/demo/animation.svg)
@@ -777,21 +904,35 @@ package main import "github.com/pterm/pterm" func main() { - pterm.DefaultBox. - WithRightPadding(10). - WithLeftPadding(10). - WithTopPadding(2). - WithBottomPadding(2). - Println("Hello, World!") + // Print an informational message. + pterm.Info.Println("This might not be rendered correctly on GitHub,\nbut it will work in a real terminal.\nThis is because GitHub does not use a monospaced font by default for SVGs") + + // Create three panels with text, some of them with titles. + // The panels are created using the DefaultBox style. + panel1 := pterm.DefaultBox.Sprint("Lorem ipsum dolor sit amet,\nconsectetur adipiscing elit,\nsed do eiusmod tempor incididunt\nut labore et dolore\nmagna aliqua.") + panel2 := pterm.DefaultBox.WithTitle("title").Sprint("Ut enim ad minim veniam,\nquis nostrud exercitation\nullamco laboris\nnisi ut aliquip\nex ea commodo\nconsequat.") + panel3 := pterm.DefaultBox.WithTitle("bottom center title").WithTitleBottomCenter().Sprint("Duis aute irure\ndolor in reprehenderit\nin voluptate velit esse cillum\ndolore eu fugiat\nnulla pariatur.") + + // Combine the panels into a layout using the DefaultPanel style. + // The layout is a 2D grid, with each row being an array of panels. + // In this case, the first row contains panel1 and panel2, and the second row contains only panel3. + panels, _ := pterm.DefaultPanel.WithPanels(pterm.Panels{ + {{Data: panel1}, {Data: panel2}}, + {{Data: panel3}}, + }).Srender() + + // Print the panels layout inside a box with a title. + // The box is created using the DefaultBox style, with the title positioned at the bottom right. + pterm.DefaultBox.WithTitle("Lorem Ipsum").WithTitleBottomRight().WithRightPadding(0).WithBottomPadding(0).Println(panels) } ```
-### box/default +### box/custom-padding -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/box/default/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/box/custom-padding/animation.svg)
@@ -803,16 +944,17 @@ package main import "github.com/pterm/pterm" func main() { - pterm.DefaultBox.Println("Hello, World!") + // Create a default box with custom padding options and print "Hello, World!" inside it. + pterm.DefaultBox.WithRightPadding(10).WithLeftPadding(10).WithTopPadding(2).WithBottomPadding(2).Println("Hello, World!") } ```
-### box/demo +### box/default -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/box/demo/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/box/default/animation.svg)
@@ -824,18 +966,9 @@ package main import "github.com/pterm/pterm" func main() { - pterm.Info.Println("This might not be rendered correctly on GitHub,\nbut it will work in a real terminal.\nThis is because GitHub does not use a monospaced font by default for SVGs") - - panel1 := pterm.DefaultBox.Sprint("Lorem ipsum dolor sit amet,\nconsectetur adipiscing elit,\nsed do eiusmod tempor incididunt\nut labore et dolore\nmagna aliqua.") - panel2 := pterm.DefaultBox.WithTitle("title").Sprint("Ut enim ad minim veniam,\nquis nostrud exercitation\nullamco laboris\nnisi ut aliquip\nex ea commodo\nconsequat.") - panel3 := pterm.DefaultBox.WithTitle("bottom center title").WithTitleBottomCenter().Sprint("Duis aute irure\ndolor in reprehenderit\nin voluptate velit esse cillum\ndolore eu fugiat\nnulla pariatur.") - - panels, _ := pterm.DefaultPanel.WithPanels(pterm.Panels{ - {{Data: panel1}, {Data: panel2}}, - {{Data: panel3}}, - }).Srender() - - pterm.DefaultBox.WithTitle("Lorem Ipsum").WithTitleBottomRight().WithRightPadding(0).WithBottomPadding(0).Println(panels) + // Create a default box with PTerm and print a message in it. + // The DefaultBox.Println method automatically starts, prints the message, and stops the box. + pterm.DefaultBox.Println("Hello, World!") } ``` @@ -856,19 +989,22 @@ package main import "github.com/pterm/pterm" func main() { - // Default titled bpx + // Create a default box with specified padding paddedBox := pterm.DefaultBox.WithLeftPadding(4).WithRightPadding(4).WithTopPadding(1).WithBottomPadding(1) + // Define a title for the box title := pterm.LightRed("I'm a box!") - box1 := paddedBox.WithTitle(title).Sprint("Hello, World!\n 1") - box2 := paddedBox.WithTitle(title).WithTitleTopCenter().Sprint("Hello, World!\n 2") - box3 := paddedBox.WithTitle(title).WithTitleTopRight().Sprint("Hello, World!\n 3") - box4 := paddedBox.WithTitle(title).WithTitleBottomRight().Sprint("Hello, World!\n 4") - box5 := paddedBox.WithTitle(title).WithTitleBottomCenter().Sprint("Hello, World!\n 5") - box6 := paddedBox.WithTitle(title).WithTitleBottomLeft().Sprint("Hello, World!\n 6") - box7 := paddedBox.WithTitle(title).WithTitleTopLeft().Sprint("Hello, World!\n 7") + // Create boxes with the title positioned differently and containing different content + box1 := paddedBox.WithTitle(title).Sprint("Hello, World!\n 1") // Title at default position (top left) + box2 := paddedBox.WithTitle(title).WithTitleTopCenter().Sprint("Hello, World!\n 2") // Title at top center + box3 := paddedBox.WithTitle(title).WithTitleTopRight().Sprint("Hello, World!\n 3") // Title at top right + box4 := paddedBox.WithTitle(title).WithTitleBottomRight().Sprint("Hello, World!\n 4") // Title at bottom right + box5 := paddedBox.WithTitle(title).WithTitleBottomCenter().Sprint("Hello, World!\n 5") // Title at bottom center + box6 := paddedBox.WithTitle(title).WithTitleBottomLeft().Sprint("Hello, World!\n 6") // Title at bottom left + box7 := paddedBox.WithTitle(title).WithTitleTopLeft().Sprint("Hello, World!\n 7") // Title at top left + // Render the boxes in a panel layout pterm.DefaultPanel.WithPanels([][]pterm.Panel{ {{box1}, {box2}, {box3}}, {{box4}, {box5}, {box6}}, @@ -880,9 +1016,9 @@ func main() {
-### bulletlist/customized +### bulletlist/demo -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/bulletlist/customized/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/bulletlist/demo/animation.svg)
@@ -893,24 +1029,37 @@ package main import ( "github.com/pterm/pterm" + "github.com/pterm/pterm/putils" ) func main() { - // Print a customized list with different styles and levels. - pterm.DefaultBulletList.WithItems([]pterm.BulletListItem{ - {Level: 0, Text: "Blue", TextStyle: pterm.NewStyle(pterm.FgBlue), BulletStyle: pterm.NewStyle(pterm.FgRed)}, - {Level: 1, Text: "Green", TextStyle: pterm.NewStyle(pterm.FgGreen), Bullet: "-", BulletStyle: pterm.NewStyle(pterm.FgLightWhite)}, - {Level: 2, Text: "Cyan", TextStyle: pterm.NewStyle(pterm.FgCyan), Bullet: ">", BulletStyle: pterm.NewStyle(pterm.FgYellow)}, - }).Render() + // Define a list of bullet list items with different levels. + bulletListItems := []pterm.BulletListItem{ + {Level: 0, Text: "Level 0"}, // Level 0 item + {Level: 1, Text: "Level 1"}, // Level 1 item + {Level: 2, Text: "Level 2"}, // Level 2 item + } + + // Use the default bullet list style to render the list items. + pterm.DefaultBulletList.WithItems(bulletListItems).Render() + + // Define a string with different levels of indentation. + text := `0 + 1 + 2 + 3` + + // Convert the indented string to a bullet list and render it. + putils.BulletListFromString(text, " ").Render() } ```
-### bulletlist/demo +### bulletlist/customized -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/bulletlist/demo/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/bulletlist/customized/animation.svg)
@@ -921,23 +1070,35 @@ package main import ( "github.com/pterm/pterm" - "github.com/pterm/pterm/putils" ) func main() { - // Print a list with different levels. - // Useful to generate lists automatically from data. - pterm.DefaultBulletList.WithItems([]pterm.BulletListItem{ - {Level: 0, Text: "Level 0"}, - {Level: 1, Text: "Level 1"}, - {Level: 2, Text: "Level 2"}, - }).Render() + // Define a list of bullet list items with different styles and levels. + bulletListItems := []pterm.BulletListItem{ + { + Level: 0, // Level 0 (top level) + Text: "Blue", // Text to display + TextStyle: pterm.NewStyle(pterm.FgBlue), // Text color + BulletStyle: pterm.NewStyle(pterm.FgRed), // Bullet color + }, + { + Level: 1, // Level 1 (sub-item) + Text: "Green", // Text to display + TextStyle: pterm.NewStyle(pterm.FgGreen), // Text color + Bullet: "-", // Custom bullet symbol + BulletStyle: pterm.NewStyle(pterm.FgLightWhite), // Bullet color + }, + { + Level: 2, // Level 2 (sub-sub-item) + Text: "Cyan", // Text to display + TextStyle: pterm.NewStyle(pterm.FgCyan), // Text color + Bullet: ">", // Custom bullet symbol + BulletStyle: pterm.NewStyle(pterm.FgYellow), // Bullet color + }, + } - // Convert a text to a list and print it. - putils.BulletListFromString(`0 - 1 - 2 - 3`, " ").Render() + // Create a bullet list with the defined items and render it. + pterm.DefaultBulletList.WithItems(bulletListItems).Render() } ``` @@ -955,15 +1116,22 @@ func main() { ```go package main -import "github.com/pterm/pterm" +import ( + "github.com/pterm/pterm" + "github.com/pterm/pterm/putils" +) func main() { - pterm.DefaultCenter.Println("This text is centered!\nIt centeres the whole block by default.\nIn that way you can do stuff like this:") + // Print a block of text centered in the terminal + pterm.DefaultCenter.Println("This text is centered!\nIt centers the whole block by default.\nIn that way you can do stuff like this:") - // Generate BigLetters - s, _ := pterm.DefaultBigText.WithLetters(pterm.NewLettersFromString("PTerm")).Srender() - pterm.DefaultCenter.Println(s) // Print BigLetters with the default CenterPrinter + // Generate BigLetters and store in 's' + s, _ := pterm.DefaultBigText.WithLetters(putils.LettersFromString("PTerm")).Srender() + // Print the BigLetters 's' centered in the terminal + pterm.DefaultCenter.Println(s) + + // Print each line of the text separately centered in the terminal pterm.DefaultCenter.WithCenterEachLineSeparately().Println("This text is centered!\nBut each line is\ncentered\nseparately") } @@ -985,8 +1153,7 @@ package main import "github.com/pterm/pterm" func main() { - // Print all colors - + // Create a table with different foreground and background colors. pterm.DefaultTable.WithData([][]string{ {pterm.FgBlack.Sprint("Black"), pterm.FgRed.Sprint("Red"), pterm.FgGreen.Sprint("Green"), pterm.FgYellow.Sprint("Yellow")}, {"", pterm.FgLightRed.Sprint("Light Red"), pterm.FgLightGreen.Sprint("Light Green"), pterm.FgLightYellow.Sprint("Light Yellow")}, @@ -996,18 +1163,19 @@ func main() { {pterm.FgLightBlue.Sprint("Light Blue"), pterm.FgLightMagenta.Sprint("Light Magenta"), pterm.FgLightCyan.Sprint("Light Cyan"), pterm.FgLightWhite.Sprint("Light White")}, {pterm.BgBlue.Sprint("Blue"), pterm.BgMagenta.Sprint("Magenta"), pterm.BgCyan.Sprint("Cyan"), pterm.BgWhite.Sprint("White")}, {pterm.BgLightBlue.Sprint("Light Blue"), pterm.BgLightMagenta.Sprint("Light Magenta"), pterm.BgLightCyan.Sprint("Light Cyan"), pterm.BgLightWhite.Sprint("Light White")}, - }).Render() + }).Render() // Render the table. pterm.Println() - // Print different colored words. + // Print words in different colors. pterm.Println(pterm.Red("Hello, ") + pterm.Green("World") + pterm.Cyan("!")) pterm.Println(pterm.Red("Even " + pterm.Cyan("nested ") + pterm.Green("colors ") + "are supported!")) pterm.Println() - // Or print colors as a style + // Create a new style with a red background, light green foreground, and bold text. style := pterm.NewStyle(pterm.BgRed, pterm.FgLightGreen, pterm.Bold) + // Print text using the created style. style.Println("This text uses a style and is bold and light green with a red background!") } @@ -1029,16 +1197,20 @@ package main import "github.com/pterm/pterm" func main() { + // Loop from 0 to 14 for i := 0; i < 15; i++ { switch i { case 5: + // At the 5th iteration, print a message and disable the output pterm.Info.Println("Disabled Output!") pterm.DisableOutput() case 10: + // At the 10th iteration, enable the output and print a message pterm.EnableOutput() pterm.Info.Println("Enabled Output!") } + // Print a progress message for each iteration pterm.Printf("Printing something... [%d/%d]\n", i, 15) } } @@ -1063,16 +1235,26 @@ import ( ) func main() { - // Print info. + // Print an informational message. pterm.Info.Println("RGB colors only work in Terminals which support TrueColor.") - from := pterm.NewRGB(0, 255, 255) // This RGB value is used as the gradients start point. - to := pterm.NewRGB(255, 0, 255) // This RGB value is used as the gradients end point. + // Define the start and end points for the color gradient. + startColor := pterm.NewRGB(0, 255, 255) // Cyan + endColor := pterm.NewRGB(255, 0, 255) // Magenta + + // Get the terminal height to determine the gradient range. + terminalHeight := pterm.GetTerminalHeight() + + // Loop over the range of the terminal height to create a color gradient. + for i := 0; i < terminalHeight-2; i++ { + // Calculate the fade factor for the current step in the gradient. + fadeFactor := float32(i) / float32(terminalHeight-2) + + // Create a color that represents the current step in the gradient. + currentColor := startColor.Fade(0, 1, fadeFactor, endColor) - // For loop over the range of the terminal height. - for i := 0; i < pterm.GetTerminalHeight()-2; i++ { - // Print string which is colored with the faded RGB value. - from.Fade(0, float32(pterm.GetTerminalHeight()-2), float32(i), to).Println("Hello, World!") + // Print a string with the current color. + currentColor.Println("Hello, World!") } } @@ -1098,63 +1280,64 @@ import ( ) func main() { - white := pterm.NewRGB(255, 255, 255) // This RGB value is used as the gradients start point. - grey := pterm.NewRGB(128, 128, 128) // This RGB value is used as the gradients start point. - black := pterm.NewRGB(0, 0, 0) // This RGB value is used as the gradients start point. - red := pterm.NewRGB(255, 0, 0) // This RGB value is used as the gradients start point. - purple := pterm.NewRGB(255, 0, 255) // This RGB value is used as the gradients start point. - green := pterm.NewRGB(0, 255, 0) // This RGB value is used as the gradients start point. + // Define RGB colors + white := pterm.NewRGB(255, 255, 255) + grey := pterm.NewRGB(128, 128, 128) + black := pterm.NewRGB(0, 0, 0) + red := pterm.NewRGB(255, 0, 0) + purple := pterm.NewRGB(255, 0, 255) + green := pterm.NewRGB(0, 255, 0) - str := "RGB colors only work in Terminals which support TrueColor." - strs := strings.Split(str, "") - var fadeInfo string // String which will be used to print. - for i := 0; i < len(str); i++ { - // Append faded letter to info string. - fadeInfo += pterm.NewRGBStyle(white.Fade(0, float32(len(str)), float32(i), purple), grey.Fade(0, float32(len(str)), float32(i), black)).Sprint(strs[i]) - } + // Define strings to be printed + str1 := "RGB colors only work in Terminals which support TrueColor." + str2 := "The background and foreground colors can be customized individually." + str3 := "Styles can also be applied. For example: Bold or Italic." - pterm.Info.Println(fadeInfo) + // Print first string with color fading from white to purple + printFadedString(str1, white, purple, grey, black) - str = "The background and foreground colors can be customized individually." - strs = strings.Split(str, "") - var fade2 string // String which will be used to print info. - for i := 0; i < len(str); i++ { - // Append faded letter to info string. - fade2 += pterm.NewRGBStyle(black, purple.Fade(0, float32(len(str)), float32(i), red)).Sprint(strs[i]) - } + // Print second string with color fading from purple to red + printFadedString(str2, black, purple, red, red) - pterm.Println(fade2) + // Print third string with color fading from white to green and style changes + printStyledString(str3, white, green, red, black) +} - str = "Styles can also be applied. For example: Bold or Italic." - strs = strings.Split(str, "") - var fade3 string // String which will be used to print. +// printFadedString prints a string with color fading effect +func printFadedString(str string, fgStart, fgEnd, bgStart, bgEnd pterm.RGB) { + strs := strings.Split(str, "") + var result string + for i := 0; i < len(str); i++ { + // Create a style with color fading effect + style := pterm.NewRGBStyle(fgStart.Fade(0, float32(len(str)), float32(i), fgEnd), bgStart.Fade(0, float32(len(str)), float32(i), bgEnd)) + // Append styled letter to result string + result += style.Sprint(strs[i]) + } + pterm.Println(result) +} - bold := 0 +// printStyledString prints a string with color fading and style changes +func printStyledString(str string, fgStart, fgEnd, bgStart, bgEnd pterm.RGB) { + strs := strings.Split(str, "") + var result string boldStr := strings.Split("Bold", "") - italic := 0 italicStr := strings.Split("Italic", "") - + bold, italic := 0, 0 for i := 0; i < len(str); i++ { - // Append faded letter to info string. - s := pterm.NewRGBStyle(white.Fade(0, float32(len(str)), float32(i), green), red.Fade(0, float32(len(str)), float32(i), black)) - - // if the next letters are "Bold", then add the style "Bold". - // else if the next letters are "Italic", then add the style "Italic". - if bold < len(boldStr) && i+len(boldStr) <= len(strs) { - if strings.Join(strs[i:i+len(boldStr)-bold], "") == strings.Join(boldStr[bold:], "") { - s = s.AddOptions(pterm.Bold) - bold++ - } - } else if italic < len(italicStr) && i+len(italicStr)-italic < len(strs) { - if strings.Join(strs[i:i+len(italicStr)-italic], "") == strings.Join(italicStr[italic:], "") { - s = s.AddOptions(pterm.Italic) - italic++ - } + // Create a style with color fading effect + style := pterm.NewRGBStyle(fgStart.Fade(0, float32(len(str)), float32(i), fgEnd), bgStart.Fade(0, float32(len(str)), float32(i), bgEnd)) + // Check if the next letters are "Bold" or "Italic" and add the corresponding style + if bold < len(boldStr) && i+len(boldStr)-bold <= len(strs) && strings.Join(strs[i:i+len(boldStr)-bold], "") == strings.Join(boldStr[bold:], "") { + style = style.AddOptions(pterm.Bold) + bold++ + } else if italic < len(italicStr) && i+len(italicStr)-italic < len(strs) && strings.Join(strs[i:i+len(italicStr)-italic], "") == strings.Join(italicStr[italic:], "") { + style = style.AddOptions(pterm.Italic) + italic++ } - fade3 += s.Sprint(strs[i]) + // Append styled letter to result string + result += style.Sprint(strs[i]) } - - pterm.Println(fade3) + pterm.Println(result) } ``` @@ -1179,28 +1362,36 @@ import ( ) func main() { - from := pterm.NewRGB(0, 255, 255) // This RGB value is used as the gradients start point. - to := pterm.NewRGB(255, 0, 255) // This RGB value is used as the gradients first point. - to2 := pterm.NewRGB(255, 0, 0) // This RGB value is used as the gradients second point. - to3 := pterm.NewRGB(0, 255, 0) // This RGB value is used as the gradients third point. - to4 := pterm.NewRGB(255, 255, 255) // This RGB value is used as the gradients end point. + // Define RGB values for gradient points. + startColor := pterm.NewRGB(0, 255, 255) + firstPoint := pterm.NewRGB(255, 0, 255) + secondPoint := pterm.NewRGB(255, 0, 0) + thirdPoint := pterm.NewRGB(0, 255, 0) + endColor := pterm.NewRGB(255, 255, 255) + // Define the string to be printed. str := "RGB colors only work in Terminals which support TrueColor." strs := strings.Split(str, "") - var fadeInfo string // String which will be used to print info. - // For loop over the range of the string length. + + // Initialize an empty string for the faded info. + var fadeInfo string + + // Loop over the string length to create a gradient effect. for i := 0; i < len(str); i++ { - // Append faded letter to info string. - fadeInfo += from.Fade(0, float32(len(str)), float32(i), to).Sprint(strs[i]) + // Append each character of the string with a faded color to the info string. + fadeInfo += startColor.Fade(0, float32(len(str)), float32(i), firstPoint).Sprint(strs[i]) } - // Print info. + // Print the info string with gradient effect. pterm.Info.Println(fadeInfo) - // For loop over the range of the terminal height. - for i := 0; i < pterm.GetTerminalHeight()-2; i++ { - // Print string which is colored with the faded RGB value. - from.Fade(0, float32(pterm.GetTerminalHeight()-2), float32(i), to, to2, to3, to4).Println("Hello, World!") + // Get the terminal height. + terminalHeight := pterm.GetTerminalHeight() + + // Loop over the terminal height to print "Hello, World!" with a gradient effect. + for i := 0; i < terminalHeight-2; i++ { + // Print the string with a color that fades from startColor to endColor. + startColor.Fade(0, float32(terminalHeight-2), float32(i), firstPoint, secondPoint, thirdPoint, endColor).Println("Hello, World!") } } @@ -1222,16 +1413,13 @@ package main import "github.com/pterm/pterm" func main() { - // Print default error. + // Print a default error message with PTerm's built-in Error style. pterm.Error.Println("This is the default Error") - // Customize default error. - pterm.Error.Prefix = pterm.Prefix{ - Text: "OVERRIDE", - Style: pterm.NewStyle(pterm.BgCyan, pterm.FgRed), - } + // Override the default error prefix with a new text and style. + pterm.Error.Prefix = pterm.Prefix{Text: "OVERRIDE", Style: pterm.NewStyle(pterm.BgCyan, pterm.FgRed)} - // Print new default error. + // Print the error message again, this time with the overridden prefix. pterm.Error.Println("This is the default Error after the prefix was overridden") } @@ -1253,10 +1441,17 @@ package main import "github.com/pterm/pterm" func main() { - // Print strings with a custom RGB color. - // NOTICE: This only works with terminals which support TrueColor. + // Create a new RGB color with values 178, 44, 199. + // This color will be used for the text. pterm.NewRGB(178, 44, 199).Println("This text is printed with a custom RGB!") + + // Create a new RGB color with values 15, 199, 209. + // This color will be used for the text. pterm.NewRGB(15, 199, 209).Println("This text is printed with a custom RGB!") + + // Create a new RGB color with values 201, 144, 30. + // This color will be used for the background. + // The 'true' argument indicates that the color is for the background. pterm.NewRGB(201, 144, 30, true).Println("This text is printed with a custom RGB background!") } @@ -1280,17 +1475,21 @@ import ( ) func main() { + // Define RGB colors for foreground and background. foregroundRGB := pterm.RGB{R: 187, G: 80, B: 0} backgroundRGB := pterm.RGB{R: 0, G: 50, B: 123} - // Print string with a custom foreground and background RGB color. - pterm.NewRGBStyle(foregroundRGB, backgroundRGB).Println("This text is not styled.") + // Create a new RGB style with the defined foreground and background colors. + rgbStyle := pterm.NewRGBStyle(foregroundRGB, backgroundRGB) + + // Print a string with the custom RGB style. + rgbStyle.Println("This text is not styled.") - // Print string with a custom foreground and background RGB color and style bold. - pterm.NewRGBStyle(foregroundRGB, backgroundRGB).AddOptions(pterm.Bold).Println("This text is bold.") + // Add the 'Bold' option to the RGB style and print a string with this style. + rgbStyle.AddOptions(pterm.Bold).Println("This text is bold.") - // Print string with a custom foreground and background RGB color and style italic. - pterm.NewRGBStyle(foregroundRGB, backgroundRGB).AddOptions(pterm.Italic).Println("This text is italic.") + // Add the 'Italic' option to the RGB style and print a string with this style. + rgbStyle.AddOptions(pterm.Italic).Println("This text is italic.") } ``` @@ -1439,7 +1638,7 @@ func main() { pterm.DefaultCenter.WithCenterEachLineSeparately().Println(fadeInfo) }) - showcase("Fully Customizale", 2, func() { + showcase("Fully Customizable", 2, func() { for i := 0; i < 4; i++ { pterm.Println() } @@ -1579,9 +1778,9 @@ func randomInt(min, max int) int {
-### header/custom +### header/demo -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/header/custom/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/header/demo/animation.svg)
@@ -1593,25 +1792,47 @@ package main import "github.com/pterm/pterm" func main() { - // All available options: https://pkg.go.dev/github.com/pterm/pterm#HeaderPrinter + // Print a default header. + // This uses the default settings of PTerm to print a header. + pterm.DefaultHeader.Println("This is the default header!") - // Build on top of DefaultHeader - pterm.DefaultHeader. // Use DefaultHeader as base - WithMargin(15). - WithBackgroundStyle(pterm.NewStyle(pterm.BgCyan)). - WithTextStyle(pterm.NewStyle(pterm.FgBlack)). - Println("This is a custom header!") - // Instead of printing the header you can set it to a variable. - // You can then reuse your custom header. + // Print a spacer line for better readability. + pterm.Println() - // Making a completely new HeaderPrinter - newHeader := pterm.HeaderPrinter{ - TextStyle: pterm.NewStyle(pterm.FgBlack), - BackgroundStyle: pterm.NewStyle(pterm.BgRed), - Margin: 20, - } + // Print a full-width header. + // This uses the WithFullWidth() option of PTerm to print a header that spans the full width of the terminal. + pterm.DefaultHeader.WithFullWidth().Println("This is a full-width header.") +} + +``` + +
+ +### header/custom + +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/header/custom/animation.svg) - // Print header. +
+ +SHOW SOURCE + +```go +package main + +import "github.com/pterm/pterm" + +func main() { + // Customize the DefaultHeader with a cyan background, black text, and a margin of 15. + pterm.DefaultHeader.WithMargin(15).WithBackgroundStyle(pterm.NewStyle(pterm.BgCyan)).WithTextStyle(pterm.NewStyle(pterm.FgBlack)).Println("This is a custom header!") + + // Define a new HeaderPrinter with a red background, black text, and a margin of 20. + newHeader := pterm.HeaderPrinter{ + TextStyle: pterm.NewStyle(pterm.FgBlack), + BackgroundStyle: pterm.NewStyle(pterm.BgRed), + Margin: 20, + } + + // Print the custom header using the new HeaderPrinter. newHeader.Println("This is a custom header!") } @@ -1619,9 +1840,250 @@ func main() {
-### header/demo +### heatmap/demo -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/header/demo/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/heatmap/demo/animation.svg) + +
+ +SHOW SOURCE + +```go +package main + +import ( + "github.com/pterm/pterm" +) + +func main() { + // Define the data for the heatmap. Each sub-array represents a row in the heatmap. + data := [][]float32{ + {0.9, 0.2, -0.7, 0.4, -0.5, 0.6, -0.3, 0.8, -0.1, -1.0, 0.1, -0.8, 0.3}, + {0.2, -0.7, -0.5, -0.3, -0.1, 0.1, 0.3, 0.5, 0.9, -0.9, -0.7, -0.5, -0.3}, + {0.4, 0.4, -0.3, -1.0, 0.3, -0.2, -0.9, 0.5, -0.3, -1.0, 0.6, -0.2, -0.9}, + {0.9, -0.5, -0.1, 0.3, 1, -0.7, -0.3, 0.1, 0.7, -0.9, -0.5, 0.2, 0.6}, + {0.5, 0.6, 0.1, -0.2, -0.7, 0.8, 0.6, 0.1, -0.5, -0.7, 0.7, 0.3, 0.0}, + } + + // Define the labels for the X and Y axes of the heatmap. + headerData := pterm.HeatmapAxis{ + XAxis: []string{"a", "b", "c", "d", "e", "f", "g", "h", "i", "j", "k", "l", "m"}, + YAxis: []string{"1", "2", "3", "4", "5"}, + } + + // Create a heatmap with the defined data and axis labels, and enable RGB colors. + // Then render the heatmap. + pterm.DefaultHeatmap.WithAxisData(headerData).WithData(data).WithEnableRGB().Render() +} + +``` + +
+ +### heatmap/custom_colors + +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/heatmap/custom_colors/animation.svg) + +
+ +SHOW SOURCE + +```go +package main + +import ( + "github.com/pterm/pterm" +) + +func main() { + // Define the data for the heatmap + data := [][]float32{ + {0.9, 0.2, -0.7, 0.4, -0.5, 0.6, -0.3, 0.8, -0.1, -1.0, 0.1, -0.8, 0.3}, + {0.2, -0.7, -0.5, -0.3, -0.1, 0.1, 0.3, 0.5, 0.9, -0.9, -0.7, -0.5, -0.3}, + {0.4, 0.4, -0.3, -1.0, 0.3, -0.2, -0.9, 0.5, -0.3, -1.0, 0.6, -0.2, -0.9}, + {0.9, -0.5, -0.1, 0.3, 1, -0.7, -0.3, 0.1, 0.7, -0.9, -0.5, 0.2, 0.6}, + {0.5, 0.6, 0.1, -0.2, -0.7, 0.8, 0.6, 0.1, -0.5, -0.7, 0.7, 0.3, 0.0}, + } + + // Define the axis labels for the heatmap + headerData := pterm.HeatmapAxis{ + XAxis: []string{"a", "b", "c", "d", "e", "f", "g", "h", "i", "j", "k", "l", "m"}, + YAxis: []string{"1", "2", "3", "4", "5"}, + } + + // Print an informational message + pterm.Info.Println("The following table has no rgb (supported by every terminal), no axis data and a legend.") + pterm.Println() + + // Create the heatmap with the defined data and options, and render it + pterm.DefaultHeatmap. + WithData(data). + WithBoxed(false). + WithAxisData(headerData). + WithLegend(false). + WithColors(pterm.BgBlue, pterm.BgRed, pterm.BgGreen, pterm.BgYellow). + WithLegend(). + Render() +} + +``` + +
+ +### heatmap/custom_legend + +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/heatmap/custom_legend/animation.svg) + +
+ +SHOW SOURCE + +```go +package main + +import ( + "github.com/pterm/pterm" +) + +func main() { + // Define the data for the heatmap + data := [][]float32{ + {0.9, 0.2, -0.7, 0.4, -0.5, 0.6, -0.3, 0.8, -0.1, -1.0, 0.1, -0.8, 0.3}, + {0.2, -0.7, -0.5, -0.3, -0.1, 0.1, 0.3, 0.5, 0.9, -0.9, -0.7, -0.5, -0.3}, + {0.4, 0.4, -0.3, -1.0, 0.3, -0.2, -0.9, 0.5, -0.3, -1.0, 0.6, -0.2, -0.9}, + {0.9, -0.5, -0.1, 0.3, 1, -0.7, -0.3, 0.1, 0.7, -0.9, -0.5, 0.2, 0.6}, + {0.5, 0.6, 0.1, -0.2, -0.7, 0.8, 0.6, 0.1, -0.5, -0.7, 0.7, 0.3, 0.0}, + } + + // Define the header data for the heatmap + headerData := pterm.HeatmapAxis{ + XAxis: []string{"a", "b", "c", "d", "e", "f", "g", "h", "i", "j", "k", "l", "m"}, + YAxis: []string{"1", "2", "3", "4", "5"}, + } + + // Print an informational message + pterm.Info.Println("The following table has rgb (not supported by every terminal), axis data and a custom legend.") + pterm.Println() + + // Create the heatmap with the defined data and options + // Options are chained in a single line for simplicity + pterm.DefaultHeatmap. + WithData(data). + WithBoxed(false). + WithAxisData(headerData). + WithEnableRGB(). + WithLegendLabel("custom"). + WithLegendOnlyColoredCells(). + Render() // Render the heatmap +} + +``` + +
+ +### heatmap/custom_rgb + +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/heatmap/custom_rgb/animation.svg) + +
+ +SHOW SOURCE + +```go +package main + +import ( + "github.com/pterm/pterm" +) + +func main() { + // Define the data for the heatmap. + data := [][]float32{ + {0.9, 0.2, -0.7, 0.4, -0.5, 0.6, -0.3, 0.8, -0.1, -1.0, 0.1, -0.8, 0.3}, + {0.2, -0.7, -0.5, -0.3, -0.1, 0.1, 0.3, 0.5, 0.9, -0.9, -0.7, -0.5, -0.3}, + {0.4, 0.4, -0.3, -1.0, 0.3, -0.2, -0.9, 0.5, -0.3, -1.0, 0.6, -0.2, -0.9}, + {0.9, -0.5, -0.1, 0.3, 1, -0.7, -0.3, 0.1, 0.7, -0.9, -0.5, 0.2, 0.6}, + {0.5, 0.6, 0.1, -0.2, -0.7, 0.8, 0.6, 0.1, -0.5, -0.7, 0.7, 0.3, 0.0}, + } + + // Define the axis labels for the heatmap. + axisLabels := pterm.HeatmapAxis{ + XAxis: []string{"a", "b", "c", "d", "e", "f", "g", "h", "i", "j", "k", "l", "m"}, + YAxis: []string{"1", "2", "3", "4", "5"}, + } + + // Print an informational message. + pterm.Info.Println("The following table has rgb (not supported by every terminal), axis data and a legend.") + pterm.Println() + + // Define the color range for the heatmap. + rgbRange := []pterm.RGB{ + pterm.NewRGB(0, 0, 255), + pterm.NewRGB(255, 0, 0), + pterm.NewRGB(0, 255, 0), + pterm.NewRGB(255, 255, 0), + } + + // Create and render the heatmap. + pterm.DefaultHeatmap. + WithData(data). + WithBoxed(false). + WithAxisData(axisLabels). + WithEnableRGB(). + WithRGBRange(rgbRange...). + Render() +} + +``` + +
+ +### heatmap/no_grid + +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/heatmap/no_grid/animation.svg) + +
+ +SHOW SOURCE + +```go +package main + +import ( + "github.com/pterm/pterm" +) + +func main() { + // Define the data for the heatmap. + data := [][]float32{ + {0.9, 0.2, -0.7, 0.4, -0.5, 0.6, -0.3, 0.8, -0.1, -1.0, 0.1, -0.8, 0.3}, + {0.2, -0.7, -0.5, -0.3, -0.1, 0.1, 0.3, 0.5, 0.9, -0.9, -0.7, -0.5, -0.3}, + {0.4, 0.4, -0.3, -1.0, 0.3, -0.2, -0.9, 0.5, -0.3, -1.0, 0.6, -0.2, -0.9}, + {0.9, -0.5, -0.1, 0.3, 1, -0.7, -0.3, 0.1, 0.7, -0.9, -0.5, 0.2, 0.6}, + {0.5, 0.6, 0.1, -0.2, -0.7, 0.8, 0.6, 0.1, -0.5, -0.7, 0.7, 0.3, 0.0}, + } + + // Define the axis data for the heatmap. + axisData := pterm.HeatmapAxis{ + XAxis: []string{"a", "b", "c", "d", "e", "f", "g", "h", "i", "j", "k", "l", "m"}, + YAxis: []string{"1", "2", "3", "4", "5"}, + } + + // Print an informational message. + pterm.Info.Println("The following table has rgb (not supported by every terminal), axis data and a legend.") + pterm.Println() + + // Create the heatmap with the defined data and options, then render it. + pterm.DefaultHeatmap.WithData(data).WithBoxed(false).WithAxisData(axisData).WithEnableRGB().WithLegend().WithGrid(false).Render() +} + +``` + +
+ +### heatmap/separated + +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/heatmap/separated/animation.svg)
@@ -1633,10 +2095,27 @@ package main import "github.com/pterm/pterm" func main() { - // Print a default header. - pterm.DefaultHeader.Println("This is the default header!") - pterm.Println() // spacer - pterm.DefaultHeader.WithFullWidth().Println("This is a full-width header.") + // Define the data for the heatmap. + data := [][]float32{ + {0.9, 0.2, -0.7, 0.4, -0.5, 0.6, -0.3, 0.8, -0.1, -1.0, 0.1, -0.8, 0.3}, + {0.2, -0.7, -0.5, -0.3, -0.1, 0.1, 0.3, 0.5, 0.9, -0.9, -0.7, -0.5, -0.3}, + {0.4, 0.4, -0.3, -1.0, 0.3, -0.2, -0.9, 0.5, -0.3, -1.0, 0.6, -0.2, -0.9}, + {0.9, -0.5, -0.1, 0.3, 1, -0.7, -0.3, 0.1, 0.7, -0.9, -0.5, 0.2, 0.6}, + {0.5, 0.6, 0.1, -0.2, -0.7, 0.8, 0.6, 0.1, -0.5, -0.7, 0.7, 0.3, 0.0}, + } + + // Define the axis labels for the heatmap. + headerData := pterm.HeatmapAxis{ + XAxis: []string{"a", "b", "c", "d", "e", "f", "g", "h", "i", "j", "k", "l", "m"}, + YAxis: []string{"1", "2", "3", "4", "5"}, + } + + // Print an informational message. + pterm.Info.Println("The following table has no rgb (supported by every terminal), no axis data and no legend.") + pterm.Println() + + // Create the heatmap with the specified data and options, and render it. + pterm.DefaultHeatmap.WithData(data).WithBoxed(false).WithAxisData(headerData).WithLegend(false).Render() } ``` @@ -1659,11 +2138,19 @@ import ( ) func main() { + // Show an interactive confirmation dialog and get the result. result, _ := pterm.DefaultInteractiveConfirm.Show() - pterm.Println() // Blank line + + // Print a blank line for better readability. + pterm.Println() + + // Print the user's answer in a formatted way. pterm.Info.Printfln("You answered: %s", boolToText(result)) } +// boolToText converts a boolean value to a colored text. +// If the value is true, it returns a green "Yes". +// If the value is false, it returns a red "No". func boolToText(b bool) string { if b { return pterm.Green("Yes") @@ -1691,8 +2178,21 @@ import ( ) func main() { - result, _ := pterm.DefaultInteractiveContinue.Show() - pterm.Println() // Blank line + // Create an interactive continue prompt with default settings + // This will pause the program execution until the user presses enter + // The message displayed is "Press 'Enter' to continue..." + prompt := pterm.DefaultInteractiveContinue + + // Show the prompt and wait for user input + // The returned result is the user's input (should be empty as it's a continue prompt) + // The second return value is an error which is ignored here + result, _ := prompt.Show() + + // Print a blank line for better readability + pterm.Println() + + // Print the user's input with an info prefix + // As this is a continue prompt, the input should be empty pterm.Info.Printfln("You answered: %s", result) } @@ -1700,9 +2200,9 @@ func main() {
-### interactive_multiselect/custom-checkmarks +### interactive_multiselect/demo -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/interactive_multiselect/custom-checkmarks/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/interactive_multiselect/demo/animation.svg)
@@ -1713,25 +2213,28 @@ package main import ( "fmt" - - "atomicgo.dev/keyboard/keys" - "github.com/pterm/pterm" ) func main() { + // Initialize an empty slice to hold the options. var options []string - for i := 0; i < 5; i++ { + // Populate the options slice with 100 options. + for i := 0; i < 100; i++ { options = append(options, fmt.Sprintf("Option %d", i)) } - printer := pterm.DefaultInteractiveMultiselect.WithOptions(options) - printer.Filter = false - printer.KeyConfirm = keys.Enter - printer.KeySelect = keys.Space - printer.Checkmark = &pterm.Checkmark{Checked: pterm.Green("+"), Unchecked: pterm.Red("-")} - selectedOptions, _ := printer.Show() + // Add 5 more options to the slice, indicating the availability of fuzzy searching. + for i := 0; i < 5; i++ { + options = append(options, fmt.Sprintf("You can use fuzzy searching (%d)", i)) + } + + // Use PTerm's interactive multiselect to present the options to the user and capture their selections. + // The Show() method displays the options and waits for user input. + selectedOptions, _ := pterm.DefaultInteractiveMultiselect.WithOptions(options).Show() + + // Print the selected options, highlighted in green. pterm.Info.Printfln("Selected options: %s", pterm.Green(selectedOptions)) } @@ -1739,9 +2242,9 @@ func main() {
-### interactive_multiselect/custom-keys +### interactive_multiselect/custom-checkmarks -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/interactive_multiselect/custom-keys/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/interactive_multiselect/custom-checkmarks/animation.svg)
@@ -1752,23 +2255,29 @@ package main import ( "fmt" - - "atomicgo.dev/keyboard/keys" "github.com/pterm/pterm" ) func main() { + // Initialize an empty slice to hold the options var options []string + // Populate the options slice with 5 options for i := 0; i < 5; i++ { options = append(options, fmt.Sprintf("Option %d", i)) } - printer := pterm.DefaultInteractiveMultiselect.WithOptions(options) - printer.Filter = false - printer.KeyConfirm = keys.Enter - printer.KeySelect = keys.Space + // Create a new interactive multiselect printer with the options + // Disable the filter and define the checkmark symbols + printer := pterm.DefaultInteractiveMultiselect. + WithOptions(options). + WithFilter(false). + WithCheckmark(&pterm.Checkmark{Checked: pterm.Green("+"), Unchecked: pterm.Red("-")}) + + // Show the interactive multiselect and get the selected options selectedOptions, _ := printer.Show() + + // Print the selected options pterm.Info.Printfln("Selected options: %s", pterm.Green(selectedOptions)) } @@ -1776,9 +2285,9 @@ func main() {
-### interactive_multiselect/demo +### interactive_multiselect/custom-keys -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/interactive_multiselect/demo/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/interactive_multiselect/custom-keys/animation.svg)
@@ -1788,23 +2297,32 @@ func main() { package main import ( + "atomicgo.dev/keyboard/keys" "fmt" - "github.com/pterm/pterm" ) func main() { + // Initialize an empty slice to hold the options var options []string - for i := 0; i < 100; i++ { + // Populate the options slice with 5 options + for i := 0; i < 5; i++ { options = append(options, fmt.Sprintf("Option %d", i)) } - for i := 0; i < 5; i++ { - options = append(options, fmt.Sprintf("You can use fuzzy searching (%d)", i)) - } + // Create a new interactive multiselect printer with the options + // Disable the filter and set the keys for confirming and selecting options + printer := pterm.DefaultInteractiveMultiselect. + WithOptions(options). + WithFilter(false). + WithKeyConfirm(keys.Enter). + WithKeySelect(keys.Space) - selectedOptions, _ := pterm.DefaultInteractiveMultiselect.WithOptions(options).Show() + // Show the interactive multiselect and get the selected options + selectedOptions, _ := printer.Show() + + // Print the selected options pterm.Info.Printfln("Selected options: %s", pterm.Green(selectedOptions)) } @@ -1825,22 +2343,28 @@ package main import ( "fmt" - "github.com/pterm/pterm" ) func main() { + // Initialize an empty slice to hold the options var options []string + // Generate 100 options and add them to the options slice for i := 0; i < 100; i++ { options = append(options, fmt.Sprintf("Option %d", i)) } + // Generate 5 additional options with a specific message and add them to the options slice for i := 0; i < 5; i++ { options = append(options, fmt.Sprintf("You can use fuzzy searching (%d)", i)) } + // Use PTerm's interactive select feature to present the options to the user and capture their selection + // The Show() method displays the options and waits for the user's input selectedOption, _ := pterm.DefaultInteractiveSelect.WithOptions(options).Show() + + // Display the selected option to the user with a green color for emphasis pterm.Info.Printfln("Selected option: %s", pterm.Green(selectedOption)) } @@ -1864,8 +2388,43 @@ import ( ) func main() { - result, _ := pterm.DefaultInteractiveTextInput.WithMultiLine(false).Show() - pterm.Println() // Blank line + // Create an interactive text input with single line input mode and show it + result, _ := pterm.DefaultInteractiveTextInput.Show() + + // Print a blank line for better readability + pterm.Println() + + // Print the user's answer with an info prefix + pterm.Info.Printfln("You answered: %s", result) +} + +``` + +
+ +### interactive_textinput/default-value + +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/interactive_textinput/default-value/animation.svg) + +
+ +SHOW SOURCE + +```go +package main + +import ( + "github.com/pterm/pterm" +) + +func main() { + // Create an interactive text input with single line input mode and show it + result, _ := pterm.DefaultInteractiveTextInput.WithDefaultValue("Some default value").Show() + + // Print a blank line for better readability + pterm.Println() + + // Print the user's answer with an info prefix pterm.Info.Printfln("You answered: %s", result) } @@ -1889,8 +2448,19 @@ import ( ) func main() { - result, _ := pterm.DefaultInteractiveTextInput.WithMultiLine().Show() // Text input with multi line enabled - pterm.Println() // Blank line + // Create a default interactive text input with multi-line enabled. + // This allows the user to input multiple lines of text. + textInput := pterm.DefaultInteractiveTextInput.WithMultiLine() + + // Show the text input to the user and store the result. + // The second return value (an error) is ignored with '_'. + result, _ := textInput.Show() + + // Print a blank line for better readability in the output. + pterm.Println() + + // Print the user's input prefixed with an informational message. + // The '%s' placeholder is replaced with the user's input. pterm.Info.Printfln("You answered: %s", result) } @@ -1909,13 +2479,97 @@ func main() { ```go package main -import "github.com/pterm/pterm" +import "github.com/pterm/pterm" + +func main() { + // Create an interactive text input with a mask for password input + passwordInput := pterm.DefaultInteractiveTextInput.WithMask("*") + + // Show the password input prompt and store the result + result, _ := passwordInput.Show("Enter your password") + + // Get the default logger from PTerm + logger := pterm.DefaultLogger + + // Log the received password (masked) + // Note: In a real-world application, you should never log passwords + logger.Info("Password received", logger.Args("password", result)) +} + +``` + +
+ +### logger/demo + +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/logger/demo/animation.svg) + +
+ +SHOW SOURCE + +```go +package main + +import ( + "github.com/pterm/pterm" + "time" +) + +func main() { + // Create a logger with trace level + logger := pterm.DefaultLogger.WithLevel(pterm.LogLevelTrace) + + // Log a trace level message + logger.Trace("Doing not so important stuff", logger.Args("priority", "super low")) + + // Pause for 3 seconds + sleep() + + // Define a map with interesting stuff + interstingStuff := map[string]any{ + "when were crayons invented": "1903", + "what is the meaning of life": 42, + "is this interesting": true, + } + + // Log a debug level message with arguments from the map + logger.Debug("This might be interesting", logger.ArgsFromMap(interstingStuff)) + + // Pause for 3 seconds + sleep() + + // Log an info level message + logger.Info("That was actually interesting", logger.Args("such", "wow")) + + // Pause for 3 seconds + sleep() + + // Log a warning level message + logger.Warn("Oh no, I see an error coming to us!", logger.Args("speed", 88, "measures", "mph")) + + // Pause for 3 seconds + sleep() + + // Log an error level message + logger.Error("Damn, here it is!", logger.Args("error", "something went wrong")) + + // Pause for 3 seconds + sleep() + + // Log an info level message with a long text that will be automatically wrapped + logger.Info("But what's really cool is, that you can print very long logs, and PTerm will automatically wrap them for you! Say goodbye to text, that has weird line breaks!", logger.Args("very", "long")) + + // Pause for 3 seconds + sleep() -func main() { - result, _ := pterm.DefaultInteractiveTextInput.WithMask("*").Show("Enter your password") + // Log a fatal level message + logger.Fatal("Oh no, this process is getting killed!", logger.Args("fatal", true)) +} - logger := pterm.DefaultLogger - logger.Info("Password received", logger.Args("password", result)) +// Function to pause the execution for 3 seconds +func sleep() { + time.Sleep(time.Second * 3) } ``` @@ -1936,20 +2590,27 @@ package main import "github.com/pterm/pterm" func main() { - logger := pterm.DefaultLogger.WithLevel(pterm.LogLevelTrace) // Only show logs with a level of Trace or higher. + // Create a logger with a level of Trace or higher. + logger := pterm.DefaultLogger.WithLevel(pterm.LogLevelTrace) - // Overwrite all key styles with a new map - logger = logger.WithKeyStyles(map[string]pterm.Style{ + // Define a new style for the "priority" key. + priorityStyle := map[string]pterm.Style{ "priority": *pterm.NewStyle(pterm.FgRed), - }) + } - // The priority key should now be red + // Overwrite all key styles with the new map. + logger = logger.WithKeyStyles(priorityStyle) + + // Log an info message. The "priority" key will be displayed in red. logger.Info("The priority key should now be red", logger.Args("priority", "low", "foo", "bar")) - // Append a key style to the exisiting ones - logger.AppendKeyStyle("foo", *pterm.NewStyle(pterm.FgBlue)) + // Define a new style for the "foo" key. + fooStyle := *pterm.NewStyle(pterm.FgBlue) + + // Append the new style to the existing ones. + logger.AppendKeyStyle("foo", fooStyle) - // The foo key should now be blue + // Log another info message. The "foo" key will be displayed in blue. logger.Info("The foo key should now be blue", logger.Args("priority", "low", "foo", "bar")) } @@ -1974,23 +2635,38 @@ import ( ) func main() { - logger := pterm.DefaultLogger.WithLevel(pterm.LogLevelTrace) // Only show logs with a level of Trace or higher. + // Create a logger with a level of Trace or higher. + logger := pterm.DefaultLogger.WithLevel(pterm.LogLevelTrace) + // Log a trace message with additional arguments. logger.Trace("Doing not so important stuff", logger.Args("priority", "super low")) - // You can also use the `ArgsFromMap` function to create a `Args` object from a map. + // Create a map of interesting stuff. interstingStuff := map[string]any{ "when were crayons invented": "1903", "what is the meaning of life": 42, "is this interesting": true, } + + // Log a debug message with arguments from a map. logger.Debug("This might be interesting", logger.ArgsFromMap(interstingStuff)) + // Log an info message with additional arguments. logger.Info("That was actually interesting", logger.Args("such", "wow")) + + // Log a warning message with additional arguments. logger.Warn("Oh no, I see an error coming to us!", logger.Args("speed", 88, "measures", "mph")) + + // Log an error message with additional arguments. logger.Error("Damn, here it is!", logger.Args("error", "something went wrong")) + + // Log an info message with additional arguments. PTerm will automatically wrap long logs. logger.Info("But what's really cool is, that you can print very long logs, and PTerm will automatically wrap them for you! Say goodbye to text, that has weird line breaks!", logger.Args("very", "long")) + + // Pause for 2 seconds. time.Sleep(time.Second * 2) + + // Log a fatal message with additional arguments. This will terminate the process. logger.Fatal("Oh no, this process is getting killed!", logger.Args("fatal", true)) } @@ -1998,9 +2674,9 @@ func main() {
-### logger/demo +### logger/json -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/logger/demo/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/logger/json/animation.svg)
@@ -2009,49 +2685,40 @@ func main() { ```go package main -import ( - "github.com/pterm/pterm" - "time" -) +import "github.com/pterm/pterm" func main() { - logger := pterm.DefaultLogger. - WithLevel(pterm.LogLevelTrace) + // Create a logger with Trace level and JSON formatter + logger := pterm.DefaultLogger.WithLevel(pterm.LogLevelTrace).WithFormatter(pterm.LogFormatterJSON) + // Log a Trace level message with additional arguments logger.Trace("Doing not so important stuff", logger.Args("priority", "super low")) - sleep() - - interstingStuff := map[string]any{ + // Create a map of interesting stuff + interestingStuff := map[string]any{ "when were crayons invented": "1903", "what is the meaning of life": 42, "is this interesting": true, } - logger.Debug("This might be interesting", logger.ArgsFromMap(interstingStuff)) - sleep() + // Log a Debug level message with arguments from the map + logger.Debug("This might be interesting", logger.ArgsFromMap(interestingStuff)) + + // Log Info, Warn, Error, and Fatal level messages with additional arguments logger.Info("That was actually interesting", logger.Args("such", "wow")) - sleep() logger.Warn("Oh no, I see an error coming to us!", logger.Args("speed", 88, "measures", "mph")) - sleep() logger.Error("Damn, here it is!", logger.Args("error", "something went wrong")) - sleep() logger.Info("But what's really cool is, that you can print very long logs, and PTerm will automatically wrap them for you! Say goodbye to text, that has weird line breaks!", logger.Args("very", "long")) - sleep() logger.Fatal("Oh no, this process is getting killed!", logger.Args("fatal", true)) } -func sleep() { - time.Sleep(time.Second * 3) -} - ```
-### logger/json +### logger/with-caller -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/logger/json/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/logger/with-caller/animation.svg)
@@ -2063,24 +2730,35 @@ package main import "github.com/pterm/pterm" func main() { - logger := pterm.DefaultLogger. - WithLevel(pterm.LogLevelTrace). // Only show logs with a level of Trace or higher. - WithFormatter(pterm.LogFormatterJSON) // ! Make the logger print JSON logs. + // Create a logger with Trace level and caller information + logger := pterm.DefaultLogger.WithLevel(pterm.LogLevelTrace).WithCaller() + // Log a trace message with additional arguments logger.Trace("Doing not so important stuff", logger.Args("priority", "super low")) - // You can also use the `ArgsFromMap` function to create a `Args` object from a map. - interstingStuff := map[string]any{ + // Create a map of interesting stuff + interestingStuff := map[string]any{ "when were crayons invented": "1903", "what is the meaning of life": 42, "is this interesting": true, } - logger.Debug("This might be interesting", logger.ArgsFromMap(interstingStuff)) + // Log a debug message with arguments from a map + logger.Debug("This might be interesting", logger.ArgsFromMap(interestingStuff)) + + // Log an info message with additional arguments logger.Info("That was actually interesting", logger.Args("such", "wow")) + + // Log a warning message with additional arguments logger.Warn("Oh no, I see an error coming to us!", logger.Args("speed", 88, "measures", "mph")) + + // Log an error message with additional arguments logger.Error("Damn, here it is!", logger.Args("error", "something went wrong")) + + // Log an info message with additional arguments. PTerm will automatically wrap long logs. logger.Info("But what's really cool is, that you can print very long logs, and PTerm will automatically wrap them for you! Say goodbye to text, that has weird line breaks!", logger.Args("very", "long")) + + // Log a fatal message with additional arguments. This will terminate the process. logger.Fatal("Oh no, this process is getting killed!", logger.Args("fatal", true)) } @@ -2088,9 +2766,9 @@ func main() {
-### logger/with-caller +### multiple-live-printers/demo -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/logger/with-caller/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/multiple-live-printers/demo/animation.svg)
@@ -2099,28 +2777,63 @@ func main() { ```go package main -import "github.com/pterm/pterm" +import ( + "time" + + "github.com/pterm/pterm" +) func main() { - logger := pterm.DefaultLogger. - WithLevel(pterm.LogLevelTrace). // Only show logs with a level of Trace or higher. - WithCaller() // ! Show the caller of the log function. + // Create a multi printer for managing multiple printers + multi := pterm.DefaultMultiPrinter - logger.Trace("Doing not so important stuff", logger.Args("priority", "super low")) + // Create two spinners with their own writers + spinner1, _ := pterm.DefaultSpinner.WithWriter(multi.NewWriter()).Start("Spinner 1") + spinner2, _ := pterm.DefaultSpinner.WithWriter(multi.NewWriter()).Start("Spinner 2") - // You can also use the `ArgsFromMap` function to create a `Args` object from a map. - interstingStuff := map[string]any{ - "when were crayons invented": "1903", - "what is the meaning of life": 42, - "is this interesting": true, + // Create five progress bars with their own writers and a total of 100 + pb1, _ := pterm.DefaultProgressbar.WithTotal(100).WithWriter(multi.NewWriter()).Start("Progressbar 1") + pb2, _ := pterm.DefaultProgressbar.WithTotal(100).WithWriter(multi.NewWriter()).Start("Progressbar 2") + pb3, _ := pterm.DefaultProgressbar.WithTotal(100).WithWriter(multi.NewWriter()).Start("Progressbar 3") + pb4, _ := pterm.DefaultProgressbar.WithTotal(100).WithWriter(multi.NewWriter()).Start("Progressbar 4") + pb5, _ := pterm.DefaultProgressbar.WithTotal(100).WithWriter(multi.NewWriter()).Start("Progressbar 5") + + // Start the multi printer + multi.Start() + + // Increment progress bars and spinners based on certain conditions + for i := 1; i <= 100; i++ { + pb1.Increment() // Increment progress bar 1 every iteration + + if i%2 == 0 { + pb2.Add(3) // Add 3 to progress bar 2 every even iteration + } + + if i%5 == 0 { + pb3.Increment() // Increment progress bar 3 every 5th iteration + } + + if i%10 == 0 { + pb4.Increment() // Increment progress bar 4 every 10th iteration + } + + if i%3 == 0 { + pb5.Increment() // Increment progress bar 5 every 3rd iteration + } + + if i%50 == 0 { + spinner1.Success("Spinner 1 is done!") // Mark spinner 1 as successful every 50th iteration + } + + if i%60 == 0 { + spinner2.Fail("Spinner 2 failed!") // Mark spinner 2 as failed every 60th iteration + } + + time.Sleep(time.Millisecond * 50) // Sleep for 50 milliseconds between each iteration } - logger.Debug("This might be interesting", logger.ArgsFromMap(interstingStuff)) - logger.Info("That was actually interesting", logger.Args("such", "wow")) - logger.Warn("Oh no, I see an error coming to us!", logger.Args("speed", 88, "measures", "mph")) - logger.Error("Damn, here it is!", logger.Args("error", "something went wrong")) - logger.Info("But what's really cool is, that you can print very long logs, and PTerm will automatically wrap them for you! Say goodbye to text, that has weird line breaks!", logger.Args("very", "long")) - logger.Fatal("Oh no, this process is getting killed!", logger.Args("fatal", true)) + // Stop the multi printer + multi.Stop() } ``` @@ -2141,13 +2854,20 @@ package main import "github.com/pterm/pterm" func main() { - // Declare panels in a two dimensional grid system. + // Define panels in a 2D grid system panels := pterm.Panels{ - {{Data: "This is the first panel"}, {Data: pterm.DefaultHeader.Sprint("Hello, World!")}, {Data: "This\npanel\ncontains\nmultiple\nlines"}}, - {{Data: pterm.Red("This is another\npanel line")}, {Data: "This is the second panel\nwith a new line"}}, + { + {Data: "This is the first panel"}, + {Data: pterm.DefaultHeader.Sprint("Hello, World!")}, + {Data: "This\npanel\ncontains\nmultiple\nlines"}, + }, + { + {Data: pterm.Red("This is another\npanel line")}, + {Data: "This is the second panel\nwith a new line"}, + }, } - // Print panels. + // Render the panels with a padding of 5 _ = pterm.DefaultPanel.WithPanels(panels).WithPadding(5).Render() } @@ -2155,9 +2875,9 @@ func main() {
-### paragraph/customized +### paragraph/demo -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/paragraph/customized/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/paragraph/demo/animation.svg)
@@ -2169,15 +2889,18 @@ package main import "github.com/pterm/pterm" func main() { - // Print a paragraph with a custom maximal width. - pterm.DefaultParagraph.WithMaxWidth(60).Println("This is a custom paragraph printer. As you can see, no words are separated, " + + // Using the default paragraph printer to print a long text. + // The text is split at the spaces, which is useful for continuous text of all kinds. + // The line width can be manually adjusted if needed. + pterm.DefaultParagraph.Println("This is the default paragraph printer. As you can see, no words are separated, " + "but the text is split at the spaces. This is useful for continuous text of all kinds. You can manually change the line width if you want to." + "Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna aliquyam") - // Print one line space. + // Printing a line space for separation. pterm.Println() - // Print text without a paragraph printer. + // Printing a long text without using the paragraph printer. + // The default Println() function is used here, which does not provide intelligent splitting. pterm.Println("This text is written with the default Println() function. No intelligent splitting here." + "Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna aliquyam") } @@ -2186,9 +2909,9 @@ func main() {
-### paragraph/demo +### paragraph/customized -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/paragraph/demo/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/paragraph/customized/animation.svg)
@@ -2200,17 +2923,23 @@ package main import "github.com/pterm/pterm" func main() { - // Print long text with default paragraph printer. - pterm.DefaultParagraph.Println("This is the default paragraph printer. As you can see, no words are separated, " + + // Define a long text to be printed as a paragraph. + longText := "This is a custom paragraph printer. As you can see, no words are separated, " + "but the text is split at the spaces. This is useful for continuous text of all kinds. You can manually change the line width if you want to." + - "Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna aliquyam") + "Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna aliquyam" + + // Print the long text as a paragraph with a custom maximal width of 60 characters. + pterm.DefaultParagraph.WithMaxWidth(60).Println(longText) - // Print one line space. + // Print a line space to separate the paragraph from the following text. pterm.Println() - // Print long text without paragraph printer. - pterm.Println("This text is written with the default Println() function. No intelligent splitting here." + - "Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna aliquyam") + // Define another long text to be printed without a paragraph printer. + longTextWithoutParagraph := "This text is written with the default Println() function. No intelligent splitting here." + + "Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna aliquyam" + + // Print the long text without using a paragraph printer. + pterm.Println(longTextWithoutParagraph) } ``` @@ -2231,17 +2960,31 @@ package main import "github.com/pterm/pterm" func main() { - // Enable debug messages. + // Enable debug messages in PTerm. pterm.EnableDebugMessages() - pterm.Debug.Println("Hello, World!") // Print Debug. - pterm.Info.Println("Hello, World!") // Print Info. - pterm.Success.Println("Hello, World!") // Print Success. - pterm.Warning.Println("Hello, World!") // Print Warning. - pterm.Error.Println("Errors show the filename and linenumber inside the terminal!") // Print Error. - pterm.Info.WithShowLineNumber().Println("Other PrefixPrinters can do that too!") // Print Error. + // Print a debug message with PTerm. + pterm.Debug.Println("Hello, World!") + + // Print an informational message with PTerm. + pterm.Info.Println("Hello, World!") + + // Print a success message with PTerm. + pterm.Success.Println("Hello, World!") + + // Print a warning message with PTerm. + pterm.Warning.Println("Hello, World!") + + // Print an error message with PTerm. This will also display the filename and line number in the terminal. + pterm.Error.Println("Errors show the filename and linenumber inside the terminal!") + + // Print an informational message with PTerm, with line number. + // This demonstrates that other PrefixPrinters can also display line numbers. + pterm.Info.WithShowLineNumber().Println("Other PrefixPrinters can do that too!") + // Temporarily set Fatal to false, so that the CI won't crash. - pterm.Fatal.WithFatal(false).Println("Hello, World!") // Print Fatal. + // This will print a fatal message with PTerm, but won't terminate the program. + pterm.Fatal.WithFatal(false).Println("Hello, World!") } ``` @@ -2266,23 +3009,96 @@ import ( "github.com/pterm/pterm" ) -// Slice of strings with placeholder text. +// Slice of strings representing names of pseudo applications to be downloaded. var fakeInstallList = strings.Split("pseudo-excel pseudo-photoshop pseudo-chrome pseudo-outlook pseudo-explorer "+ "pseudo-dops pseudo-git pseudo-vsc pseudo-intellij pseudo-minecraft pseudo-scoop pseudo-chocolatey", " ") func main() { - // Create progressbar as fork from the default progressbar. + // Create a progressbar with the total steps equal to the number of items in fakeInstallList. + // Set the initial title of the progressbar to "Downloading stuff". p, _ := pterm.DefaultProgressbar.WithTotal(len(fakeInstallList)).WithTitle("Downloading stuff").Start() + // Loop over each item in the fakeInstallList. for i := 0; i < p.Total; i++ { + // Simulate a slow download for the 7th item. if i == 6 { - time.Sleep(time.Second * 3) // Simulate a slow download. + time.Sleep(time.Second * 3) + } + + // Update the title of the progressbar with the current item being downloaded. + p.UpdateTitle("Downloading " + fakeInstallList[i]) + + // Print a success message for the current download. This will be printed above the progressbar. + pterm.Success.Println("Downloading " + fakeInstallList[i]) + + // Increment the progressbar by one to indicate progress. + p.Increment() + + // Pause for 350 milliseconds to simulate the time taken for each download. + time.Sleep(time.Millisecond * 350) + } +} + +``` + +
+ +### progressbar/multiple + +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/progressbar/multiple/animation.svg) + +
+ +SHOW SOURCE + +```go +package main + +import ( + "time" + + "github.com/pterm/pterm" +) + +func main() { + // Create a multi printer instance from the default one + multi := pterm.DefaultMultiPrinter + + // Create five progress bars with a total of 100 units each, and assign each a new writer from the multi printer + pb1, _ := pterm.DefaultProgressbar.WithTotal(100).WithWriter(multi.NewWriter()).Start("Progressbar 1") + pb2, _ := pterm.DefaultProgressbar.WithTotal(100).WithWriter(multi.NewWriter()).Start("Progressbar 2") + pb3, _ := pterm.DefaultProgressbar.WithTotal(100).WithWriter(multi.NewWriter()).Start("Progressbar 3") + pb4, _ := pterm.DefaultProgressbar.WithTotal(100).WithWriter(multi.NewWriter()).Start("Progressbar 4") + pb5, _ := pterm.DefaultProgressbar.WithTotal(100).WithWriter(multi.NewWriter()).Start("Progressbar 5") + + // Start the multi printer + multi.Start() + + // Loop to increment progress bars based on certain conditions + for i := 1; i <= 100; i++ { + pb1.Increment() // Increment the first progress bar at each iteration + + if i%2 == 0 { + pb2.Add(3) // Add 3 units to the second progress bar at every even iteration + } + + if i%5 == 0 { + pb3.Increment() // Increment the third progress bar at every fifth iteration + } + + if i%10 == 0 { + pb4.Increment() // Increment the fourth progress bar at every tenth iteration + } + + if i%3 == 0 { + pb5.Increment() // Increment the fifth progress bar at every third iteration } - p.UpdateTitle("Downloading " + fakeInstallList[i]) // Update the title of the progressbar. - pterm.Success.Println("Downloading " + fakeInstallList[i]) // If a progressbar is running, each print will be printed above the progressbar. - p.Increment() // Increment the progressbar by one. Use Add(x int) to increment by a custom amount. - time.Sleep(time.Millisecond * 350) // Sleep 350 milliseconds. + + time.Sleep(time.Millisecond * 50) // Pause for 50 milliseconds at each iteration } + + // Stop the multi printer + multi.Stop() } ``` @@ -2303,14 +3119,16 @@ package main import "github.com/pterm/pterm" func main() { - // Print a section with level one. + // Create a section with level one and print it. pterm.DefaultSection.Println("This is a section!") - // Print placeholder. + + // Print an informational message. pterm.Info.Println("And here is some text.\nThis text could be anything.\nBasically it's just a placeholder") - // Print a section with level two. + // Create a section with level two and print it. pterm.DefaultSection.WithLevel(2).Println("This is another section!") - // Print placeholder. + + // Print another informational message. pterm.Info.Println("And this is\nmore placeholder text") } @@ -2318,6 +3136,53 @@ func main() {
+### slog/demo + +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/slog/demo/animation.svg) + +
+ +SHOW SOURCE + +```go +package main + +import ( + "log/slog" + + "github.com/pterm/pterm" +) + +func main() { + // Create a new slog handler with the default PTerm logger + handler := pterm.NewSlogHandler(&pterm.DefaultLogger) + + // Create a new slog logger with the handler + logger := slog.New(handler) + + // Log a debug message (won't show by default) + logger.Debug("This is a debug message that won't show") + + // Change the log level to debug to enable debug messages + pterm.DefaultLogger.Level = pterm.LogLevelDebug + + // Log a debug message (will show because debug level is enabled) + logger.Debug("This is a debug message", "changedLevel", true) + + // Log an info message + logger.Info("This is an info message") + + // Log a warning message + logger.Warn("This is a warning message") + + // Log an error message + logger.Error("This is an error message") +} + +``` + +
+ ### spinner/demo ![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/spinner/demo/animation.svg) @@ -2383,6 +3248,68 @@ func main() { +### spinner/multiple + +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/spinner/multiple/animation.svg) + +
+ +SHOW SOURCE + +```go +package main + +import ( + "time" + + "github.com/pterm/pterm" +) + +func main() { + // Create a multi printer. This allows multiple spinners to print simultaneously. + multi := pterm.DefaultMultiPrinter + + // Create and start spinner 1 with a new writer from the multi printer. + // The spinner will display the message "Spinner 1". + spinner1, _ := pterm.DefaultSpinner.WithWriter(multi.NewWriter()).Start("Spinner 1") + + // Create and start spinner 2 with a new writer from the multi printer. + // The spinner will display the message "Spinner 2". + spinner2, _ := pterm.DefaultSpinner.WithWriter(multi.NewWriter()).Start("Spinner 2") + + // Create and start spinner 3 with a new writer from the multi printer. + // The spinner will display the message "Spinner 3". + spinner3, _ := pterm.DefaultSpinner.WithWriter(multi.NewWriter()).Start("Spinner 3") + + // Start the multi printer. This will start printing all the spinners. + multi.Start() + + // Wait for 1 second. + time.Sleep(time.Millisecond * 1000) + + // Stop spinner 1 with a success message. + spinner1.Success("Spinner 1 is done!") + + // Wait for 750 milliseconds. + time.Sleep(time.Millisecond * 750) + + // Stop spinner 2 with a failure message. + spinner2.Fail("Spinner 2 failed!") + + // Wait for 500 milliseconds. + time.Sleep(time.Millisecond * 500) + + // Stop spinner 3 with a warning message. + spinner3.Warning("Spinner 3 has a warning!") + + // Stop the multi printer. This will stop printing all the spinners. + multi.Stop() +} + +``` + +
+ ### style/demo ![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/style/demo/animation.svg) @@ -2397,12 +3324,16 @@ package main import "github.com/pterm/pterm" func main() { - // Create styles as new variables + // Define a primary style with light cyan foreground, gray background, and bold text primary := pterm.NewStyle(pterm.FgLightCyan, pterm.BgGray, pterm.Bold) + + // Define a secondary style with light green foreground, white background, and italic text secondary := pterm.NewStyle(pterm.FgLightGreen, pterm.BgWhite, pterm.Italic) - // Use created styles + // Print "Hello, World!" with the primary style primary.Println("Hello, World!") + + // Print "Hello, World!" with the secondary style secondary.Println("Hello, World!") } @@ -2410,9 +3341,9 @@ func main() { -### table/boxed +### table/demo -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/table/boxed/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/table/demo/animation.svg)
@@ -2424,24 +3355,40 @@ package main import "github.com/pterm/pterm" func main() { - // Create a fork of the default table, fill it with data and print it. - // Data can also be generated and inserted later. - pterm.DefaultTable.WithHasHeader().WithBoxed().WithData(pterm.TableData{ + // Define the data for the first table + tableData1 := pterm.TableData{ {"Firstname", "Lastname", "Email", "Note"}, {"Paul", "Dean", "augue@velitAliquam.co.uk", ""}, {"Callie", "Mckay", "nunc.sed@est.com", "这是一个测试, haha!"}, {"Libby", "Camacho", "lobortis@semper.com", "just a test, hey!"}, {"张", "小宝", "zhang@example.com", ""}, - }).Render() + } + + // Create a table with a header and the defined data, then render it + pterm.DefaultTable.WithHasHeader().WithData(tableData1).Render() + + pterm.Println() // Blank line + + // Define the data for the second table + tableData2 := pterm.TableData{ + {"Firstname", "Lastname", "Email"}, + {"Paul\n\nNewline", "Dean", "augue@velitAliquam.co.uk"}, + {"Callie", "Mckay", "nunc.sed@est.com\nNewline"}, + {"Libby", "Camacho", "lobortis@semper.com"}, + {"张", "小宝", "zhang@example.com"}, + } + + // Create another table with a header and the defined data, then render it + pterm.DefaultTable.WithHasHeader().WithData(tableData2).Render() } ```
-### table/demo +### table/boxed -![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/table/demo/animation.svg) +![Animation](https://raw.githubusercontent.com/pterm/pterm/master/_examples/table/boxed/animation.svg)
@@ -2453,26 +3400,21 @@ package main import "github.com/pterm/pterm" func main() { - // Create a fork of the default table, fill it with data and print it. - // Data can also be generated and inserted later. - pterm.DefaultTable.WithHasHeader().WithData(pterm.TableData{ + // Define the data for the table. + // Each inner slice represents a row in the table. + // The first row is considered as the header of the table. + tableData := pterm.TableData{ {"Firstname", "Lastname", "Email", "Note"}, {"Paul", "Dean", "augue@velitAliquam.co.uk", ""}, {"Callie", "Mckay", "nunc.sed@est.com", "这是一个测试, haha!"}, {"Libby", "Camacho", "lobortis@semper.com", "just a test, hey!"}, {"张", "小宝", "zhang@example.com", ""}, - }).Render() - - pterm.Println() // Blank line + } - // Create a table with multiple lines in a row. - pterm.DefaultTable.WithHasHeader().WithData(pterm.TableData{ - {"Firstname", "Lastname", "Email"}, - {"Paul\n\nNewline", "Dean", "augue@velitAliquam.co.uk"}, - {"Callie", "Mckay", "nunc.sed@est.com\nNewline"}, - {"Libby", "Camacho", "lobortis@semper.com"}, - {"张", "小宝", "zhang@example.com"}, - }).Render() + // Create a table with the defined data. + // The table has a header and is boxed. + // Finally, render the table to print it. + pterm.DefaultTable.WithHasHeader().WithBoxed().WithData(tableData).Render() } ``` @@ -2493,14 +3435,19 @@ package main import "github.com/pterm/pterm" func main() { - // Create a table with multiple lines in a row and set a row separator. - pterm.DefaultTable.WithHasHeader().WithRowSeparator("-").WithHeaderRowSeparator("-").WithData(pterm.TableData{ + // Define the data for the table. + data := pterm.TableData{ {"Firstname", "Lastname", "Email"}, {"Paul\n\nNewline", "Dean", "augue@velitAliquam.co.uk"}, {"Callie", "Mckay", "nunc.sed@est.com\nNewline"}, {"Libby", "Camacho", "lobortis@semper.com"}, {"张", "小宝", "zhang@example.com"}, - }).Render() + } + + // Create and render the table. + // The options are chained in a single line for simplicity. + // The table has a header, a row separator, and a header row separator. + pterm.DefaultTable.WithHasHeader().WithRowSeparator("-").WithHeaderRowSeparator("-").WithData(data).Render() } ``` @@ -2521,15 +3468,21 @@ package main import "github.com/pterm/pterm" func main() { - // Create a fork of the default table, fill it with data and print it. - // Data can also be generated and inserted later. - pterm.DefaultTable.WithHasHeader().WithRightAlignment().WithData(pterm.TableData{ + // Define the data for the table. + // Each inner slice represents a row in the table. + // The first row is considered as the header. + tableData := pterm.TableData{ {"Firstname", "Lastname", "Email", "Note"}, {"Paul", "Dean", "augue@velitAliquam.co.uk", ""}, {"Callie", "Mckay", "nunc.sed@est.com", "这是一个测试, haha!"}, {"Libby", "Camacho", "lobortis@semper.com", "just a test, hey!"}, {"张", "小宝", "zhang@example.com", ""}, - }).Render() + } + + // Create a table with the defined data. + // The table has a header and the text in the cells is right-aligned. + // The Render() method is used to print the table to the console. + pterm.DefaultTable.WithHasHeader().WithRightAlignment().WithData(tableData).Render() } ``` @@ -2554,23 +3507,27 @@ import ( ) func main() { - // Print info. - pterm.Info.Println("These are the default theme styles.\n" + - "You can modify them easily to your personal preference,\n" + - "or create new themes from scratch :)") + // Print an informational message about the default theme styles. + pterm.Info.Println("These are the default theme styles.\nYou can modify them easily to your personal preference,\nor create new themes from scratch :)") - pterm.Println() // Print one line space. + // Print a blank line for better readability. + pterm.Println() - // Print every value of the default theme with its own style. + // Get the value and type of the default theme. v := reflect.ValueOf(pterm.ThemeDefault) typeOfS := v.Type() + // Check if the type of the default theme is 'pterm.Theme'. if typeOfS == reflect.TypeOf(pterm.Theme{}) { + // Iterate over each field in the default theme. for i := 0; i < v.NumField(); i++ { + // Try to convert the field to 'pterm.Style'. field, ok := v.Field(i).Interface().(pterm.Style) if ok { + // Print the field name using its own style. field.Println(typeOfS.Field(i).Name) } + // Pause for a quarter of a second to make the output easier to read. time.Sleep(time.Millisecond * 250) } } @@ -2596,11 +3553,17 @@ import ( ) func main() { + // Define a tree structure using pterm.TreeNode tree := pterm.TreeNode{ + // The top node of the tree Text: "Top node", + // The children of the top node Children: []pterm.TreeNode{{ + // A child node Text: "Child node", + // The children of the child node Children: []pterm.TreeNode{ + // Grandchildren nodes {Text: "Grandchild node"}, {Text: "Grandchild node"}, {Text: "Grandchild node"}, @@ -2608,6 +3571,7 @@ func main() { }}, } + // Render the tree with the defined structure as the root pterm.DefaultTree.WithRoot(tree).Render() } @@ -2632,37 +3596,37 @@ import ( ) func main() { - // You can use a LeveledList here, for easy generation. + // Define a leveled list to represent the structure of the directories. leveledList := pterm.LeveledList{ - pterm.LeveledListItem{Level: 0, Text: "C:"}, - pterm.LeveledListItem{Level: 1, Text: "Users"}, - pterm.LeveledListItem{Level: 1, Text: "Windows"}, - pterm.LeveledListItem{Level: 1, Text: "Programs"}, - pterm.LeveledListItem{Level: 1, Text: "Programs(x86)"}, - pterm.LeveledListItem{Level: 1, Text: "dev"}, - pterm.LeveledListItem{Level: 0, Text: "D:"}, - pterm.LeveledListItem{Level: 0, Text: "E:"}, - pterm.LeveledListItem{Level: 1, Text: "Movies"}, - pterm.LeveledListItem{Level: 1, Text: "Music"}, - pterm.LeveledListItem{Level: 2, Text: "LinkinPark"}, - pterm.LeveledListItem{Level: 1, Text: "Games"}, - pterm.LeveledListItem{Level: 2, Text: "Shooter"}, - pterm.LeveledListItem{Level: 3, Text: "CallOfDuty"}, - pterm.LeveledListItem{Level: 3, Text: "CS:GO"}, - pterm.LeveledListItem{Level: 3, Text: "Battlefield"}, - pterm.LeveledListItem{Level: 4, Text: "Battlefield 1"}, - pterm.LeveledListItem{Level: 4, Text: "Battlefield 2"}, - pterm.LeveledListItem{Level: 0, Text: "F:"}, - pterm.LeveledListItem{Level: 1, Text: "dev"}, - pterm.LeveledListItem{Level: 2, Text: "dops"}, - pterm.LeveledListItem{Level: 2, Text: "PTerm"}, - } - - // Generate tree from LeveledList. + {Level: 0, Text: "C:"}, + {Level: 1, Text: "Users"}, + {Level: 1, Text: "Windows"}, + {Level: 1, Text: "Programs"}, + {Level: 1, Text: "Programs(x86)"}, + {Level: 1, Text: "dev"}, + {Level: 0, Text: "D:"}, + {Level: 0, Text: "E:"}, + {Level: 1, Text: "Movies"}, + {Level: 1, Text: "Music"}, + {Level: 2, Text: "LinkinPark"}, + {Level: 1, Text: "Games"}, + {Level: 2, Text: "Shooter"}, + {Level: 3, Text: "CallOfDuty"}, + {Level: 3, Text: "CS:GO"}, + {Level: 3, Text: "Battlefield"}, + {Level: 4, Text: "Battlefield 1"}, + {Level: 4, Text: "Battlefield 2"}, + {Level: 0, Text: "F:"}, + {Level: 1, Text: "dev"}, + {Level: 2, Text: "dops"}, + {Level: 2, Text: "PTerm"}, + } + + // Convert the leveled list into a tree structure. root := putils.TreeFromLeveledList(leveledList) - root.Text = "Computer" + root.Text = "Computer" // Set the root node text. - // Render TreePrinter + // Render the tree structure using the default tree printer. pterm.DefaultTree.WithRoot(root).Render() } diff --git a/vendor/github.com/pterm/pterm/SECURITY.md b/vendor/github.com/pterm/pterm/SECURITY.md index 27611496..3e4653f8 100644 --- a/vendor/github.com/pterm/pterm/SECURITY.md +++ b/vendor/github.com/pterm/pterm/SECURITY.md @@ -8,7 +8,6 @@ PTerm is a command-line interface (CLI) tool library, and we believe the securit If you discover a security issue in PTerm, please follow these steps: Open a new issue in the PTerm GitHub repository, describing the security problem in detail. -Do not disclose any sensitive information or exploit details in the issue, as PTerm is not considered to have any exploitable features. ## 3. Vulnerable Dependencies If a dependency of PTerm is found to be vulnerable or infected and requires immediate updates, please follow these steps: diff --git a/vendor/github.com/pterm/pterm/area_printer.go b/vendor/github.com/pterm/pterm/area_printer.go index 5f3e5b04..ed4b0c22 100644 --- a/vendor/github.com/pterm/pterm/area_printer.go +++ b/vendor/github.com/pterm/pterm/area_printer.go @@ -1,6 +1,7 @@ package pterm import ( + "io" "strings" "atomicgo.dev/cursor" @@ -47,6 +48,11 @@ func (p AreaPrinter) WithCenter(b ...bool) *AreaPrinter { return &p } +// SetWriter sets the writer for the AreaPrinter. +func (p *AreaPrinter) SetWriter(writer io.Writer) { + +} + // Update overwrites the content of the AreaPrinter. // Can be used live. func (p *AreaPrinter) Update(text ...interface{}) { diff --git a/vendor/github.com/pterm/pterm/box_printer.go b/vendor/github.com/pterm/pterm/box_printer.go index 8bff4671..3185e024 100644 --- a/vendor/github.com/pterm/pterm/box_printer.go +++ b/vendor/github.com/pterm/pterm/box_printer.go @@ -240,8 +240,8 @@ func (p BoxPrinter) Sprint(a ...interface{}) string { maxWidth+p.LeftPadding+p.RightPadding) + p.BoxStyle.Sprint(p.TopLeftCornerString) } else { p.Title = strings.ReplaceAll(p.Title, "\n", " ") - if (maxWidth + p.RightPadding + p.LeftPadding - 4) < len(RemoveColorFromString(p.Title)) { - p.RightPadding = len(RemoveColorFromString(p.Title)) - (maxWidth + p.RightPadding + p.LeftPadding - 5) + if (maxWidth + p.RightPadding + p.LeftPadding - 4) < internal.GetStringMaxWidth(p.Title) { + p.RightPadding = internal.GetStringMaxWidth(p.Title) - (maxWidth + p.RightPadding + p.LeftPadding - 5) } if p.TitleTopLeft { topLine = p.BoxStyle.Sprint(p.BottomRightCornerString) + internal.AddTitleToLine(p.Title, p.BoxStyle.Sprint(p.HorizontalString), maxWidth+p.LeftPadding+p.RightPadding, true) + p.BoxStyle.Sprint(p.BottomLeftCornerString) diff --git a/vendor/github.com/pterm/pterm/bulletlist_printer.go b/vendor/github.com/pterm/pterm/bulletlist_printer.go index ed997aa5..8e6afcb0 100644 --- a/vendor/github.com/pterm/pterm/bulletlist_printer.go +++ b/vendor/github.com/pterm/pterm/bulletlist_printer.go @@ -116,10 +116,18 @@ func (l BulletListPrinter) Srender() (string, error) { item.BulletStyle = l.BulletStyle } } - if item.Bullet == "" { - ret += strings.Repeat(" ", item.Level) + item.BulletStyle.Sprint(l.Bullet) + " " + item.TextStyle.Sprint(item.Text) + "\n" - } else { - ret += strings.Repeat(" ", item.Level) + item.BulletStyle.Sprint(item.Bullet) + " " + item.TextStyle.Sprint(item.Text) + "\n" + + split := strings.Split(item.Text, "\n") + for i, line := range split { + if i == 0 { + if item.Bullet == "" { + ret += strings.Repeat(" ", item.Level) + item.BulletStyle.Sprint(l.Bullet) + " " + item.TextStyle.Sprint(line) + "\n" + } else { + ret += strings.Repeat(" ", item.Level) + item.BulletStyle.Sprint(item.Bullet) + " " + item.TextStyle.Sprint(line) + "\n" + } + } else { + ret += strings.Repeat(" ", item.Level) + strings.Repeat(" ", len(item.Bullet)) + " " + item.TextStyle.Sprint(line) + "\n" + } } } return ret, nil diff --git a/vendor/github.com/pterm/pterm/errors.go b/vendor/github.com/pterm/pterm/errors.go index a7d6fcc7..9260ab64 100644 --- a/vendor/github.com/pterm/pterm/errors.go +++ b/vendor/github.com/pterm/pterm/errors.go @@ -8,4 +8,7 @@ var ( // ErrHexCodeIsInvalid - the given HEX code is invalid. ErrHexCodeIsInvalid = errors.New("hex code is not valid") + + // ErrKeyWithoutValue - an odd number of arguments was passed to a pterm Logger's Args method. + ErrKeyWithoutValue = "ERROR: key_without_value" ) diff --git a/vendor/github.com/pterm/pterm/heatmap_printer.go b/vendor/github.com/pterm/pterm/heatmap_printer.go new file mode 100644 index 00000000..4fac71e3 --- /dev/null +++ b/vendor/github.com/pterm/pterm/heatmap_printer.go @@ -0,0 +1,744 @@ +package pterm + +import ( + "bytes" + "errors" + "io" + "math" + "strings" + + "github.com/pterm/pterm/internal" +) + +// DefaultHeatmap contains standards, which can be used to print a HeatmapPrinter. +var DefaultHeatmap = HeatmapPrinter{ + AxisStyle: &ThemeDefault.HeatmapHeaderStyle, + SeparatorStyle: &ThemeDefault.HeatmapSeparatorStyle, + VerticalSeparator: "│", + TopRightCornerSeparator: "└", + TopLeftCornerSeparator: "┘", + BottomLeftCornerSeparator: "┐", + BottomRightCornerSeparator: "┌", + HorizontalSeparator: "─", + TSeparator: "┬", + TReverseSeparator: "┴", + LSeparator: "├", + LReverseSeparator: "┤", + TCrossSeparator: "┼", + LegendLabel: "Legend", + Boxed: true, + Grid: true, + Legend: true, + TextRGB: RGB{0, 0, 0, false}, + RGBRange: []RGB{{R: 255, G: 0, B: 0, Background: true}, {R: 255, G: 165, B: 0, Background: true}, {R: 0, G: 255, B: 0, Background: true}}, + TextColor: FgBlack, + Colors: []Color{BgRed, BgLightRed, BgYellow, BgLightYellow, BgLightGreen, BgGreen}, + + EnableRGB: false, +} + +// HeatmapData is the type that contains the data of a HeatmapPrinter. +type HeatmapData [][]float32 + +type HeatmapAxis struct { + XAxis []string + YAxis []string +} + +// HeatmapPrinter is able to render tables. +type HeatmapPrinter struct { + HasHeader bool + AxisStyle *Style + VerticalSeparator string + TopRightCornerSeparator string + TopLeftCornerSeparator string + BottomLeftCornerSeparator string + BottomRightCornerSeparator string + HorizontalSeparator string + TSeparator string + TReverseSeparator string + LSeparator string + LReverseSeparator string + TCrossSeparator string + LegendLabel string + SeparatorStyle *Style + Data HeatmapData + Axis HeatmapAxis + Boxed bool + Grid bool + OnlyColoredCells bool + LegendOnlyColoredCells bool + EnableComplementaryColor bool + Legend bool + CellSize int + Colors []Color + TextColor Color + EnableRGB bool + RGBRange []RGB + TextRGB RGB + Writer io.Writer + + minValue float32 + maxValue float32 + + rgbLegendValue int +} + +var complementaryColors = map[Color]Color{ + BgBlack: FgLightWhite, + BgRed: FgCyan, + BgGreen: FgMagenta, + BgYellow: FgBlue, + BgBlue: FgYellow, + BgMagenta: FgGreen, + BgCyan: FgRed, + BgWhite: FgBlack, + BgDefault: FgBlack, + BgDarkGray: FgLightWhite, + BgLightRed: FgLightCyan, + BgLightGreen: FgLightMagenta, + BgLightYellow: FgLightBlue, + BgLightBlue: FgLightYellow, + BgLightMagenta: FgLightGreen, + BgLightCyan: FgLightRed, + BgLightWhite: FgBlack, +} + +// WithAxisData returns a new HeatmapPrinter, where the first line and row are headers. +func (p HeatmapPrinter) WithAxisData(hd HeatmapAxis) *HeatmapPrinter { + p.HasHeader = true + p.Axis = hd + return &p +} + +// WithAxisStyle returns a new HeatmapPrinter with a specific AxisStyle. +func (p HeatmapPrinter) WithAxisStyle(style *Style) *HeatmapPrinter { + p.AxisStyle = style + return &p +} + +// WithSeparatorStyle returns a new HeatmapPrinter with a specific SeparatorStyle. +func (p HeatmapPrinter) WithSeparatorStyle(style *Style) *HeatmapPrinter { + p.SeparatorStyle = style + return &p +} + +// WithData returns a new HeatmapPrinter with specific Data. +func (p HeatmapPrinter) WithData(data [][]float32) *HeatmapPrinter { + p.Data = data + return &p +} + +// WithTextColor returns a new HeatmapPrinter with a specific TextColor. +// This sets EnableComplementaryColor to false. +func (p HeatmapPrinter) WithTextColor(color Color) *HeatmapPrinter { + p.TextColor = color + p.EnableComplementaryColor = false + return &p +} + +// WithTextRGB returns a new HeatmapPrinter with a specific TextRGB. +// This sets EnableComplementaryColor to false. +func (p HeatmapPrinter) WithTextRGB(rgb RGB) *HeatmapPrinter { + p.TextRGB = rgb + p.EnableComplementaryColor = false + return &p +} + +// WithBoxed returns a new HeatmapPrinter with a box around the table. +// If set to true, Grid will be set to true too. +func (p HeatmapPrinter) WithBoxed(b ...bool) *HeatmapPrinter { + p.Boxed = internal.WithBoolean(b) + if p.Boxed && !p.Grid { + p.Grid = true + } + return &p +} + +// WithGrid returns a new HeatmapPrinter with a grid. +// If set to false, Boxed will be set to false too. +func (p HeatmapPrinter) WithGrid(b ...bool) *HeatmapPrinter { + b2 := internal.WithBoolean(b) + p.Grid = b2 + if !b2 && p.Boxed { + p.Boxed = false + } + return &p +} + +// WithEnableRGB returns a new HeatmapPrinter with RGB colors. +func (p HeatmapPrinter) WithEnableRGB(b ...bool) *HeatmapPrinter { + p.EnableRGB = internal.WithBoolean(b) + return &p +} + +// WithOnlyColoredCells returns a new HeatmapPrinter with only colored cells. +func (p HeatmapPrinter) WithOnlyColoredCells(b ...bool) *HeatmapPrinter { + b2 := internal.WithBoolean(b) + p.OnlyColoredCells = b2 + return &p +} + +// WithLegendOnlyColoredCells returns a new HeatmapPrinter with legend with only colored cells. +// This sets the Legend to true. +func (p HeatmapPrinter) WithLegendOnlyColoredCells(b ...bool) *HeatmapPrinter { + b2 := internal.WithBoolean(b) + p.LegendOnlyColoredCells = b2 + if b2 { + p.Legend = true + } + return &p +} + +// WithEnableComplementaryColor returns a new HeatmapPrinter with complement color. +func (p HeatmapPrinter) WithEnableComplementaryColor(b ...bool) *HeatmapPrinter { + p.EnableComplementaryColor = internal.WithBoolean(b) + return &p +} + +// WithLegend returns a new HeatmapPrinter with a legend. +func (p HeatmapPrinter) WithLegend(b ...bool) *HeatmapPrinter { + p.Legend = internal.WithBoolean(b) + return &p +} + +// WithCellSize returns a new HeatmapPrinter with a specific cell size. +// This only works if there is no header and OnlyColoredCells == true! +func (p HeatmapPrinter) WithCellSize(i int) *HeatmapPrinter { + p.CellSize = i + return &p +} + +// WithLegendLabel returns a new HeatmapPrinter with a specific legend tag. +// This sets the Legend to true. +func (p HeatmapPrinter) WithLegendLabel(s string) *HeatmapPrinter { + p.LegendLabel = s + p.Legend = true + return &p +} + +// WithRGBRange returns a new HeatmapPrinter with a specific RGBRange. +func (p HeatmapPrinter) WithRGBRange(rgb ...RGB) *HeatmapPrinter { + p.RGBRange = rgb + return &p +} + +// WithColors returns a new HeatmapPrinter with a specific Colors. +func (p HeatmapPrinter) WithColors(colors ...Color) *HeatmapPrinter { + p.Colors = colors + return &p +} + +// WithWriter sets the Writer. +func (p HeatmapPrinter) WithWriter(writer io.Writer) *HeatmapPrinter { + p.Writer = writer + return &p +} + +// Srender renders the HeatmapPrinter as a string. +func (p HeatmapPrinter) Srender() (string, error) { + if err := p.errCheck(); err != nil { + return "", err + } + + if p.SeparatorStyle == nil { + p.SeparatorStyle = DefaultHeatmap.SeparatorStyle + } + if p.AxisStyle == nil { + p.AxisStyle = DefaultHeatmap.AxisStyle + } + + if RawOutput { + p.Legend = false + } + + buffer := bytes.NewBufferString("") + xAmount := len(p.Data[0]) - 1 + yAmount := len(p.Data) - 1 + p.minValue, p.maxValue = minMaxFloat32(p.Data) + + var data string + for _, datum := range p.Data { + for _, f := range datum { + data += Sprintf("%v\n", f) + } + } + + if p.HasHeader { + data, xAmount, yAmount = p.computeAxisData(data, xAmount, yAmount) + } + + colWidth := internal.GetStringMaxWidth(data) + legendColWidth := colWidth + 2 + + if p.OnlyColoredCells && (p.CellSize > colWidth || !p.HasHeader) { + colWidth = p.CellSize + } + + if p.Boxed { + p.renderSeparatorRow(buffer, colWidth, xAmount, true) + } + + p.renderData(buffer, colWidth, xAmount, yAmount) + + if p.HasHeader { + p.renderHeader(buffer, colWidth, xAmount) + } + + if p.Boxed { + p.renderSeparatorRow(buffer, colWidth, xAmount, false) + } + + if p.Legend { + p.renderLegend(buffer, legendColWidth) + } + + buffer.WriteString("\n") + + return buffer.String(), nil +} + +func (p HeatmapPrinter) computeAxisData(data string, xAmount, yAmount int) (string, int, int) { + var header string + for _, h := range p.Axis.XAxis { + header += h + "\n" + } + for _, h := range p.Axis.YAxis { + header += h + "\n" + } + + if p.OnlyColoredCells { + data = header + } else { + data += header + } + xAmount++ + yAmount++ + + p.Axis.YAxis = append(p.Axis.YAxis, "") + + return data, xAmount, yAmount +} + +func (p HeatmapPrinter) renderSeparatorRow(buffer *bytes.Buffer, colWidth, xAmount int, top bool) { + tSep := p.TReverseSeparator + rightSep := p.TopRightCornerSeparator + leftSep := p.TopLeftCornerSeparator + + if top { + tSep = p.TSeparator + rightSep = p.BottomRightCornerSeparator + leftSep = p.BottomLeftCornerSeparator + } else { + buffer.WriteString("\n") + } + buffer.WriteString(p.SeparatorStyle.Sprint(rightSep)) + for i := 0; i < xAmount+1; i++ { + buffer.WriteString(strings.Repeat(p.SeparatorStyle.Sprint(p.HorizontalSeparator), colWidth)) + if i < xAmount { + buffer.WriteString(p.SeparatorStyle.Sprint(tSep)) + } + } + buffer.WriteString(p.SeparatorStyle.Sprint(leftSep)) + + if top { + buffer.WriteString("\n") + } +} + +func (p HeatmapPrinter) renderLegend(buffer *bytes.Buffer, legendColWidth int) { + buffer.WriteString("\n") + buffer.WriteString("\n") + if p.Boxed { + p.boxLegend(buffer, p.LegendLabel, legendColWidth) + } else { + p.generateLegend(buffer, p.LegendLabel, legendColWidth) + } +} + +func (p HeatmapPrinter) renderHeader(buffer *bytes.Buffer, colWidth int, xAmount int) { + buffer.WriteString("\n") + if p.Boxed { + buffer.WriteString(p.SeparatorStyle.Sprint(p.LSeparator)) + } + if p.Grid { + for i := 0; i < xAmount+1; i++ { + buffer.WriteString(strings.Repeat(p.SeparatorStyle.Sprint(p.HorizontalSeparator), colWidth)) + if i < xAmount { + buffer.WriteString(p.SeparatorStyle.Sprint(p.TCrossSeparator)) + } + } + } + if p.Boxed { + buffer.WriteString(p.SeparatorStyle.Sprint(p.LReverseSeparator)) + } + if p.Grid { + buffer.WriteString("\n") + } + for j, f := range p.Axis.XAxis { + if j == 0 { + if p.Boxed { + buffer.WriteString(p.SeparatorStyle.Sprint(p.VerticalSeparator)) + } + ct := internal.CenterText(" ", colWidth) + if len(ct) < colWidth { + ct += strings.Repeat(" ", colWidth-len(ct)) + } + buffer.WriteString(p.AxisStyle.Sprint(ct)) + if p.Grid { + buffer.WriteString(p.SeparatorStyle.Sprint(p.VerticalSeparator)) + } + } + var ct string + ct = internal.CenterText(Sprintf("%v", f), colWidth) + if len(ct) < colWidth { + ct += strings.Repeat(" ", colWidth-len(ct)) + } + buffer.WriteString(p.AxisStyle.Sprint(ct)) + + if j < xAmount { + if !p.Boxed && j == xAmount-1 { + continue + } + if p.Grid { + buffer.WriteString(p.SeparatorStyle.Sprint(p.VerticalSeparator)) + } + } + } +} + +func (p HeatmapPrinter) renderData(buffer *bytes.Buffer, colWidth int, xAmount int, yAmount int) { + for i, datum := range p.Data { + if p.Boxed { + buffer.WriteString(p.SeparatorStyle.Sprint(p.VerticalSeparator)) + } + for j, f := range datum { + if j == 0 && p.HasHeader { + ct := internal.CenterText(p.Axis.YAxis[i], colWidth) + if len(ct) < colWidth { + ct += strings.Repeat(" ", colWidth-len(ct)) + } + buffer.WriteString(p.AxisStyle.Sprint(ct)) + if p.Grid { + buffer.WriteString(p.SeparatorStyle.Sprint(p.VerticalSeparator)) + } + } + var ct string + if p.OnlyColoredCells { + ct = internal.CenterText(" ", colWidth) + } else { + ct = internal.CenterText(Sprintf("%v", f), colWidth) + } + if len(ct) < colWidth { + if len(Sprintf("%v", f)) == 1 { + ct += strings.Repeat(" ", colWidth-len(ct)) + } else { + ct = strings.Repeat(" ", colWidth-len(ct)) + ct + } + } + if p.EnableRGB { + rgb := p.RGBRange[0].Fade(p.minValue, p.maxValue, f, p.RGBRange[1:]...) + rgbStyle := NewRGBStyle(p.TextRGB, rgb) + if p.EnableComplementaryColor { + complimentary := NewRGB(internal.Complementary(rgb.R, rgb.G, rgb.B)) + rgbStyle = NewRGBStyle(complimentary, rgb) + } + buffer.WriteString(rgbStyle.Sprint(ct)) + } else { + color := getColor(p.minValue, p.maxValue, f, p.Colors...) + fgColor := p.TextColor + if p.EnableComplementaryColor { + fgColor = complementaryColors[color] + } + buffer.WriteString(fgColor.Sprint(color.Sprintf(ct))) + } + if j < xAmount { + if !p.Boxed && p.HasHeader && j == xAmount-1 { + continue + } + if p.Grid { + buffer.WriteString(p.SeparatorStyle.Sprint(p.VerticalSeparator)) + } + } + if p.Boxed && !p.HasHeader && j == xAmount { + buffer.WriteString(p.SeparatorStyle.Sprint(p.VerticalSeparator)) + } + } + + if i < yAmount { + if p.HasHeader && i == yAmount-1 { + continue + } + buffer.WriteString("\n") + if p.Boxed { + buffer.WriteString(p.SeparatorStyle.Sprint(p.LSeparator)) + } + if p.Grid { + for i := 0; i < xAmount+1; i++ { + buffer.WriteString(strings.Repeat(p.SeparatorStyle.Sprint(p.HorizontalSeparator), colWidth)) + if i < xAmount { + buffer.WriteString(p.SeparatorStyle.Sprint(p.TCrossSeparator)) + } + } + } + if p.Boxed { + buffer.WriteString(p.SeparatorStyle.Sprint(p.LReverseSeparator)) + } + if p.Grid { + buffer.WriteString("\n") + } + } + } +} + +func (p HeatmapPrinter) generateLegend(buffer *bytes.Buffer, legend string, legendColWidth int) { + buffer.WriteString(p.AxisStyle.Sprint(legend)) + if p.Grid { + buffer.WriteString(p.SeparatorStyle.Sprintf("%s", p.VerticalSeparator)) + } else { + buffer.WriteString(" ") + } + if p.EnableRGB { + p.generateRGBLegend(buffer, legendColWidth) + } else { + p.generateColorLegend(buffer, legendColWidth) + } +} + +func (p HeatmapPrinter) generateColorLegend(buffer *bytes.Buffer, legendColWidth int) { + for i, color := range p.Colors { + // the first color is the min value and the last color is the max value + var f float32 + if i == 0 { + f = p.minValue + } else if i == len(p.Colors)-1 { + f = p.maxValue + } else { + f = p.minValue + (p.maxValue-p.minValue)*float32(i)/float32(len(p.Colors)-1) + } + fgColor := p.TextColor + if p.EnableComplementaryColor { + fgColor = complementaryColors[color] + } + buffer.WriteString(fgColor.Sprint(color.Sprint(centerAndShorten(f, legendColWidth, p.LegendOnlyColoredCells)))) + if p.Grid && i < len(p.Colors)-1 && !p.LegendOnlyColoredCells { + buffer.WriteString(p.SeparatorStyle.Sprintf("%s", p.VerticalSeparator)) + } + } +} + +func (p HeatmapPrinter) generateRGBLegend(buffer *bytes.Buffer, legendColWidth int) { + p.rgbLegendValue = 10 + steps := len(p.RGBRange) + if steps < p.rgbLegendValue { + steps = p.rgbLegendValue + } + if p.LegendOnlyColoredCells { + steps *= 3 + } + for i := 0; i < steps; i++ { + // the first color is the min value and the last color is the max value + var f float32 + if i == 0 { + f = p.minValue + } else if i == steps-1 { + f = p.maxValue + } else { + f = p.minValue + (p.maxValue-p.minValue)*float32(i)/float32(steps-1) + } + rgb := p.RGBRange[0].Fade(p.minValue, p.maxValue, f, p.RGBRange[1:]...) + rgbStyle := NewRGBStyle(p.TextRGB, rgb) + if p.EnableComplementaryColor { + complimentary := NewRGB(internal.Complementary(rgb.R, rgb.G, rgb.B)) + rgbStyle = NewRGBStyle(complimentary, rgb) + } + if p.LegendOnlyColoredCells { + buffer.WriteString(rgbStyle.Sprint(centerAndShorten(f, 1, p.LegendOnlyColoredCells))) + } else { + buffer.WriteString(rgbStyle.Sprint(centerAndShorten(f, legendColWidth, p.LegendOnlyColoredCells))) + } + if p.Grid && i < steps-1 && !p.LegendOnlyColoredCells { + buffer.WriteString(p.SeparatorStyle.Sprintf("%s", p.VerticalSeparator)) + } + } +} + +func (p HeatmapPrinter) boxLegend(buffer *bytes.Buffer, legend string, legendColWidth int) { + buffer.WriteString(p.SeparatorStyle.Sprint(p.BottomRightCornerSeparator)) + + p.generateSeparatorRow(buffer, legend, legendColWidth, true) + + buffer.WriteString(p.SeparatorStyle.Sprint(p.BottomLeftCornerSeparator)) + buffer.WriteString("\n") + buffer.WriteString(p.SeparatorStyle.Sprintf("%s", p.VerticalSeparator)) + + p.generateLegend(buffer, legend, legendColWidth) + + buffer.WriteString(p.SeparatorStyle.Sprintf("%s", p.VerticalSeparator)) + buffer.WriteString("\n") + + buffer.WriteString(p.SeparatorStyle.Sprint(p.TopRightCornerSeparator)) + + p.generateSeparatorRow(buffer, legend, legendColWidth, false) + + buffer.WriteString(p.SeparatorStyle.Sprint(p.TopLeftCornerSeparator)) +} + +func (p HeatmapPrinter) generateSeparatorRow(buffer *bytes.Buffer, legend string, legendColWidth int, top bool) { + p.rgbLegendValue = 10 + steps := len(p.RGBRange) + if steps < p.rgbLegendValue { + steps = p.rgbLegendValue + } + if p.LegendOnlyColoredCells { + steps *= 3 + } + + var xValue int + if p.EnableRGB { + xValue = len(p.RGBRange) + if xValue < p.rgbLegendValue { + xValue = p.rgbLegendValue + } + } else { + xValue = len(p.Colors) + } + + for i := 0; i < xValue+1; i++ { + if i == 0 { + firstLength := len(legend) + buffer.WriteString(strings.Repeat(p.SeparatorStyle.Sprint(p.HorizontalSeparator), firstLength)) + } else { + if p.LegendOnlyColoredCells { + if p.EnableRGB { + buffer.WriteString(strings.Repeat(p.SeparatorStyle.Sprint(p.HorizontalSeparator), steps/(xValue))) + } else { + buffer.WriteString(strings.Repeat(p.SeparatorStyle.Sprint(p.HorizontalSeparator), legendColWidth)) + } + } else { + buffer.WriteString(strings.Repeat(p.SeparatorStyle.Sprint(p.HorizontalSeparator), legendColWidth)) + } + } + if i < xValue && !p.LegendOnlyColoredCells || i == 0 { + if top { + buffer.WriteString(p.SeparatorStyle.Sprint(p.TSeparator)) + } else { + buffer.WriteString(p.SeparatorStyle.Sprint(p.TReverseSeparator)) + } + } + } +} + +func centerAndShorten(f float32, lineLength int, onlyColor bool) string { + value := "" + if !onlyColor { + value = Sprintf("%.2v", f) + } + if len(value) > lineLength { + value = value[:lineLength] + if strings.HasSuffix(value, ".") { + value = Sprintf("%.1v", f) + lineLength = len(value) + } + } + ct := internal.CenterText(value, lineLength) + if len(ct) < lineLength { + if len(Sprintf("%v", f)) == 1 { + ct += strings.Repeat(" ", lineLength-len(ct)) + } else { + ct = strings.Repeat(" ", lineLength-len(ct)) + ct + } + } + + return ct +} + +func getColor(min float32, max float32, current float32, colors ...Color) Color { + // split the range into equal parts + // and assign a color to each part + // the last color is assigned to the max value + // and the first color to the min value + // the rest of the colors are assigned to the + // middle values + step := (max - min) / float32(len(colors)) + for i := range colors { + if current >= min+float32(i)*step && current < min+float32(i+1)*step { + return colors[i] + } + } + return colors[len(colors)-1] +} + +// Render prints the HeatmapPrinter to the terminal. +func (p HeatmapPrinter) Render() error { + s, err := p.Srender() + if err != nil { + return err + } + Fprintln(p.Writer, s) + + return nil +} + +func (p HeatmapPrinter) errCheck() error { + if p.HasHeader { + if p.Axis.XAxis == nil { + return errors.New("x axis is nil") + } + if p.Axis.YAxis == nil { + return errors.New("y axis is nil") + } + + if len(p.Axis.XAxis) == 0 { + return errors.New("x axis is empty") + } + if len(p.Axis.YAxis) == 0 { + return errors.New("y axis is empty") + } + + for i := 1; i < len(p.Data); i++ { + if len(p.Data[i]) != len(p.Axis.XAxis) { + return errors.New("x axis length does not match data") + } + } + if len(p.Axis.YAxis) != len(p.Data) { + return errors.New("y axis length does not match data") + } + } + + if p.Data == nil { + return errors.New("data is nil") + } + + if len(p.Data) == 0 { + return errors.New("data is empty") + } + + // check if p.Data[n] has the same length + for i := 1; i < len(p.Data); i++ { + if len(p.Data[i]) != len(p.Data[0]) { + return errors.New("data is not rectangular") + } + } + + return nil +} + +// return min and max value of a slice +func minMaxFloat32(s [][]float32) (float32, float32) { + var min, max float32 + min = math.MaxFloat32 + max = -math.MaxFloat32 + + for _, r := range s { + for _, c := range r { + if c < min { + min = c + } + if c > max { + max = c + } + } + } + return min, max +} diff --git a/vendor/github.com/pterm/pterm/interactive_confirm_printer.go b/vendor/github.com/pterm/pterm/interactive_confirm_printer.go index 6760ce69..a94cc5dc 100644 --- a/vendor/github.com/pterm/pterm/interactive_confirm_printer.go +++ b/vendor/github.com/pterm/pterm/interactive_confirm_printer.go @@ -7,35 +7,37 @@ import ( "atomicgo.dev/cursor" "atomicgo.dev/keyboard" "atomicgo.dev/keyboard/keys" + "github.com/pterm/pterm/internal" ) -var ( - // DefaultInteractiveConfirm is the default InteractiveConfirm printer. - // Pressing "y" will return true, "n" will return false. - // Pressing enter without typing "y" or "n" will return the configured default value (by default set to "no"). - DefaultInteractiveConfirm = InteractiveConfirmPrinter{ - DefaultValue: false, - DefaultText: "Please confirm", - TextStyle: &ThemeDefault.PrimaryStyle, - ConfirmText: "Yes", - ConfirmStyle: &ThemeDefault.SuccessMessageStyle, - RejectText: "No", - RejectStyle: &ThemeDefault.ErrorMessageStyle, - SuffixStyle: &ThemeDefault.SecondaryStyle, - } -) +// DefaultInteractiveConfirm is the default InteractiveConfirm printer. +// Pressing "y" will return true, "n" will return false. +// Pressing enter without typing "y" or "n" will return the configured default value (by default set to "no"). +var DefaultInteractiveConfirm = InteractiveConfirmPrinter{ + DefaultValue: false, + DefaultText: "Please confirm", + TextStyle: &ThemeDefault.PrimaryStyle, + ConfirmText: "Yes", + ConfirmStyle: &ThemeDefault.SuccessMessageStyle, + RejectText: "No", + RejectStyle: &ThemeDefault.ErrorMessageStyle, + SuffixStyle: &ThemeDefault.SecondaryStyle, + Delimiter: ": ", +} // InteractiveConfirmPrinter is a printer for interactive confirm prompts. type InteractiveConfirmPrinter struct { - DefaultValue bool - DefaultText string - TextStyle *Style - ConfirmText string - ConfirmStyle *Style - RejectText string - RejectStyle *Style - SuffixStyle *Style + DefaultValue bool + DefaultText string + Delimiter string + TextStyle *Style + ConfirmText string + ConfirmStyle *Style + RejectText string + RejectStyle *Style + SuffixStyle *Style + OnInterruptFunc func() } // WithDefaultText sets the default text. @@ -86,6 +88,18 @@ func (p InteractiveConfirmPrinter) WithSuffixStyle(style *Style) *InteractiveCon return &p } +// OnInterrupt sets the function to execute on exit of the input reader +func (p InteractiveConfirmPrinter) WithOnInterruptFunc(exitFunc func()) *InteractiveConfirmPrinter { + p.OnInterruptFunc = exitFunc + return &p +} + +// WithDelimiter sets the delimiter between the message and the input. +func (p InteractiveConfirmPrinter) WithDelimiter(delimiter string) *InteractiveConfirmPrinter { + p.Delimiter = delimiter + return &p +} + // Show shows the confirm prompt. // // Example: @@ -95,7 +109,7 @@ func (p InteractiveConfirmPrinter) WithSuffixStyle(style *Style) *InteractiveCon func (p InteractiveConfirmPrinter) Show(text ...string) (bool, error) { // should be the first defer statement to make sure it is executed last // and all the needed cleanup can be done before - cancel, exit := internal.NewCancelationSignal() + cancel, exit := internal.NewCancelationSignal(p.OnInterruptFunc) defer exit() var result bool @@ -104,7 +118,7 @@ func (p InteractiveConfirmPrinter) Show(text ...string) (bool, error) { text = []string{p.DefaultText} } - p.TextStyle.Print(text[0] + " " + p.getSuffix() + ": ") + p.TextStyle.Print(text[0] + " " + p.getSuffix() + p.Delimiter) y, n := p.getShortHandles() var interrupted bool diff --git a/vendor/github.com/pterm/pterm/interactive_continue_printer.go b/vendor/github.com/pterm/pterm/interactive_continue_printer.go index d0f91f13..4049cde9 100644 --- a/vendor/github.com/pterm/pterm/interactive_continue_printer.go +++ b/vendor/github.com/pterm/pterm/interactive_continue_printer.go @@ -2,7 +2,6 @@ package pterm import ( "fmt" - "os" "strings" "atomicgo.dev/cursor" @@ -14,24 +13,24 @@ import ( "github.com/pterm/pterm/internal" ) -var ( - // DefaultInteractiveContinue is the default InteractiveContinue printer. - // Pressing "y" will return yes, "n" will return no, "a" returns all and "s" returns stop. - // Pressing enter without typing any letter will return the configured default value (by default set to "yes", the fisrt option). - DefaultInteractiveContinue = InteractiveContinuePrinter{ - DefaultValueIndex: 0, - DefaultText: "Do you want to continue", - TextStyle: &ThemeDefault.PrimaryStyle, - Options: []string{"yes", "no", "all", "cancel"}, - OptionsStyle: &ThemeDefault.SuccessMessageStyle, - SuffixStyle: &ThemeDefault.SecondaryStyle, - } -) +// DefaultInteractiveContinue is the default InteractiveContinue printer. +// Pressing "y" will return yes, "n" will return no, "a" returns all and "s" returns stop. +// Pressing enter without typing any letter will return the configured default value (by default set to "yes", the fisrt option). +var DefaultInteractiveContinue = InteractiveContinuePrinter{ + DefaultValueIndex: 0, + DefaultText: "Do you want to continue", + TextStyle: &ThemeDefault.PrimaryStyle, + Options: []string{"yes", "no", "all", "cancel"}, + OptionsStyle: &ThemeDefault.SuccessMessageStyle, + SuffixStyle: &ThemeDefault.SecondaryStyle, + Delimiter: ": ", +} // InteractiveContinuePrinter is a printer for interactive continue prompts. type InteractiveContinuePrinter struct { DefaultValueIndex int DefaultText string + Delimiter string TextStyle *Style Options []string OptionsStyle *Style @@ -108,6 +107,12 @@ func (p InteractiveContinuePrinter) WithSuffixStyle(style *Style) *InteractiveCo return &p } +// WithDelimiter sets the delimiter between the message and the input. +func (p InteractiveContinuePrinter) WithDelimiter(delimiter string) *InteractiveContinuePrinter { + p.Delimiter = delimiter + return &p +} + // Show shows the continue prompt. // // Example: @@ -121,7 +126,7 @@ func (p InteractiveContinuePrinter) Show(text ...string) (string, error) { text = []string{p.DefaultText} } - p.TextStyle.Print(text[0] + " " + p.getSuffix() + ": ") + p.TextStyle.Print(text[0] + " " + p.getSuffix() + p.Delimiter) err := keyboard.Listen(func(keyInfo keys.Key) (stop bool, err error) { if err != nil { @@ -149,7 +154,7 @@ func (p InteractiveContinuePrinter) Show(text ...string) (string, error) { result = p.Options[p.DefaultValueIndex] return true, nil case keys.CtrlC: - os.Exit(1) + internal.Exit(1) return true, nil } return false, nil diff --git a/vendor/github.com/pterm/pterm/interactive_multiselect_printer.go b/vendor/github.com/pterm/pterm/interactive_multiselect_printer.go index c80f9355..9dce03fb 100644 --- a/vendor/github.com/pterm/pterm/interactive_multiselect_printer.go +++ b/vendor/github.com/pterm/pterm/interactive_multiselect_printer.go @@ -32,16 +32,17 @@ var ( // InteractiveMultiselectPrinter is a printer for interactive multiselect menus. type InteractiveMultiselectPrinter struct { - DefaultText string - TextStyle *Style - Options []string - OptionStyle *Style - DefaultOptions []string - MaxHeight int - Selector string - SelectorStyle *Style - Filter bool - Checkmark *Checkmark + DefaultText string + TextStyle *Style + Options []string + OptionStyle *Style + DefaultOptions []string + MaxHeight int + Selector string + SelectorStyle *Style + Filter bool + Checkmark *Checkmark + OnInterruptFunc func() selectedOption int selectedOptions []int @@ -52,7 +53,10 @@ type InteractiveMultiselectPrinter struct { displayedOptionsStart int displayedOptionsEnd int - KeySelect keys.KeyCode + // KeySelect is the select key. It cannot be keys.Space when Filter is enabled. + KeySelect keys.KeyCode + + // KeyConfirm is the confirm key. It cannot be keys.Space when Filter is enabled. KeyConfirm keys.KeyCode } @@ -81,18 +85,20 @@ func (p InteractiveMultiselectPrinter) WithMaxHeight(maxHeight int) *Interactive } // WithFilter sets the Filter option -func (p InteractiveMultiselectPrinter) WithFilter(filter bool) *InteractiveMultiselectPrinter { - p.Filter = filter +func (p InteractiveMultiselectPrinter) WithFilter(b ...bool) *InteractiveMultiselectPrinter { + p.Filter = internal.WithBoolean(b) return &p } // WithKeySelect sets the confirm key +// It cannot be keys.Space when Filter is enabled. func (p InteractiveMultiselectPrinter) WithKeySelect(keySelect keys.KeyCode) *InteractiveMultiselectPrinter { p.KeySelect = keySelect return &p } // WithKeyConfirm sets the confirm key +// It cannot be keys.Space when Filter is enabled. func (p InteractiveMultiselectPrinter) WithKeyConfirm(keyConfirm keys.KeyCode) *InteractiveMultiselectPrinter { p.KeyConfirm = keyConfirm return &p @@ -104,11 +110,17 @@ func (p InteractiveMultiselectPrinter) WithCheckmark(checkmark *Checkmark) *Inte return &p } +// OnInterrupt sets the function to execute on exit of the input reader +func (p InteractiveMultiselectPrinter) WithOnInterruptFunc(exitFunc func()) *InteractiveMultiselectPrinter { + p.OnInterruptFunc = exitFunc + return &p +} + // Show shows the interactive multiselect menu and returns the selected entry. func (p *InteractiveMultiselectPrinter) Show(text ...string) ([]string, error) { // should be the first defer statement to make sure it is executed last // and all the needed cleanup can be done before - cancel, exit := internal.NewCancelationSignal() + cancel, exit := internal.NewCancelationSignal(p.OnInterruptFunc) defer exit() if len(text) == 0 || Sprint(text[0]) == "" { @@ -194,7 +206,7 @@ func (p *InteractiveMultiselectPrinter) Show(text ...string) ([]string, error) { } case keys.Backspace: // Remove last character from fuzzy search string - if len(p.fuzzySearchString) > 0 { + if p.fuzzySearchString != "" { // Handle UTF-8 characters p.fuzzySearchString = string([]rune(p.fuzzySearchString)[:len([]rune(p.fuzzySearchString))-1]) } @@ -228,7 +240,7 @@ func (p *InteractiveMultiselectPrinter) Show(text ...string) ([]string, error) { p.selectedOptions = append(p.selectedOptions, i) } area.Update(p.renderSelectMenu()) - case keys.Up: + case keys.Up, keys.CtrlP: if len(p.fuzzySearchMatches) == 0 { return false, nil } @@ -251,7 +263,7 @@ func (p *InteractiveMultiselectPrinter) Show(text ...string) ([]string, error) { } area.Update(p.renderSelectMenu()) - case keys.Down: + case keys.Down, keys.CtrlN: if len(p.fuzzySearchMatches) == 0 { return false, nil } diff --git a/vendor/github.com/pterm/pterm/interactive_select_printer.go b/vendor/github.com/pterm/pterm/interactive_select_printer.go index 0af1a0d6..d62f5dad 100644 --- a/vendor/github.com/pterm/pterm/interactive_select_printer.go +++ b/vendor/github.com/pterm/pterm/interactive_select_printer.go @@ -23,19 +23,22 @@ var ( MaxHeight: 5, Selector: ">", SelectorStyle: &ThemeDefault.SecondaryStyle, + Filter: true, } ) // InteractiveSelectPrinter is a printer for interactive select menus. type InteractiveSelectPrinter struct { - TextStyle *Style - DefaultText string - Options []string - OptionStyle *Style - DefaultOption string - MaxHeight int - Selector string - SelectorStyle *Style + TextStyle *Style + DefaultText string + Options []string + OptionStyle *Style + DefaultOption string + MaxHeight int + Selector string + SelectorStyle *Style + OnInterruptFunc func() + Filter bool selectedOption int result string @@ -71,11 +74,23 @@ func (p InteractiveSelectPrinter) WithMaxHeight(maxHeight int) *InteractiveSelec return &p } +// OnInterrupt sets the function to execute on exit of the input reader +func (p InteractiveSelectPrinter) WithOnInterruptFunc(exitFunc func()) *InteractiveSelectPrinter { + p.OnInterruptFunc = exitFunc + return &p +} + +// WithFilter sets the Filter option +func (p InteractiveSelectPrinter) WithFilter(b ...bool) *InteractiveSelectPrinter { + p.Filter = internal.WithBoolean(b) + return &p +} + // Show shows the interactive select menu and returns the selected entry. func (p *InteractiveSelectPrinter) Show(text ...string) (string, error) { // should be the first defer statement to make sure it is executed last // and all the needed cleanup can be done before - cancel, exit := internal.NewCancelationSignal() + cancel, exit := internal.NewCancelationSignal(p.OnInterruptFunc) defer exit() if len(text) == 0 || Sprint(text[0]) == "" { @@ -142,21 +157,23 @@ func (p *InteractiveSelectPrinter) Show(text ...string) (string, error) { switch key { case keys.RuneKey: - // Fuzzy search for options - // append to fuzzy search string - p.fuzzySearchString += keyInfo.String() - p.selectedOption = 0 - p.displayedOptionsStart = 0 - p.displayedOptionsEnd = maxHeight - p.displayedOptions = append([]string{}, p.fuzzySearchMatches[:maxHeight]...) - area.Update(p.renderSelectMenu()) + if p.Filter { + // Fuzzy search for options + // append to fuzzy search string + p.fuzzySearchString += keyInfo.String() + p.selectedOption = 0 + p.displayedOptionsStart = 0 + p.displayedOptionsEnd = maxHeight + p.displayedOptions = append([]string{}, p.fuzzySearchMatches[:maxHeight]...) + area.Update(p.renderSelectMenu()) + } case keys.Space: p.fuzzySearchString += " " p.selectedOption = 0 area.Update(p.renderSelectMenu()) case keys.Backspace: // Remove last character from fuzzy search string - if len(p.fuzzySearchString) > 0 { + if p.fuzzySearchString != "" { // Handle UTF-8 characters p.fuzzySearchString = string([]rune(p.fuzzySearchString)[:len([]rune(p.fuzzySearchString))-1]) } @@ -179,7 +196,7 @@ func (p *InteractiveSelectPrinter) Show(text ...string) (string, error) { p.displayedOptions = append([]string{}, p.fuzzySearchMatches[p.displayedOptionsStart:p.displayedOptionsEnd]...) area.Update(p.renderSelectMenu()) - case keys.Up: + case keys.Up, keys.CtrlP: if len(p.fuzzySearchMatches) == 0 { return false, nil } @@ -202,7 +219,7 @@ func (p *InteractiveSelectPrinter) Show(text ...string) (string, error) { } area.Update(p.renderSelectMenu()) - case keys.Down: + case keys.Down, keys.CtrlN: if len(p.fuzzySearchMatches) == 0 { return false, nil } @@ -245,7 +262,11 @@ func (p *InteractiveSelectPrinter) Show(text ...string) (string, error) { func (p *InteractiveSelectPrinter) renderSelectMenu() string { var content string - content += Sprintf("%s %s: %s\n", p.text, p.SelectorStyle.Sprint("[type to search]"), p.fuzzySearchString) + if p.Filter { + content += Sprintf("%s %s: %s\n", p.text, p.SelectorStyle.Sprint("[type to search]"), p.fuzzySearchString) + } else { + content += Sprintf("%s:\n", p.text) + } // find options that match fuzzy search string rankedResults := fuzzy.RankFindFold(p.fuzzySearchString, p.Options) diff --git a/vendor/github.com/pterm/pterm/interactive_textinput_printer.go b/vendor/github.com/pterm/pterm/interactive_textinput_printer.go index 512e24f9..6926a4be 100644 --- a/vendor/github.com/pterm/pterm/interactive_textinput_printer.go +++ b/vendor/github.com/pterm/pterm/interactive_textinput_printer.go @@ -6,30 +6,35 @@ import ( "atomicgo.dev/cursor" "atomicgo.dev/keyboard" "atomicgo.dev/keyboard/keys" + "github.com/mattn/go-runewidth" "github.com/pterm/pterm/internal" ) -var ( - // DefaultInteractiveTextInput is the default InteractiveTextInput printer. - DefaultInteractiveTextInput = InteractiveTextInputPrinter{ - DefaultText: "Input text", - TextStyle: &ThemeDefault.PrimaryStyle, - Mask: "", - } -) +// DefaultInteractiveTextInput is the default InteractiveTextInput printer. +var DefaultInteractiveTextInput = InteractiveTextInputPrinter{ + DefaultText: "Input text", + Delimiter: ": ", + TextStyle: &ThemeDefault.PrimaryStyle, + Mask: "", +} // InteractiveTextInputPrinter is a printer for interactive select menus. type InteractiveTextInputPrinter struct { - TextStyle *Style - DefaultText string - MultiLine bool - Mask string - - input []string - cursorXPos int - cursorYPos int - text string + TextStyle *Style + DefaultText string + DefaultValue string + Delimiter string + MultiLine bool + Mask string + OnInterruptFunc func() + + input []string + cursorXPos int + cursorYPos int + text string + startedTyping bool + valueStyle *Style } // WithDefaultText sets the default text. @@ -38,6 +43,12 @@ func (p InteractiveTextInputPrinter) WithDefaultText(text string) *InteractiveTe return &p } +// WithDefaultValue sets the default value. +func (p InteractiveTextInputPrinter) WithDefaultValue(value string) *InteractiveTextInputPrinter { + p.DefaultValue = value + return &p +} + // WithTextStyle sets the text style. func (p InteractiveTextInputPrinter) WithTextStyle(style *Style) *InteractiveTextInputPrinter { p.TextStyle = style @@ -56,38 +67,52 @@ func (p InteractiveTextInputPrinter) WithMask(mask string) *InteractiveTextInput return &p } +// WithOnInterruptFunc sets the function to execute on exit of the input reader +func (p InteractiveTextInputPrinter) WithOnInterruptFunc(exitFunc func()) *InteractiveTextInputPrinter { + p.OnInterruptFunc = exitFunc + return &p +} + +// WithDelimiter sets the delimiter between the message and the input. +func (p InteractiveTextInputPrinter) WithDelimiter(delimiter string) *InteractiveTextInputPrinter { + p.Delimiter = delimiter + return &p +} + // Show shows the interactive select menu and returns the selected entry. func (p InteractiveTextInputPrinter) Show(text ...string) (string, error) { // should be the first defer statement to make sure it is executed last // and all the needed cleanup can be done before - cancel, exit := internal.NewCancelationSignal() + cancel, exit := internal.NewCancelationSignal(p.OnInterruptFunc) defer exit() var areaText string - if len(text) == 0 || Sprint(text[0]) == "" { + if len(text) == 0 || text[0] == "" { text = []string{p.DefaultText} } if p.MultiLine { - areaText = p.TextStyle.Sprintfln("%s %s :", text[0], ThemeDefault.SecondaryStyle.Sprint("[Press tab to submit]")) + areaText = p.TextStyle.Sprintfln("%s %s %s", text[0], ThemeDefault.SecondaryStyle.Sprint("[Press tab to submit]"), p.Delimiter) } else { - areaText = p.TextStyle.Sprintf("%s: ", text[0]) + areaText = p.TextStyle.Sprintf("%s%s", text[0], p.Delimiter) } + p.text = areaText - area, err := DefaultArea.Start(areaText) - defer area.Stop() - if err != nil { - return "", err - } + area := cursor.NewArea() + area.Update(areaText) + area.StartOfLine() - cursor.Up(1) - cursor.StartOfLine() if !p.MultiLine { - cursor.Right(len(RemoveColorFromString(areaText))) + cursor.Right(runewidth.StringWidth(RemoveColorFromString(areaText))) + } + + if p.DefaultValue != "" { + p.input = append(p.input, Gray(p.DefaultValue)) + p.updateArea(&area) } - err = keyboard.Listen(func(key keys.Key) (stop bool, err error) { + err := keyboard.Listen(func(key keys.Key) (stop bool, err error) { if !p.MultiLine { p.cursorYPos = 0 } @@ -98,9 +123,21 @@ func (p InteractiveTextInputPrinter) Show(text ...string) (string, error) { switch key.Code { case keys.Tab: if p.MultiLine { + area.Bottom() return true, nil } case keys.Enter: + if p.DefaultValue != "" && !p.startedTyping { + for i := range p.input { + p.input[i] = RemoveColorFromString(p.input[i]) + } + + if p.MultiLine { + area.Bottom() + } + return true, nil + } + if p.MultiLine { if key.AltPressed { p.cursorXPos = 0 @@ -112,16 +149,27 @@ func (p InteractiveTextInputPrinter) Show(text ...string) (string, error) { p.input = append(p.input, appendAfterY...) p.cursorYPos++ p.cursorXPos = -internal.GetStringMaxWidth(p.input[p.cursorYPos]) - cursor.Down(1) cursor.StartOfLine() } else { return true, nil } case keys.RuneKey: + if !p.startedTyping { + p.input = []string{""} + p.startedTyping = true + } p.input[p.cursorYPos] = string(append([]rune(p.input[p.cursorYPos])[:len([]rune(p.input[p.cursorYPos]))+p.cursorXPos], append([]rune(key.String()), []rune(p.input[p.cursorYPos])[len([]rune(p.input[p.cursorYPos]))+p.cursorXPos:]...)...)) case keys.Space: + if !p.startedTyping { + p.input = []string{" "} + p.startedTyping = true + } p.input[p.cursorYPos] = string(append([]rune(p.input[p.cursorYPos])[:len([]rune(p.input[p.cursorYPos]))+p.cursorXPos], append([]rune(" "), []rune(p.input[p.cursorYPos])[len([]rune(p.input[p.cursorYPos]))+p.cursorXPos:]...)...)) case keys.Backspace: + if !p.startedTyping { + p.input = []string{""} + p.startedTyping = true + } if len([]rune(p.input[p.cursorYPos]))+p.cursorXPos > 0 { p.input[p.cursorYPos] = string(append([]rune(p.input[p.cursorYPos])[:len([]rune(p.input[p.cursorYPos]))-1+p.cursorXPos], []rune(p.input[p.cursorYPos])[len([]rune(p.input[p.cursorYPos]))+p.cursorXPos:]...)) } else if p.cursorYPos > 0 { @@ -132,6 +180,11 @@ func (p InteractiveTextInputPrinter) Show(text ...string) (string, error) { p.cursorYPos-- } case keys.Delete: + if !p.startedTyping { + p.input = []string{""} + p.startedTyping = true + return false, nil + } if len([]rune(p.input[p.cursorYPos]))+p.cursorXPos < len([]rune(p.input[p.cursorYPos])) { p.input[p.cursorYPos] = string(append([]rune(p.input[p.cursorYPos])[:len([]rune(p.input[p.cursorYPos]))+p.cursorXPos], []rune(p.input[p.cursorYPos])[len([]rune(p.input[p.cursorYPos]))+p.cursorXPos+1:]...)) p.cursorXPos++ @@ -145,6 +198,10 @@ func (p InteractiveTextInputPrinter) Show(text ...string) (string, error) { cancel() return true, nil case keys.Down: + if !p.startedTyping { + p.input = []string{""} + p.startedTyping = true + } if p.cursorYPos+1 < len(p.input) { p.cursorXPos = (internal.GetStringMaxWidth(p.input[p.cursorYPos]) + p.cursorXPos) - internal.GetStringMaxWidth(p.input[p.cursorYPos+1]) if p.cursorXPos > 0 { @@ -153,6 +210,10 @@ func (p InteractiveTextInputPrinter) Show(text ...string) (string, error) { p.cursorYPos++ } case keys.Up: + if !p.startedTyping { + p.input = []string{""} + p.startedTyping = true + } if p.cursorYPos > 0 { p.cursorXPos = (internal.GetStringMaxWidth(p.input[p.cursorYPos]) + p.cursorXPos) - internal.GetStringMaxWidth(p.input[p.cursorYPos-1]) if p.cursorXPos > 0 { @@ -181,7 +242,7 @@ func (p InteractiveTextInputPrinter) Show(text ...string) (string, error) { } } - p.updateArea(area) + p.updateArea(&area) return false, nil }) @@ -200,10 +261,14 @@ func (p InteractiveTextInputPrinter) Show(text ...string) (string, error) { } } + if !p.startedTyping { + return p.DefaultValue, nil + } + return strings.ReplaceAll(areaText, p.text, ""), nil } -func (p InteractiveTextInputPrinter) updateArea(area *AreaPrinter) string { +func (p InteractiveTextInputPrinter) updateArea(area *cursor.Area) string { if !p.MultiLine { p.cursorYPos = 0 } @@ -225,10 +290,10 @@ func (p InteractiveTextInputPrinter) updateArea(area *AreaPrinter) string { p.cursorXPos = -internal.GetStringMaxWidth(p.input[p.cursorYPos]) } - cursor.StartOfLine() area.Update(areaText) - cursor.Up(len(p.input) - p.cursorYPos) - cursor.StartOfLine() + area.Top() + area.Down(p.cursorYPos + 1) + area.StartOfLine() if p.MultiLine { cursor.Right(internal.GetStringMaxWidth(p.input[p.cursorYPos]) + p.cursorXPos) } else { diff --git a/vendor/github.com/pterm/pterm/interface_live_printer.go b/vendor/github.com/pterm/pterm/interface_live_printer.go index b8d3dbe3..69dce345 100644 --- a/vendor/github.com/pterm/pterm/interface_live_printer.go +++ b/vendor/github.com/pterm/pterm/interface_live_printer.go @@ -1,5 +1,7 @@ package pterm +import "io" + // LivePrinter is a printer which can update it's output live. type LivePrinter interface { // GenericStart runs Start, but returns a LivePrinter. @@ -11,4 +13,6 @@ type LivePrinter interface { // This is used for the interface LivePrinter. // You most likely want to use Stop instead of this in your program. GenericStop() (*LivePrinter, error) + + SetWriter(writer io.Writer) } diff --git a/vendor/github.com/pterm/pterm/internal/cancelation_signal.go b/vendor/github.com/pterm/pterm/internal/cancelation_signal.go index d6f79b0a..33f17cc1 100644 --- a/vendor/github.com/pterm/pterm/internal/cancelation_signal.go +++ b/vendor/github.com/pterm/pterm/internal/cancelation_signal.go @@ -1,19 +1,20 @@ package internal -import ( - "os" -) - // NewCancelationSignal for keeping track of a cancelation -func NewCancelationSignal() (func(), func()) { +func NewCancelationSignal(interruptFunc func()) (func(), func()) { canceled := false cancel := func() { canceled = true } + exit := func() { if canceled { - os.Exit(1) + if interruptFunc != nil { + interruptFunc() + } else { + Exit(1) + } } } diff --git a/vendor/github.com/pterm/pterm/internal/exit.go b/vendor/github.com/pterm/pterm/internal/exit.go new file mode 100644 index 00000000..f07a0045 --- /dev/null +++ b/vendor/github.com/pterm/pterm/internal/exit.go @@ -0,0 +1,14 @@ +package internal + +import "os" + +// ExitFuncType is the type of function used to exit the program. +type ExitFuncType func(int) + +// DefaultExitFunc is the default function used to exit the program. +var DefaultExitFunc ExitFuncType = os.Exit + +// Exit calls the current exit function. +func Exit(code int) { + DefaultExitFunc(code) +} diff --git a/vendor/github.com/pterm/pterm/internal/rgb_complementary.go b/vendor/github.com/pterm/pterm/internal/rgb_complementary.go new file mode 100644 index 00000000..71520b33 --- /dev/null +++ b/vendor/github.com/pterm/pterm/internal/rgb_complementary.go @@ -0,0 +1,5 @@ +package internal + +func Complementary(r, g, b uint8) (uint8, uint8, uint8) { + return 255 - r, 255 - g, 255 - b +} diff --git a/vendor/github.com/pterm/pterm/internal/title_in_line.go b/vendor/github.com/pterm/pterm/internal/title_in_line.go index 3aae546b..68e28ec6 100644 --- a/vendor/github.com/pterm/pterm/internal/title_in_line.go +++ b/vendor/github.com/pterm/pterm/internal/title_in_line.go @@ -2,17 +2,15 @@ package internal import ( "strings" - - "github.com/gookit/color" ) // AddTitleToLine adds a title to a site of a line ex: "─ This is the title ──────" func AddTitleToLine(title, line string, length int, left bool) string { var ret string if left { - ret += line + " " + title + " " + line + strings.Repeat(line, length-(4+len(color.ClearCode(title)))) + ret += line + " " + title + " " + line + strings.Repeat(line, length-(4+GetStringMaxWidth(title))) } else { - ret += strings.Repeat(line, length-(4+len(color.ClearCode(title)))) + line + " " + title + " " + line + ret += strings.Repeat(line, length-(4+GetStringMaxWidth(title))) + line + " " + title + " " + line } return ret @@ -21,7 +19,7 @@ func AddTitleToLine(title, line string, length int, left bool) string { // AddTitleToLineCenter adds a title to the center of a line ex: "─ This is the title ──────" func AddTitleToLineCenter(title, line string, length int) string { var ret string - repeatString := length - (4 + len(color.ClearCode(title))) + repeatString := length - (4 + GetStringMaxWidth(title)) unevenRepeatString := repeatString % 2 ret += strings.Repeat(line, repeatString/2) + line + " " + title + " " + line + strings.Repeat(line, repeatString/2+unevenRepeatString) diff --git a/vendor/github.com/pterm/pterm/logger.go b/vendor/github.com/pterm/pterm/logger.go index 4fed9283..407f4d50 100644 --- a/vendor/github.com/pterm/pterm/logger.go +++ b/vendor/github.com/pterm/pterm/logger.go @@ -200,6 +200,9 @@ func (l Logger) AppendKeyStyle(key string, style Style) *Logger { // CanPrint checks if the logger can print a specific log level. func (l Logger) CanPrint(level LogLevel) bool { + if l.Level == LogLevelDisabled { + return false + } return l.Level <= level } @@ -208,6 +211,8 @@ func (l Logger) Args(args ...any) []LoggerArgument { var loggerArgs []LoggerArgument // args are in the format of: key, value, key, value, key, value, ... + args = l.sanitizeArgs(args) + for i := 0; i < len(args); i += 2 { key := Sprint(args[i]) value := args[i+1] @@ -235,6 +240,20 @@ func (l Logger) ArgsFromMap(m map[string]any) []LoggerArgument { return loggerArgs } +// sanitizeArgs inserts an error message into an args slice if an odd number of arguments is provided. +func (l Logger) sanitizeArgs(args []any) []any { + numArgs := len(args) + if numArgs > 0 && numArgs%2 != 0 { + if numArgs > 1 { + lastArg := args[numArgs-1] + args = append(args[:numArgs-1], []any{ErrKeyWithoutValue, lastArg}...) + } else { + args = []any{ErrKeyWithoutValue, args[0]} + } + } + return args +} + func (l Logger) getCallerInfo() (path string, line int) { if !l.ShowCaller { return @@ -261,7 +280,7 @@ func (l Logger) combineArgs(args ...[]LoggerArgument) []LoggerArgument { } func (l Logger) print(level LogLevel, msg string, args []LoggerArgument) { - if l.Level > level { + if !l.CanPrint(level) { return } @@ -277,7 +296,7 @@ func (l Logger) print(level LogLevel, msg string, args []LoggerArgument) { loggerMutex.Lock() defer loggerMutex.Unlock() - _, _ = l.Writer.Write([]byte(line + "\n")) + Fprintln(l.Writer, line) } func (l Logger) renderColorful(level LogLevel, msg string, args []LoggerArgument) (result string) { diff --git a/vendor/github.com/pterm/pterm/multi_live_printer.go b/vendor/github.com/pterm/pterm/multi_live_printer.go new file mode 100644 index 00000000..b9e0d0e8 --- /dev/null +++ b/vendor/github.com/pterm/pterm/multi_live_printer.go @@ -0,0 +1,124 @@ +package pterm + +import ( + "atomicgo.dev/schedule" + "bytes" + "io" + "os" + "strings" + "time" +) + +var DefaultMultiPrinter = MultiPrinter{ + printers: []LivePrinter{}, + Writer: os.Stdout, + UpdateDelay: time.Millisecond * 200, + + buffers: []*bytes.Buffer{}, + area: DefaultArea, +} + +type MultiPrinter struct { + IsActive bool + Writer io.Writer + UpdateDelay time.Duration + + printers []LivePrinter + buffers []*bytes.Buffer + area AreaPrinter +} + +// SetWriter sets the writer for the AreaPrinter. +func (p *MultiPrinter) SetWriter(writer io.Writer) { + p.Writer = writer +} + +// WithWriter returns a fork of the MultiPrinter with a new writer. +func (p MultiPrinter) WithWriter(writer io.Writer) *MultiPrinter { + p.Writer = writer + return &p +} + +// WithUpdateDelay returns a fork of the MultiPrinter with a new update delay. +func (p MultiPrinter) WithUpdateDelay(delay time.Duration) *MultiPrinter { + p.UpdateDelay = delay + return &p +} + +func (p *MultiPrinter) NewWriter() io.Writer { + buf := bytes.NewBufferString("") + p.buffers = append(p.buffers, buf) + return buf +} + +// getString returns all buffers appended and separated by a newline. +func (p *MultiPrinter) getString() string { + var buffer bytes.Buffer + for _, b := range p.buffers { + s := b.String() + s = strings.Trim(s, "\n") + + parts := strings.Split(s, "\r") // only get the last override + s = parts[len(parts)-1] + + // check if s is empty, if so get one part before, repeat until not empty + for s == "" { + parts = parts[:len(parts)-1] + s = parts[len(parts)-1] + } + + s = strings.Trim(s, "\n\r") + buffer.WriteString(s) + buffer.WriteString("\n") + } + return buffer.String() +} + +func (p *MultiPrinter) Start() (*MultiPrinter, error) { + p.IsActive = true + for _, printer := range p.printers { + printer.GenericStart() + } + + schedule.Every(p.UpdateDelay, func() bool { + if !p.IsActive { + return false + } + + p.area.Update(p.getString()) + + return true + }) + + return p, nil +} + +func (p *MultiPrinter) Stop() (*MultiPrinter, error) { + p.IsActive = false + for _, printer := range p.printers { + printer.GenericStop() + } + time.Sleep(time.Millisecond * 20) + p.area.Update(p.getString()) + p.area.Stop() + + return p, nil +} + +// GenericStart runs Start, but returns a LivePrinter. +// This is used for the interface LivePrinter. +// You most likely want to use Start instead of this in your program. +func (p MultiPrinter) GenericStart() (*LivePrinter, error) { + p2, _ := p.Start() + lp := LivePrinter(p2) + return &lp, nil +} + +// GenericStop runs Stop, but returns a LivePrinter. +// This is used for the interface LivePrinter. +// You most likely want to use Stop instead of this in your program. +func (p MultiPrinter) GenericStop() (*LivePrinter, error) { + p2, _ := p.Stop() + lp := LivePrinter(p2) + return &lp, nil +} diff --git a/vendor/github.com/pterm/pterm/panel_printer.go b/vendor/github.com/pterm/pterm/panel_printer.go index 709f7c80..090498e7 100644 --- a/vendor/github.com/pterm/pterm/panel_printer.go +++ b/vendor/github.com/pterm/pterm/panel_printer.go @@ -183,7 +183,7 @@ func (p PanelPrinter) Srender() (string, error) { // Render prints the Template to the terminal. func (p PanelPrinter) Render() error { s, _ := p.Srender() - Println(s) + Fprintln(p.Writer, s) return nil } diff --git a/vendor/github.com/pterm/pterm/print.go b/vendor/github.com/pterm/pterm/print.go index a58e5fa6..67b49c02 100644 --- a/vendor/github.com/pterm/pterm/print.go +++ b/vendor/github.com/pterm/pterm/print.go @@ -3,13 +3,17 @@ package pterm import ( "fmt" "io" + "os" "strings" "github.com/gookit/color" ) +var defaultWriter io.Writer = os.Stdout + // SetDefaultOutput sets the default output of pterm. func SetDefaultOutput(w io.Writer) { + defaultWriter = w color.SetOutput(w) } @@ -45,7 +49,7 @@ func Sprinto(a ...interface{}) string { // Spaces are added between operands when neither is a string. // It returns the number of bytes written and any write error encountered. func Print(a ...interface{}) { - Fprint(nil, a...) + Fprint(defaultWriter, a...) } // Println formats using the default formats for its operands and writes to standard output. diff --git a/vendor/github.com/pterm/pterm/progressbar_printer.go b/vendor/github.com/pterm/pterm/progressbar_printer.go index 282adcda..d2bb35c1 100644 --- a/vendor/github.com/pterm/pterm/progressbar_printer.go +++ b/vendor/github.com/pterm/pterm/progressbar_printer.go @@ -6,6 +6,7 @@ import ( "fmt" "io" "math" + "os" "strings" "time" @@ -18,23 +19,22 @@ import ( // Generally, there should only be one active ProgressbarPrinter at a time. var ActiveProgressBarPrinters []*ProgressbarPrinter -var ( - // DefaultProgressbar is the default ProgressbarPrinter. - DefaultProgressbar = ProgressbarPrinter{ - Total: 100, - BarCharacter: "█", - LastCharacter: "█", - ElapsedTimeRoundingFactor: time.Second, - BarStyle: &ThemeDefault.ProgressbarBarStyle, - TitleStyle: &ThemeDefault.ProgressbarTitleStyle, - ShowTitle: true, - ShowCount: true, - ShowPercentage: true, - ShowElapsedTime: true, - BarFiller: Gray("█"), - MaxWidth: 80, - } -) +// DefaultProgressbar is the default ProgressbarPrinter. +var DefaultProgressbar = ProgressbarPrinter{ + Total: 100, + BarCharacter: "█", + LastCharacter: "█", + ElapsedTimeRoundingFactor: time.Second, + BarStyle: &ThemeDefault.ProgressbarBarStyle, + TitleStyle: &ThemeDefault.ProgressbarTitleStyle, + ShowTitle: true, + ShowCount: true, + ShowPercentage: true, + ShowElapsedTime: true, + BarFiller: Gray("█"), + MaxWidth: 80, + Writer: os.Stdout, +} // ProgressbarPrinter shows a progress animation in the terminal. type ProgressbarPrinter struct { @@ -162,6 +162,11 @@ func (p ProgressbarPrinter) WithWriter(writer io.Writer) *ProgressbarPrinter { return &p } +// SetWriter sets the custom Writer. +func (p *ProgressbarPrinter) SetWriter(writer io.Writer) { + p.Writer = writer +} + // Increment current value by one. func (p *ProgressbarPrinter) Increment() *ProgressbarPrinter { p.Add(1) @@ -177,8 +182,13 @@ func (p *ProgressbarPrinter) UpdateTitle(title string) *ProgressbarPrinter { // This is the update logic, renders the progressbar func (p *ProgressbarPrinter) updateProgress() *ProgressbarPrinter { + Fprinto(p.Writer, p.getString()) + return p +} + +func (p *ProgressbarPrinter) getString() string { if !p.IsActive { - return p + return "" } if p.TitleStyle == nil { p.TitleStyle = NewStyle() @@ -187,7 +197,7 @@ func (p *ProgressbarPrinter) updateProgress() *ProgressbarPrinter { p.BarStyle = NewStyle() } if p.Total == 0 { - return nil + return "" } var before string @@ -235,10 +245,7 @@ func (p *ProgressbarPrinter) updateProgress() *ProgressbarPrinter { bar = p.BarStyle.Sprint(strings.Repeat(p.BarCharacter, barCurrentLength)+p.LastCharacter) + bar } - if !RawOutput { - Fprinto(p.Writer, before+bar+after) - } - return p + return before + bar + after } // Add to current value. @@ -251,6 +258,8 @@ func (p *ProgressbarPrinter) Add(count int) *ProgressbarPrinter { p.updateProgress() if p.Current >= p.Total { + p.Total = p.Current + p.updateProgress() p.Stop() } return p @@ -272,8 +281,9 @@ func (p ProgressbarPrinter) Start(title ...interface{}) (*ProgressbarPrinter, er p.updateProgress() if p.ShowElapsedTime { - p.rerenderTask = schedule.Every(time.Second, func() { + p.rerenderTask = schedule.Every(time.Second, func() bool { p.updateProgress() + return true }) } @@ -303,7 +313,7 @@ func (p *ProgressbarPrinter) Stop() (*ProgressbarPrinter, error) { // GenericStart runs Start, but returns a LivePrinter. // This is used for the interface LivePrinter. // You most likely want to use Start instead of this in your program. -func (p ProgressbarPrinter) GenericStart() (*LivePrinter, error) { +func (p *ProgressbarPrinter) GenericStart() (*LivePrinter, error) { p2, _ := p.Start() lp := LivePrinter(p2) return &lp, nil @@ -312,7 +322,7 @@ func (p ProgressbarPrinter) GenericStart() (*LivePrinter, error) { // GenericStop runs Stop, but returns a LivePrinter. // This is used for the interface LivePrinter. // You most likely want to use Stop instead of this in your program. -func (p ProgressbarPrinter) GenericStop() (*LivePrinter, error) { +func (p *ProgressbarPrinter) GenericStop() (*LivePrinter, error) { p2, _ := p.Stop() lp := LivePrinter(p2) return &lp, nil diff --git a/vendor/github.com/pterm/pterm/pterm.go b/vendor/github.com/pterm/pterm/pterm.go index ac05f0fd..f9d76ca3 100644 --- a/vendor/github.com/pterm/pterm/pterm.go +++ b/vendor/github.com/pterm/pterm/pterm.go @@ -7,11 +7,7 @@ package pterm import ( - "atomicgo.dev/cursor" "github.com/gookit/color" - "os" - "os/signal" - "syscall" ) var ( @@ -30,16 +26,6 @@ var ( func init() { color.ForceColor() - - // Make the cursor visible when the program stops - c := make(chan os.Signal, 1) - signal.Notify(c, os.Interrupt) - signal.Notify(c, syscall.SIGTERM) - go func() { - for range c { - cursor.Show() - } - }() } // EnableOutput enables the output of PTerm. @@ -77,7 +63,7 @@ func DisableStyling() { DisableColor() } -// RecalculateTerminalSize updates already initialized terminal dimensions. Has to be called after a termina resize to guarantee proper rendering. Applies only to new instances. +// RecalculateTerminalSize updates already initialized terminal dimensions. Has to be called after a terminal resize to guarantee proper rendering. Applies only to new instances. func RecalculateTerminalSize() { // keep in sync with DefaultBarChart DefaultBarChart.Width = GetTerminalWidth() * 2 / 3 diff --git a/vendor/github.com/pterm/pterm/rgb.go b/vendor/github.com/pterm/pterm/rgb.go index a35dd1a0..7c00835a 100644 --- a/vendor/github.com/pterm/pterm/rgb.go +++ b/vendor/github.com/pterm/pterm/rgb.go @@ -136,13 +136,13 @@ func (p RGBStyle) Sprintln(a ...interface{}) string { // Sprintf formats according to a format specifier and returns the resulting string. func (p RGBStyle) Sprintf(format string, a ...interface{}) string { - return fmt.Sprintf(format, p.Sprint(a...)) + return p.Sprint(Sprintf(format, a...)) } // Sprintfln formats according to a format specifier and returns the resulting string. // Spaces are always added between operands and a newline is appended. func (p RGBStyle) Sprintfln(format string, a ...interface{}) string { - return fmt.Sprintf(format, p.Sprint(a...)) + "\n" + return p.Sprintf(format, a...) + "\n" } // GetValues returns the RGB values separately. diff --git a/vendor/github.com/pterm/pterm/slog_handler.go b/vendor/github.com/pterm/pterm/slog_handler.go new file mode 100644 index 00000000..a2b2acfe --- /dev/null +++ b/vendor/github.com/pterm/pterm/slog_handler.go @@ -0,0 +1,90 @@ +package pterm + +import ( + "context" + + "log/slog" +) + +type SlogHandler struct { + logger *Logger + attrs []slog.Attr +} + +// Enabled returns true if the given level is enabled. +func (s *SlogHandler) Enabled(ctx context.Context, level slog.Level) bool { + switch level { + case slog.LevelDebug: + return s.logger.CanPrint(LogLevelDebug) + case slog.LevelInfo: + return s.logger.CanPrint(LogLevelInfo) + case slog.LevelWarn: + return s.logger.CanPrint(LogLevelWarn) + case slog.LevelError: + return s.logger.CanPrint(LogLevelError) + } + return false +} + +// Handle handles the given record. +func (s *SlogHandler) Handle(ctx context.Context, record slog.Record) error { + level := record.Level + message := record.Message + + // Convert slog Attrs to a map. + keyValsMap := make(map[string]interface{}) + + record.Attrs(func(attr slog.Attr) bool { + keyValsMap[attr.Key] = attr.Value + return true + }) + + for _, attr := range s.attrs { + keyValsMap[attr.Key] = attr.Value + } + + args := s.logger.ArgsFromMap(keyValsMap) + + // Wrapping args inside another slice to match [][]LoggerArgument + argsWrapped := [][]LoggerArgument{args} + + logger := s.logger + + // Must be done here, see https://github.com/pterm/pterm/issues/608#issuecomment-1876001650 + if logger.CallerOffset == 0 { + logger = logger.WithCallerOffset(3) + } + + switch level { + case slog.LevelDebug: + logger.Debug(message, argsWrapped...) + case slog.LevelInfo: + logger.Info(message, argsWrapped...) + case slog.LevelWarn: + logger.Warn(message, argsWrapped...) + case slog.LevelError: + logger.Error(message, argsWrapped...) + default: + logger.Print(message, argsWrapped...) + } + + return nil +} + +// WithAttrs returns a new handler with the given attributes. +func (s *SlogHandler) WithAttrs(attrs []slog.Attr) slog.Handler { + newS := *s + newS.attrs = attrs + return &newS +} + +// WithGroup is not yet supported. +func (s *SlogHandler) WithGroup(name string) slog.Handler { + // Grouping is not yet supported by pterm. + return s +} + +// NewSlogHandler returns a new logging handler that can be intrgrated with log/slog. +func NewSlogHandler(logger *Logger) *SlogHandler { + return &SlogHandler{logger: logger} +} diff --git a/vendor/github.com/pterm/pterm/spinner_printer.go b/vendor/github.com/pterm/pterm/spinner_printer.go index 82b84af7..044b6976 100644 --- a/vendor/github.com/pterm/pterm/spinner_printer.go +++ b/vendor/github.com/pterm/pterm/spinner_printer.go @@ -110,15 +110,18 @@ func (p SpinnerPrinter) WithWriter(writer io.Writer) *SpinnerPrinter { return &p } +// SetWriter sets the custom Writer. +func (p *SpinnerPrinter) SetWriter(writer io.Writer) { + p.Writer = writer +} + // UpdateText updates the message of the active SpinnerPrinter. // Can be used live. func (s *SpinnerPrinter) UpdateText(text string) { s.Text = text if !RawOutput { - fClearLine(s.Writer) Fprinto(s.Writer, s.Style.Sprint(s.currentSequence)+" "+s.MessageStyle.Sprint(s.Text)) - } - if RawOutput { + } else { Fprintln(s.Writer, s.Text) } } @@ -152,7 +155,6 @@ func (s SpinnerPrinter) Start(text ...interface{}) (*SpinnerPrinter, error) { if s.ShowTimer { timer = " (" + time.Since(s.startedAt).Round(s.TimerRoundingFactor).String() + ")" } - fClearLine(s.Writer) Fprinto(s.Writer, s.Style.Sprint(seq)+" "+s.MessageStyle.Sprint(s.Text)+s.TimerStyle.Sprint(timer)) s.currentSequence = seq time.Sleep(s.Delay) @@ -182,8 +184,8 @@ func (s *SpinnerPrinter) Stop() error { // This is used for the interface LivePrinter. // You most likely want to use Start instead of this in your program. func (s *SpinnerPrinter) GenericStart() (*LivePrinter, error) { - _, _ = s.Start() - lp := LivePrinter(s) + p2, _ := s.Start() + lp := LivePrinter(p2) return &lp, nil } diff --git a/vendor/github.com/pterm/pterm/theme.go b/vendor/github.com/pterm/pterm/theme.go index 22466ea7..91594c8c 100644 --- a/vendor/github.com/pterm/pterm/theme.go +++ b/vendor/github.com/pterm/pterm/theme.go @@ -30,6 +30,9 @@ var ( TableStyle: Style{FgDefault}, TableHeaderStyle: Style{FgLightCyan}, TableSeparatorStyle: Style{FgGray}, + HeatmapStyle: Style{FgDefault}, + HeatmapHeaderStyle: Style{FgLightCyan}, + HeatmapSeparatorStyle: Style{FgDefault}, SectionStyle: Style{Bold, FgYellow}, BulletListTextStyle: Style{FgDefault}, BulletListBulletStyle: Style{FgGray}, @@ -81,6 +84,9 @@ type Theme struct { TableStyle Style TableHeaderStyle Style TableSeparatorStyle Style + HeatmapStyle Style + HeatmapHeaderStyle Style + HeatmapSeparatorStyle Style SectionStyle Style BulletListTextStyle Style BulletListBulletStyle Style diff --git a/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go b/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go deleted file mode 100644 index e07899b9..00000000 --- a/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go +++ /dev/null @@ -1,30 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package unsafeheader contains header declarations for the Go runtime's -// slice and string implementations. -// -// This package allows x/sys to use types equivalent to -// reflect.SliceHeader and reflect.StringHeader without introducing -// a dependency on the (relatively heavy) "reflect" package. -package unsafeheader - -import ( - "unsafe" -) - -// Slice is the runtime representation of a slice. -// It cannot be used safely or portably and its representation may change in a later release. -type Slice struct { - Data unsafe.Pointer - Len int - Cap int -} - -// String is the runtime representation of a string. -// It cannot be used safely or portably and its representation may change in a later release. -type String struct { - Data unsafe.Pointer - Len int -} diff --git a/vendor/golang.org/x/sys/plan9/pwd_go15_plan9.go b/vendor/golang.org/x/sys/plan9/pwd_go15_plan9.go index c9b69937..73687de7 100644 --- a/vendor/golang.org/x/sys/plan9/pwd_go15_plan9.go +++ b/vendor/golang.org/x/sys/plan9/pwd_go15_plan9.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build go1.5 -// +build go1.5 package plan9 diff --git a/vendor/golang.org/x/sys/plan9/pwd_plan9.go b/vendor/golang.org/x/sys/plan9/pwd_plan9.go index 98bf56b7..fb945821 100644 --- a/vendor/golang.org/x/sys/plan9/pwd_plan9.go +++ b/vendor/golang.org/x/sys/plan9/pwd_plan9.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !go1.5 -// +build !go1.5 package plan9 diff --git a/vendor/golang.org/x/sys/plan9/race.go b/vendor/golang.org/x/sys/plan9/race.go index 62377d2f..c02d9ed3 100644 --- a/vendor/golang.org/x/sys/plan9/race.go +++ b/vendor/golang.org/x/sys/plan9/race.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build plan9 && race -// +build plan9,race package plan9 diff --git a/vendor/golang.org/x/sys/plan9/race0.go b/vendor/golang.org/x/sys/plan9/race0.go index f8da3087..7b15e15f 100644 --- a/vendor/golang.org/x/sys/plan9/race0.go +++ b/vendor/golang.org/x/sys/plan9/race0.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build plan9 && !race -// +build plan9,!race package plan9 diff --git a/vendor/golang.org/x/sys/plan9/str.go b/vendor/golang.org/x/sys/plan9/str.go index 55fa8d02..ba3e8ff8 100644 --- a/vendor/golang.org/x/sys/plan9/str.go +++ b/vendor/golang.org/x/sys/plan9/str.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build plan9 -// +build plan9 package plan9 diff --git a/vendor/golang.org/x/sys/plan9/syscall.go b/vendor/golang.org/x/sys/plan9/syscall.go index 67e5b011..d631fd66 100644 --- a/vendor/golang.org/x/sys/plan9/syscall.go +++ b/vendor/golang.org/x/sys/plan9/syscall.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build plan9 -// +build plan9 // Package plan9 contains an interface to the low-level operating system // primitives. OS details vary depending on the underlying system, and diff --git a/vendor/golang.org/x/sys/plan9/zsyscall_plan9_386.go b/vendor/golang.org/x/sys/plan9/zsyscall_plan9_386.go index 3f40b9bd..f780d5c8 100644 --- a/vendor/golang.org/x/sys/plan9/zsyscall_plan9_386.go +++ b/vendor/golang.org/x/sys/plan9/zsyscall_plan9_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build plan9 && 386 -// +build plan9,386 package plan9 diff --git a/vendor/golang.org/x/sys/plan9/zsyscall_plan9_amd64.go b/vendor/golang.org/x/sys/plan9/zsyscall_plan9_amd64.go index 0e6a96aa..7de61065 100644 --- a/vendor/golang.org/x/sys/plan9/zsyscall_plan9_amd64.go +++ b/vendor/golang.org/x/sys/plan9/zsyscall_plan9_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build plan9 && amd64 -// +build plan9,amd64 package plan9 diff --git a/vendor/golang.org/x/sys/plan9/zsyscall_plan9_arm.go b/vendor/golang.org/x/sys/plan9/zsyscall_plan9_arm.go index 244c501b..ea85780f 100644 --- a/vendor/golang.org/x/sys/plan9/zsyscall_plan9_arm.go +++ b/vendor/golang.org/x/sys/plan9/zsyscall_plan9_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build plan9 && arm -// +build plan9,arm package plan9 diff --git a/vendor/golang.org/x/sys/unix/aliases.go b/vendor/golang.org/x/sys/unix/aliases.go index abc89c10..e7d3df4b 100644 --- a/vendor/golang.org/x/sys/unix/aliases.go +++ b/vendor/golang.org/x/sys/unix/aliases.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos) && go1.9 -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos -// +build go1.9 package unix diff --git a/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s b/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s index db9171c2..269e173c 100644 --- a/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s +++ b/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_386.s b/vendor/golang.org/x/sys/unix/asm_bsd_386.s index e0fcd9b3..a4fcef0e 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_386.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_386.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (freebsd || netbsd || openbsd) && gc -// +build freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s b/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s index 2b99c349..1e63615c 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || dragonfly || freebsd || netbsd || openbsd) && gc -// +build darwin dragonfly freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_arm.s b/vendor/golang.org/x/sys/unix/asm_bsd_arm.s index d702d4ad..6496c310 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_arm.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_arm.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (freebsd || netbsd || openbsd) && gc -// +build freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s b/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s index fe36a739..4fd1f54d 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || freebsd || netbsd || openbsd) && gc -// +build darwin freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s b/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s index e5b9a848..42f7eb9e 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || freebsd || netbsd || openbsd) && gc -// +build darwin freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s b/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s index d560019e..f8902667 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || freebsd || netbsd || openbsd) && gc -// +build darwin freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_386.s b/vendor/golang.org/x/sys/unix/asm_linux_386.s index 8fd101d0..3b473487 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_386.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_386.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_amd64.s b/vendor/golang.org/x/sys/unix/asm_linux_amd64.s index 7ed38e43..67e29f31 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_amd64.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_amd64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_arm.s b/vendor/golang.org/x/sys/unix/asm_linux_arm.s index 8ef1d514..d6ae269c 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_arm.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_arm.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_arm64.s b/vendor/golang.org/x/sys/unix/asm_linux_arm64.s index 98ae0276..01e5e253 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_arm64.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_arm64.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && arm64 && gc -// +build linux -// +build arm64 -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_loong64.s b/vendor/golang.org/x/sys/unix/asm_linux_loong64.s index 56535728..2abf12f6 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_loong64.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_loong64.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && loong64 && gc -// +build linux -// +build loong64 -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s b/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s index 21231d2c..f84bae71 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (mips64 || mips64le) && gc -// +build linux -// +build mips64 mips64le -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s b/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s index 6783b26c..f08f6280 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (mips || mipsle) && gc -// +build linux -// +build mips mipsle -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s b/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s index 19d49893..bdfc024d 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (ppc64 || ppc64le) && gc -// +build linux -// +build ppc64 ppc64le -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s b/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s index e42eb81d..2e8c9961 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build riscv64 && gc -// +build riscv64 -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_s390x.s b/vendor/golang.org/x/sys/unix/asm_linux_s390x.s index c46aab33..2c394b11 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_s390x.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_s390x.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && s390x && gc -// +build linux -// +build s390x -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s index 5e7a1169..fab586a2 100644 --- a/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s +++ b/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s b/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s index f8c5394c..f949ec54 100644 --- a/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s +++ b/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_zos_s390x.s b/vendor/golang.org/x/sys/unix/asm_zos_s390x.s index 3b54e185..2f67ba86 100644 --- a/vendor/golang.org/x/sys/unix/asm_zos_s390x.s +++ b/vendor/golang.org/x/sys/unix/asm_zos_s390x.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x && gc -// +build zos -// +build s390x -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/cap_freebsd.go b/vendor/golang.org/x/sys/unix/cap_freebsd.go index 0b7c6adb..a0865789 100644 --- a/vendor/golang.org/x/sys/unix/cap_freebsd.go +++ b/vendor/golang.org/x/sys/unix/cap_freebsd.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build freebsd -// +build freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/constants.go b/vendor/golang.org/x/sys/unix/constants.go index 394a3965..6fb7cb77 100644 --- a/vendor/golang.org/x/sys/unix/constants.go +++ b/vendor/golang.org/x/sys/unix/constants.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/dev_aix_ppc.go b/vendor/golang.org/x/sys/unix/dev_aix_ppc.go index 65a99850..d7851346 100644 --- a/vendor/golang.org/x/sys/unix/dev_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/dev_aix_ppc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix && ppc -// +build aix,ppc // Functions to access/create device major and minor numbers matching the // encoding used by AIX. diff --git a/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go b/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go index 8fc08ad0..623a5e69 100644 --- a/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix && ppc64 -// +build aix,ppc64 // Functions to access/create device major and minor numbers matching the // encoding used AIX. diff --git a/vendor/golang.org/x/sys/unix/dev_zos.go b/vendor/golang.org/x/sys/unix/dev_zos.go index a388e59a..bb6a64fe 100644 --- a/vendor/golang.org/x/sys/unix/dev_zos.go +++ b/vendor/golang.org/x/sys/unix/dev_zos.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x // Functions to access/create device major and minor numbers matching the // encoding used by z/OS. diff --git a/vendor/golang.org/x/sys/unix/dirent.go b/vendor/golang.org/x/sys/unix/dirent.go index 2499f977..1ebf1178 100644 --- a/vendor/golang.org/x/sys/unix/dirent.go +++ b/vendor/golang.org/x/sys/unix/dirent.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/endian_big.go b/vendor/golang.org/x/sys/unix/endian_big.go index a5202655..1095fd31 100644 --- a/vendor/golang.org/x/sys/unix/endian_big.go +++ b/vendor/golang.org/x/sys/unix/endian_big.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. // //go:build armbe || arm64be || m68k || mips || mips64 || mips64p32 || ppc || ppc64 || s390 || s390x || shbe || sparc || sparc64 -// +build armbe arm64be m68k mips mips64 mips64p32 ppc ppc64 s390 s390x shbe sparc sparc64 package unix diff --git a/vendor/golang.org/x/sys/unix/endian_little.go b/vendor/golang.org/x/sys/unix/endian_little.go index b0f2bc4a..b9f0e277 100644 --- a/vendor/golang.org/x/sys/unix/endian_little.go +++ b/vendor/golang.org/x/sys/unix/endian_little.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. // //go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh -// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh package unix diff --git a/vendor/golang.org/x/sys/unix/env_unix.go b/vendor/golang.org/x/sys/unix/env_unix.go index 29ccc4d1..a96da71f 100644 --- a/vendor/golang.org/x/sys/unix/env_unix.go +++ b/vendor/golang.org/x/sys/unix/env_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos // Unix environment variables. diff --git a/vendor/golang.org/x/sys/unix/epoll_zos.go b/vendor/golang.org/x/sys/unix/epoll_zos.go index cedaf7e0..7753fdde 100644 --- a/vendor/golang.org/x/sys/unix/epoll_zos.go +++ b/vendor/golang.org/x/sys/unix/epoll_zos.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix diff --git a/vendor/golang.org/x/sys/unix/fcntl.go b/vendor/golang.org/x/sys/unix/fcntl.go index e9b99125..6200876f 100644 --- a/vendor/golang.org/x/sys/unix/fcntl.go +++ b/vendor/golang.org/x/sys/unix/fcntl.go @@ -2,8 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build dragonfly || freebsd || linux || netbsd || openbsd -// +build dragonfly freebsd linux netbsd openbsd +//go:build dragonfly || freebsd || linux || netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go b/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go index 29d44808..13b4acd5 100644 --- a/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go +++ b/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build (linux && 386) || (linux && arm) || (linux && mips) || (linux && mipsle) || (linux && ppc) -// +build linux,386 linux,arm linux,mips linux,mipsle linux,ppc package unix diff --git a/vendor/golang.org/x/sys/unix/fdset.go b/vendor/golang.org/x/sys/unix/fdset.go index a8068f94..9e83d18c 100644 --- a/vendor/golang.org/x/sys/unix/fdset.go +++ b/vendor/golang.org/x/sys/unix/fdset.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/fstatfs_zos.go b/vendor/golang.org/x/sys/unix/fstatfs_zos.go index e377cc9f..c8bde601 100644 --- a/vendor/golang.org/x/sys/unix/fstatfs_zos.go +++ b/vendor/golang.org/x/sys/unix/fstatfs_zos.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix diff --git a/vendor/golang.org/x/sys/unix/gccgo.go b/vendor/golang.org/x/sys/unix/gccgo.go index b06f52d7..aca5721d 100644 --- a/vendor/golang.org/x/sys/unix/gccgo.go +++ b/vendor/golang.org/x/sys/unix/gccgo.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gccgo && !aix && !hurd -// +build gccgo,!aix,!hurd package unix diff --git a/vendor/golang.org/x/sys/unix/gccgo_c.c b/vendor/golang.org/x/sys/unix/gccgo_c.c index f98a1c54..d468b7b4 100644 --- a/vendor/golang.org/x/sys/unix/gccgo_c.c +++ b/vendor/golang.org/x/sys/unix/gccgo_c.c @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gccgo && !aix && !hurd -// +build gccgo,!aix,!hurd #include #include diff --git a/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go b/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go index e60e49a3..972d61bd 100644 --- a/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gccgo && linux && amd64 -// +build gccgo,linux,amd64 package unix diff --git a/vendor/golang.org/x/sys/unix/ifreq_linux.go b/vendor/golang.org/x/sys/unix/ifreq_linux.go index 15721a51..848840ae 100644 --- a/vendor/golang.org/x/sys/unix/ifreq_linux.go +++ b/vendor/golang.org/x/sys/unix/ifreq_linux.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux -// +build linux package unix diff --git a/vendor/golang.org/x/sys/unix/ioctl_linux.go b/vendor/golang.org/x/sys/unix/ioctl_linux.go index 0d12c085..dbe680ea 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_linux.go +++ b/vendor/golang.org/x/sys/unix/ioctl_linux.go @@ -231,3 +231,8 @@ func IoctlLoopGetStatus64(fd int) (*LoopInfo64, error) { func IoctlLoopSetStatus64(fd int, value *LoopInfo64) error { return ioctlPtr(fd, LOOP_SET_STATUS64, unsafe.Pointer(value)) } + +// IoctlLoopConfigure configures all loop device parameters in a single step +func IoctlLoopConfigure(fd int, value *LoopConfig) error { + return ioctlPtr(fd, LOOP_CONFIGURE, unsafe.Pointer(value)) +} diff --git a/vendor/golang.org/x/sys/unix/ioctl_signed.go b/vendor/golang.org/x/sys/unix/ioctl_signed.go index 7def9580..5b0759bd 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_signed.go +++ b/vendor/golang.org/x/sys/unix/ioctl_signed.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || solaris -// +build aix solaris package unix diff --git a/vendor/golang.org/x/sys/unix/ioctl_unsigned.go b/vendor/golang.org/x/sys/unix/ioctl_unsigned.go index 649913d1..20f470b9 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_unsigned.go +++ b/vendor/golang.org/x/sys/unix/ioctl_unsigned.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin || dragonfly || freebsd || hurd || linux || netbsd || openbsd -// +build darwin dragonfly freebsd hurd linux netbsd openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ioctl_zos.go b/vendor/golang.org/x/sys/unix/ioctl_zos.go index cdc21bf7..c8b2a750 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_zos.go +++ b/vendor/golang.org/x/sys/unix/ioctl_zos.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix diff --git a/vendor/golang.org/x/sys/unix/mkall.sh b/vendor/golang.org/x/sys/unix/mkall.sh index 8e3947c3..e6f31d37 100644 --- a/vendor/golang.org/x/sys/unix/mkall.sh +++ b/vendor/golang.org/x/sys/unix/mkall.sh @@ -50,7 +50,7 @@ if [[ "$GOOS" = "linux" ]]; then # Use the Docker-based build system # Files generated through docker (use $cmd so you can Ctl-C the build or run) $cmd docker build --tag generate:$GOOS $GOOS - $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && /bin/pwd):/build generate:$GOOS + $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && pwd):/build generate:$GOOS exit fi diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh index be0423e6..c6492020 100644 --- a/vendor/golang.org/x/sys/unix/mkerrors.sh +++ b/vendor/golang.org/x/sys/unix/mkerrors.sh @@ -248,6 +248,7 @@ struct ltchars { #include #include #include +#include #include #include #include @@ -283,10 +284,6 @@ struct ltchars { #include #endif -#ifndef MSG_FASTOPEN -#define MSG_FASTOPEN 0x20000000 -#endif - #ifndef PTRACE_GETREGS #define PTRACE_GETREGS 0xc #endif @@ -295,14 +292,6 @@ struct ltchars { #define PTRACE_SETREGS 0xd #endif -#ifndef SOL_NETLINK -#define SOL_NETLINK 270 -#endif - -#ifndef SOL_SMC -#define SOL_SMC 286 -#endif - #ifdef SOL_BLUETOOTH // SPARC includes this in /usr/include/sparc64-linux-gnu/bits/socket.h // but it is already in bluetooth_linux.go @@ -319,10 +308,23 @@ struct ltchars { #undef TIPC_WAIT_FOREVER #define TIPC_WAIT_FOREVER 0xffffffff -// Copied from linux/l2tp.h -// Including linux/l2tp.h here causes conflicts between linux/in.h -// and netinet/in.h included via net/route.h above. -#define IPPROTO_L2TP 115 +// Copied from linux/netfilter/nf_nat.h +// Including linux/netfilter/nf_nat.h here causes conflicts between linux/in.h +// and netinet/in.h. +#define NF_NAT_RANGE_MAP_IPS (1 << 0) +#define NF_NAT_RANGE_PROTO_SPECIFIED (1 << 1) +#define NF_NAT_RANGE_PROTO_RANDOM (1 << 2) +#define NF_NAT_RANGE_PERSISTENT (1 << 3) +#define NF_NAT_RANGE_PROTO_RANDOM_FULLY (1 << 4) +#define NF_NAT_RANGE_PROTO_OFFSET (1 << 5) +#define NF_NAT_RANGE_NETMAP (1 << 6) +#define NF_NAT_RANGE_PROTO_RANDOM_ALL \ + (NF_NAT_RANGE_PROTO_RANDOM | NF_NAT_RANGE_PROTO_RANDOM_FULLY) +#define NF_NAT_RANGE_MASK \ + (NF_NAT_RANGE_MAP_IPS | NF_NAT_RANGE_PROTO_SPECIFIED | \ + NF_NAT_RANGE_PROTO_RANDOM | NF_NAT_RANGE_PERSISTENT | \ + NF_NAT_RANGE_PROTO_RANDOM_FULLY | NF_NAT_RANGE_PROTO_OFFSET | \ + NF_NAT_RANGE_NETMAP) // Copied from linux/hid.h. // Keep in sync with the size of the referenced fields. @@ -519,7 +521,8 @@ ccflags="$@" $2 ~ /^LOCK_(SH|EX|NB|UN)$/ || $2 ~ /^LO_(KEY|NAME)_SIZE$/ || $2 ~ /^LOOP_(CLR|CTL|GET|SET)_/ || - $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ || + $2 == "LOOP_CONFIGURE" || + $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MREMAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ || $2 ~ /^NFC_(GENL|PROTO|COMM|RF|SE|DIRECTION|LLCP|SOCKPROTO)_/ || $2 ~ /^NFC_.*_(MAX)?SIZE$/ || $2 ~ /^RAW_PAYLOAD_/ || @@ -560,7 +563,7 @@ ccflags="$@" $2 ~ /^RLIMIT_(AS|CORE|CPU|DATA|FSIZE|LOCKS|MEMLOCK|MSGQUEUE|NICE|NOFILE|NPROC|RSS|RTPRIO|RTTIME|SIGPENDING|STACK)|RLIM_INFINITY/ || $2 ~ /^PRIO_(PROCESS|PGRP|USER)/ || $2 ~ /^CLONE_[A-Z_]+/ || - $2 !~ /^(BPF_TIMEVAL|BPF_FIB_LOOKUP_[A-Z]+)$/ && + $2 !~ /^(BPF_TIMEVAL|BPF_FIB_LOOKUP_[A-Z]+|BPF_F_LINK)$/ && $2 ~ /^(BPF|DLT)_/ || $2 ~ /^AUDIT_/ || $2 ~ /^(CLOCK|TIMER)_/ || @@ -583,6 +586,7 @@ ccflags="$@" $2 ~ /^PERF_/ || $2 ~ /^SECCOMP_MODE_/ || $2 ~ /^SEEK_/ || + $2 ~ /^SCHED_/ || $2 ~ /^SPLICE_/ || $2 ~ /^SYNC_FILE_RANGE_/ || $2 !~ /IOC_MAGIC/ && @@ -601,6 +605,9 @@ ccflags="$@" $2 ~ /^FSOPT_/ || $2 ~ /^WDIO[CFS]_/ || $2 ~ /^NFN/ || + $2 !~ /^NFT_META_IIFTYPE/ && + $2 ~ /^NFT_/ || + $2 ~ /^NF_NAT_/ || $2 ~ /^XDP_/ || $2 ~ /^RWF_/ || $2 ~ /^(HDIO|WIN|SMART)_/ || @@ -624,7 +631,7 @@ ccflags="$@" $2 ~ /^MEM/ || $2 ~ /^WG/ || $2 ~ /^FIB_RULE_/ || - $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE)/ {printf("\t%s = C.%s\n", $2, $2)} + $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE|IOMIN$|IOOPT$|ALIGNOFF$|DISCARD|ROTATIONAL$|ZEROOUT$|GETDISKSEQ$)/ {printf("\t%s = C.%s\n", $2, $2)} $2 ~ /^__WCOREFLAG$/ {next} $2 ~ /^__W[A-Z0-9]+$/ {printf("\t%s = C.%s\n", substr($2,3), $2)} @@ -662,7 +669,6 @@ echo '// mkerrors.sh' "$@" echo '// Code generated by the command above; see README.md. DO NOT EDIT.' echo echo "//go:build ${GOARCH} && ${GOOS}" -echo "// +build ${GOARCH},${GOOS}" echo go tool cgo -godefs -- "$@" _const.go >_error.out cat _error.out | grep -vf _error.grep | grep -vf _signal.grep @@ -741,7 +747,8 @@ main(void) e = errors[i].num; if(i > 0 && errors[i-1].num == e) continue; - strcpy(buf, strerror(e)); + strncpy(buf, strerror(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; @@ -760,7 +767,8 @@ main(void) e = signals[i].num; if(i > 0 && signals[i-1].num == e) continue; - strcpy(buf, strsignal(e)); + strncpy(buf, strsignal(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; diff --git a/vendor/golang.org/x/sys/unix/mmap_nomremap.go b/vendor/golang.org/x/sys/unix/mmap_nomremap.go new file mode 100644 index 00000000..4b68e597 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/mmap_nomremap.go @@ -0,0 +1,13 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build aix || darwin || dragonfly || freebsd || openbsd || solaris + +package unix + +var mapper = &mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, +} diff --git a/vendor/golang.org/x/sys/unix/mremap.go b/vendor/golang.org/x/sys/unix/mremap.go new file mode 100644 index 00000000..fd45fe52 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/mremap.go @@ -0,0 +1,52 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build linux || netbsd + +package unix + +import "unsafe" + +type mremapMmapper struct { + mmapper + mremap func(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) +} + +var mapper = &mremapMmapper{ + mmapper: mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, + }, + mremap: mremap, +} + +func (m *mremapMmapper) Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + if newLength <= 0 || len(oldData) == 0 || len(oldData) != cap(oldData) || flags&mremapFixed != 0 { + return nil, EINVAL + } + + pOld := &oldData[cap(oldData)-1] + m.Lock() + defer m.Unlock() + bOld := m.active[pOld] + if bOld == nil || &bOld[0] != &oldData[0] { + return nil, EINVAL + } + newAddr, errno := m.mremap(uintptr(unsafe.Pointer(&bOld[0])), uintptr(len(bOld)), uintptr(newLength), flags, 0) + if errno != nil { + return nil, errno + } + bNew := unsafe.Slice((*byte)(unsafe.Pointer(newAddr)), newLength) + pNew := &bNew[cap(bNew)-1] + if flags&mremapDontunmap == 0 { + delete(m.active, pOld) + } + m.active[pNew] = bNew + return bNew, nil +} + +func Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + return mapper.Mremap(oldData, newLength, flags) +} diff --git a/vendor/golang.org/x/sys/unix/pagesize_unix.go b/vendor/golang.org/x/sys/unix/pagesize_unix.go index 53f1b4c5..4d0a3430 100644 --- a/vendor/golang.org/x/sys/unix/pagesize_unix.go +++ b/vendor/golang.org/x/sys/unix/pagesize_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris // For Unix, get the pagesize from the runtime. diff --git a/vendor/golang.org/x/sys/unix/pledge_openbsd.go b/vendor/golang.org/x/sys/unix/pledge_openbsd.go index eb48294b..6a09af53 100644 --- a/vendor/golang.org/x/sys/unix/pledge_openbsd.go +++ b/vendor/golang.org/x/sys/unix/pledge_openbsd.go @@ -8,54 +8,31 @@ import ( "errors" "fmt" "strconv" - "syscall" - "unsafe" ) // Pledge implements the pledge syscall. // -// The pledge syscall does not accept execpromises on OpenBSD releases -// before 6.3. -// -// execpromises must be empty when Pledge is called on OpenBSD -// releases predating 6.3, otherwise an error will be returned. +// This changes both the promises and execpromises; use PledgePromises or +// PledgeExecpromises to only change the promises or execpromises +// respectively. // // For more information see pledge(2). func Pledge(promises, execpromises string) error { - maj, min, err := majmin() - if err != nil { + if err := pledgeAvailable(); err != nil { return err } - err = pledgeAvailable(maj, min, execpromises) + pptr, err := BytePtrFromString(promises) if err != nil { return err } - pptr, err := syscall.BytePtrFromString(promises) + exptr, err := BytePtrFromString(execpromises) if err != nil { return err } - // This variable will hold either a nil unsafe.Pointer or - // an unsafe.Pointer to a string (execpromises). - var expr unsafe.Pointer - - // If we're running on OpenBSD > 6.2, pass execpromises to the syscall. - if maj > 6 || (maj == 6 && min > 2) { - exptr, err := syscall.BytePtrFromString(execpromises) - if err != nil { - return err - } - expr = unsafe.Pointer(exptr) - } - - _, _, e := syscall.Syscall(SYS_PLEDGE, uintptr(unsafe.Pointer(pptr)), uintptr(expr), 0) - if e != 0 { - return e - } - - return nil + return pledge(pptr, exptr) } // PledgePromises implements the pledge syscall. @@ -64,30 +41,16 @@ func Pledge(promises, execpromises string) error { // // For more information see pledge(2). func PledgePromises(promises string) error { - maj, min, err := majmin() - if err != nil { - return err - } - - err = pledgeAvailable(maj, min, "") - if err != nil { + if err := pledgeAvailable(); err != nil { return err } - // This variable holds the execpromises and is always nil. - var expr unsafe.Pointer - - pptr, err := syscall.BytePtrFromString(promises) + pptr, err := BytePtrFromString(promises) if err != nil { return err } - _, _, e := syscall.Syscall(SYS_PLEDGE, uintptr(unsafe.Pointer(pptr)), uintptr(expr), 0) - if e != 0 { - return e - } - - return nil + return pledge(pptr, nil) } // PledgeExecpromises implements the pledge syscall. @@ -96,30 +59,16 @@ func PledgePromises(promises string) error { // // For more information see pledge(2). func PledgeExecpromises(execpromises string) error { - maj, min, err := majmin() - if err != nil { + if err := pledgeAvailable(); err != nil { return err } - err = pledgeAvailable(maj, min, execpromises) + exptr, err := BytePtrFromString(execpromises) if err != nil { return err } - // This variable holds the promises and is always nil. - var pptr unsafe.Pointer - - exptr, err := syscall.BytePtrFromString(execpromises) - if err != nil { - return err - } - - _, _, e := syscall.Syscall(SYS_PLEDGE, uintptr(pptr), uintptr(unsafe.Pointer(exptr)), 0) - if e != 0 { - return e - } - - return nil + return pledge(nil, exptr) } // majmin returns major and minor version number for an OpenBSD system. @@ -147,16 +96,15 @@ func majmin() (major int, minor int, err error) { // pledgeAvailable checks for availability of the pledge(2) syscall // based on the running OpenBSD version. -func pledgeAvailable(maj, min int, execpromises string) error { - // If OpenBSD <= 5.9, pledge is not available. - if (maj == 5 && min != 9) || maj < 5 { - return fmt.Errorf("pledge syscall is not available on OpenBSD %d.%d", maj, min) +func pledgeAvailable() error { + maj, min, err := majmin() + if err != nil { + return err } - // If OpenBSD <= 6.2 and execpromises is not empty, - // return an error - execpromises is not available before 6.3 - if (maj < 6 || (maj == 6 && min <= 2)) && execpromises != "" { - return fmt.Errorf("cannot use execpromises on OpenBSD %d.%d", maj, min) + // Require OpenBSD 6.4 as a minimum. + if maj < 6 || (maj == 6 && min <= 3) { + return fmt.Errorf("cannot call Pledge on OpenBSD %d.%d", maj, min) } return nil diff --git a/vendor/golang.org/x/sys/unix/ptrace_darwin.go b/vendor/golang.org/x/sys/unix/ptrace_darwin.go index 39dba6ca..3f0975f3 100644 --- a/vendor/golang.org/x/sys/unix/ptrace_darwin.go +++ b/vendor/golang.org/x/sys/unix/ptrace_darwin.go @@ -3,16 +3,9 @@ // license that can be found in the LICENSE file. //go:build darwin && !ios -// +build darwin,!ios package unix -import "unsafe" - func ptrace(request int, pid int, addr uintptr, data uintptr) error { return ptrace1(request, pid, addr, data) } - -func ptracePtr(request int, pid int, addr uintptr, data unsafe.Pointer) error { - return ptrace1Ptr(request, pid, addr, data) -} diff --git a/vendor/golang.org/x/sys/unix/ptrace_ios.go b/vendor/golang.org/x/sys/unix/ptrace_ios.go index 9ea66330..a4d35db5 100644 --- a/vendor/golang.org/x/sys/unix/ptrace_ios.go +++ b/vendor/golang.org/x/sys/unix/ptrace_ios.go @@ -3,16 +3,9 @@ // license that can be found in the LICENSE file. //go:build ios -// +build ios package unix -import "unsafe" - func ptrace(request int, pid int, addr uintptr, data uintptr) (err error) { return ENOTSUP } - -func ptracePtr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { - return ENOTSUP -} diff --git a/vendor/golang.org/x/sys/unix/race.go b/vendor/golang.org/x/sys/unix/race.go index 6f6c5fec..714d2aae 100644 --- a/vendor/golang.org/x/sys/unix/race.go +++ b/vendor/golang.org/x/sys/unix/race.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin && race) || (linux && race) || (freebsd && race) -// +build darwin,race linux,race freebsd,race package unix diff --git a/vendor/golang.org/x/sys/unix/race0.go b/vendor/golang.org/x/sys/unix/race0.go index 706e1322..4a9f6634 100644 --- a/vendor/golang.org/x/sys/unix/race0.go +++ b/vendor/golang.org/x/sys/unix/race0.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || (darwin && !race) || (linux && !race) || (freebsd && !race) || netbsd || openbsd || solaris || dragonfly || zos -// +build aix darwin,!race linux,!race freebsd,!race netbsd openbsd solaris dragonfly zos package unix diff --git a/vendor/golang.org/x/sys/unix/readdirent_getdents.go b/vendor/golang.org/x/sys/unix/readdirent_getdents.go index 4d625756..dbd2b6cc 100644 --- a/vendor/golang.org/x/sys/unix/readdirent_getdents.go +++ b/vendor/golang.org/x/sys/unix/readdirent_getdents.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || dragonfly || freebsd || linux || netbsd || openbsd -// +build aix dragonfly freebsd linux netbsd openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go b/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go index 2a4ba47c..130398b6 100644 --- a/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go +++ b/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin -// +build darwin package unix diff --git a/vendor/golang.org/x/sys/unix/sockcmsg_unix.go b/vendor/golang.org/x/sys/unix/sockcmsg_unix.go index 3865943f..c3a62dbb 100644 --- a/vendor/golang.org/x/sys/unix/sockcmsg_unix.go +++ b/vendor/golang.org/x/sys/unix/sockcmsg_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos // Socket control messages diff --git a/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go b/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go index 0840fe4a..4a1eab37 100644 --- a/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go +++ b/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/syscall.go b/vendor/golang.org/x/sys/unix/syscall.go index 63e8c838..5ea74da9 100644 --- a/vendor/golang.org/x/sys/unix/syscall.go +++ b/vendor/golang.org/x/sys/unix/syscall.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos // Package unix contains an interface to the low-level operating system // primitives. OS details vary depending on the underlying system, and diff --git a/vendor/golang.org/x/sys/unix/syscall_aix.go b/vendor/golang.org/x/sys/unix/syscall_aix.go index c406ae00..67ce6cef 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix -// +build aix // Aix system calls. // This file is compiled as ordinary Go code, @@ -107,7 +106,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, _Socklen, error) { if n > 0 { sl += _Socklen(n) + 1 } - if sa.raw.Path[0] == '@' { + if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) { + // Check sl > 3 so we don't change unnamed socket behavior. sa.raw.Path[0] = 0 // Don't count trailing NUL for abstract address. sl-- @@ -487,8 +487,6 @@ func Fsync(fd int) error { //sys Unlinkat(dirfd int, path string, flags int) (err error) //sys Ustat(dev int, ubuf *Ustat_t) (err error) //sys write(fd int, p []byte) (n int, err error) -//sys readlen(fd int, p *byte, np int) (n int, err error) = read -//sys writelen(fd int, p *byte, np int) (n int, err error) = write //sys Dup2(oldfd int, newfd int) (err error) //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = posix_fadvise64 @@ -535,21 +533,6 @@ func Fsync(fd int) error { //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = nsendmsg //sys munmap(addr uintptr, length uintptr) (err error) - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go index f2871fa9..1fdaa476 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix && ppc -// +build aix,ppc package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go index 75718ec0..c87f9a9f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix && ppc64 -// +build aix,ppc64 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_bsd.go b/vendor/golang.org/x/sys/unix/syscall_bsd.go index 7705c327..a00c3e54 100644 --- a/vendor/golang.org/x/sys/unix/syscall_bsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_bsd.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin || dragonfly || freebsd || netbsd || openbsd -// +build darwin dragonfly freebsd netbsd openbsd // BSD system call wrappers shared by *BSD based systems // including OS X (Darwin) and FreeBSD. Like the other @@ -317,7 +316,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { if err != nil { return "", err } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } //sys recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) @@ -601,20 +600,6 @@ func Poll(fds []PollFd, timeout int) (n int, err error) { // Gethostuuid(uuid *byte, timeout *Timespec) (err error) // Ptrace(req int, pid int, addr uintptr, data int) (ret uintptr, err error) -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Madvise(b []byte, behav int) (err error) //sys Mlock(b []byte) (err error) //sys Mlockall(flags int) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.go b/vendor/golang.org/x/sys/unix/syscall_darwin.go index 20692150..59542a89 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin.go @@ -510,30 +510,36 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { return nil, err } - // Find size. - n := uintptr(0) - if err := sysctl(mib, nil, &n, nil, 0); err != nil { - return nil, err - } - if n == 0 { - return nil, nil - } - if n%SizeofKinfoProc != 0 { - return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) - } + for { + // Find size. + n := uintptr(0) + if err := sysctl(mib, nil, &n, nil, 0); err != nil { + return nil, err + } + if n == 0 { + return nil, nil + } + if n%SizeofKinfoProc != 0 { + return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) + } - // Read into buffer of that size. - buf := make([]KinfoProc, n/SizeofKinfoProc) - if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil { - return nil, err - } - if n%SizeofKinfoProc != 0 { - return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) - } + // Read into buffer of that size. + buf := make([]KinfoProc, n/SizeofKinfoProc) + if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil { + if err == ENOMEM { + // Process table grew. Try again. + continue + } + return nil, err + } + if n%SizeofKinfoProc != 0 { + return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) + } - // The actual call may return less than the original reported required - // size so ensure we deal with that. - return buf[:n/SizeofKinfoProc], nil + // The actual call may return less than the original reported required + // size so ensure we deal with that. + return buf[:n/SizeofKinfoProc], nil + } } //sys sendfile(infd int, outfd int, offset int64, len *int64, hdtr unsafe.Pointer, flags int) (err error) @@ -638,189 +644,3 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE - -/* - * Unimplemented - */ -// Profil -// Sigaction -// Sigprocmask -// Getlogin -// Sigpending -// Sigaltstack -// Ioctl -// Reboot -// Execve -// Vfork -// Sbrk -// Sstk -// Ovadvise -// Mincore -// Setitimer -// Swapon -// Select -// Sigsuspend -// Readv -// Writev -// Nfssvc -// Getfh -// Quotactl -// Csops -// Waitid -// Add_profil -// Kdebug_trace -// Sigreturn -// Atsocket -// Kqueue_from_portset_np -// Kqueue_portset -// Getattrlist -// Getdirentriesattr -// Searchfs -// Delete -// Copyfile -// Watchevent -// Waitevent -// Modwatch -// Fsctl -// Initgroups -// Posix_spawn -// Nfsclnt -// Fhopen -// Minherit -// Semsys -// Msgsys -// Shmsys -// Semctl -// Semget -// Semop -// Msgctl -// Msgget -// Msgsnd -// Msgrcv -// Shm_open -// Shm_unlink -// Sem_open -// Sem_close -// Sem_unlink -// Sem_wait -// Sem_trywait -// Sem_post -// Sem_getvalue -// Sem_init -// Sem_destroy -// Open_extended -// Umask_extended -// Stat_extended -// Lstat_extended -// Fstat_extended -// Chmod_extended -// Fchmod_extended -// Access_extended -// Settid -// Gettid -// Setsgroups -// Getsgroups -// Setwgroups -// Getwgroups -// Mkfifo_extended -// Mkdir_extended -// Identitysvc -// Shared_region_check_np -// Shared_region_map_np -// __pthread_mutex_destroy -// __pthread_mutex_init -// __pthread_mutex_lock -// __pthread_mutex_trylock -// __pthread_mutex_unlock -// __pthread_cond_init -// __pthread_cond_destroy -// __pthread_cond_broadcast -// __pthread_cond_signal -// Setsid_with_pid -// __pthread_cond_timedwait -// Aio_fsync -// Aio_return -// Aio_suspend -// Aio_cancel -// Aio_error -// Aio_read -// Aio_write -// Lio_listio -// __pthread_cond_wait -// Iopolicysys -// __pthread_kill -// __pthread_sigmask -// __sigwait -// __disable_threadsignal -// __pthread_markcancel -// __pthread_canceled -// __semwait_signal -// Proc_info -// sendfile -// Stat64_extended -// Lstat64_extended -// Fstat64_extended -// __pthread_chdir -// __pthread_fchdir -// Audit -// Auditon -// Getauid -// Setauid -// Getaudit -// Setaudit -// Getaudit_addr -// Setaudit_addr -// Auditctl -// Bsdthread_create -// Bsdthread_terminate -// Stack_snapshot -// Bsdthread_register -// Workq_open -// Workq_ops -// __mac_execve -// __mac_syscall -// __mac_get_file -// __mac_set_file -// __mac_get_link -// __mac_set_link -// __mac_get_proc -// __mac_set_proc -// __mac_get_fd -// __mac_set_fd -// __mac_get_pid -// __mac_get_lcid -// __mac_get_lctx -// __mac_set_lctx -// Setlcid -// Read_nocancel -// Write_nocancel -// Open_nocancel -// Close_nocancel -// Wait4_nocancel -// Recvmsg_nocancel -// Sendmsg_nocancel -// Recvfrom_nocancel -// Accept_nocancel -// Fcntl_nocancel -// Select_nocancel -// Fsync_nocancel -// Connect_nocancel -// Sigsuspend_nocancel -// Readv_nocancel -// Writev_nocancel -// Sendto_nocancel -// Pread_nocancel -// Pwrite_nocancel -// Waitid_nocancel -// Poll_nocancel -// Msgsnd_nocancel -// Msgrcv_nocancel -// Sem_wait_nocancel -// Aio_suspend_nocancel -// __sigwait_nocancel -// __semwait_signal_nocancel -// __mac_mount -// __mac_get_mount -// __mac_getfsstat diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go index 9fa87980..0eaecf5f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && darwin -// +build amd64,darwin package unix @@ -47,6 +46,5 @@ func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, //sys getfsstat(buf unsafe.Pointer, size uintptr, flags int) (n int, err error) = SYS_GETFSSTAT64 //sys Lstat(path string, stat *Stat_t) (err error) = SYS_LSTAT64 //sys ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) = SYS_ptrace -//sys ptrace1Ptr(request int, pid int, addr unsafe.Pointer, data uintptr) (err error) = SYS_ptrace //sys Stat(path string, stat *Stat_t) (err error) = SYS_STAT64 //sys Statfs(path string, stat *Statfs_t) (err error) = SYS_STATFS64 diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go index f17b8c52..f36c6707 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && darwin -// +build arm64,darwin package unix @@ -47,6 +46,5 @@ func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, //sys getfsstat(buf unsafe.Pointer, size uintptr, flags int) (n int, err error) = SYS_GETFSSTAT //sys Lstat(path string, stat *Stat_t) (err error) //sys ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) = SYS_ptrace -//sys ptrace1Ptr(request int, pid int, addr unsafe.Pointer, data uintptr) (err error) = SYS_ptrace //sys Stat(path string, stat *Stat_t) (err error) //sys Statfs(path string, stat *Statfs_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go b/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go index 53c96641..16dc6993 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin && go1.12 -// +build darwin,go1.12 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go index d4ce988e..97cb916f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go +++ b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go @@ -343,203 +343,5 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) - -/* - * Unimplemented - * TODO(jsing): Update this list for DragonFly. - */ -// Profil -// Sigaction -// Sigprocmask -// Getlogin -// Sigpending -// Sigaltstack -// Reboot -// Execve -// Vfork -// Sbrk -// Sstk -// Ovadvise -// Mincore -// Setitimer -// Swapon -// Select -// Sigsuspend -// Readv -// Writev -// Nfssvc -// Getfh -// Quotactl -// Mount -// Csops -// Waitid -// Add_profil -// Kdebug_trace -// Sigreturn -// Atsocket -// Kqueue_from_portset_np -// Kqueue_portset -// Getattrlist -// Setattrlist -// Getdirentriesattr -// Searchfs -// Delete -// Copyfile -// Watchevent -// Waitevent -// Modwatch -// Getxattr -// Fgetxattr -// Setxattr -// Fsetxattr -// Removexattr -// Fremovexattr -// Listxattr -// Flistxattr -// Fsctl -// Initgroups -// Posix_spawn -// Nfsclnt -// Fhopen -// Minherit -// Semsys -// Msgsys -// Shmsys -// Semctl -// Semget -// Semop -// Msgctl -// Msgget -// Msgsnd -// Msgrcv -// Shmat -// Shmctl -// Shmdt -// Shmget -// Shm_open -// Shm_unlink -// Sem_open -// Sem_close -// Sem_unlink -// Sem_wait -// Sem_trywait -// Sem_post -// Sem_getvalue -// Sem_init -// Sem_destroy -// Open_extended -// Umask_extended -// Stat_extended -// Lstat_extended -// Fstat_extended -// Chmod_extended -// Fchmod_extended -// Access_extended -// Settid -// Gettid -// Setsgroups -// Getsgroups -// Setwgroups -// Getwgroups -// Mkfifo_extended -// Mkdir_extended -// Identitysvc -// Shared_region_check_np -// Shared_region_map_np -// __pthread_mutex_destroy -// __pthread_mutex_init -// __pthread_mutex_lock -// __pthread_mutex_trylock -// __pthread_mutex_unlock -// __pthread_cond_init -// __pthread_cond_destroy -// __pthread_cond_broadcast -// __pthread_cond_signal -// Setsid_with_pid -// __pthread_cond_timedwait -// Aio_fsync -// Aio_return -// Aio_suspend -// Aio_cancel -// Aio_error -// Aio_read -// Aio_write -// Lio_listio -// __pthread_cond_wait -// Iopolicysys -// __pthread_kill -// __pthread_sigmask -// __sigwait -// __disable_threadsignal -// __pthread_markcancel -// __pthread_canceled -// __semwait_signal -// Proc_info -// Stat64_extended -// Lstat64_extended -// Fstat64_extended -// __pthread_chdir -// __pthread_fchdir -// Audit -// Auditon -// Getauid -// Setauid -// Getaudit -// Setaudit -// Getaudit_addr -// Setaudit_addr -// Auditctl -// Bsdthread_create -// Bsdthread_terminate -// Stack_snapshot -// Bsdthread_register -// Workq_open -// Workq_ops -// __mac_execve -// __mac_syscall -// __mac_get_file -// __mac_set_file -// __mac_get_link -// __mac_set_link -// __mac_get_proc -// __mac_set_proc -// __mac_get_fd -// __mac_set_fd -// __mac_get_pid -// __mac_get_lcid -// __mac_get_lctx -// __mac_set_lctx -// Setlcid -// Read_nocancel -// Write_nocancel -// Open_nocancel -// Close_nocancel -// Wait4_nocancel -// Recvmsg_nocancel -// Sendmsg_nocancel -// Recvfrom_nocancel -// Accept_nocancel -// Fcntl_nocancel -// Select_nocancel -// Fsync_nocancel -// Connect_nocancel -// Sigsuspend_nocancel -// Readv_nocancel -// Writev_nocancel -// Sendto_nocancel -// Pread_nocancel -// Pwrite_nocancel -// Waitid_nocancel -// Msgsnd_nocancel -// Msgrcv_nocancel -// Sem_wait_nocancel -// Aio_suspend_nocancel -// __sigwait_nocancel -// __semwait_signal_nocancel -// __mac_mount -// __mac_get_mount -// __mac_getfsstat diff --git a/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go index 4e2d3212..14bab6b2 100644 --- a/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && dragonfly -// +build amd64,dragonfly package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd.go b/vendor/golang.org/x/sys/unix/syscall_freebsd.go index afb10106..64d1bb4d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd.go @@ -449,197 +449,5 @@ func Dup3(oldfd, newfd, flags int) error { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) - -/* - * Unimplemented - */ -// Profil -// Sigaction -// Sigprocmask -// Getlogin -// Sigpending -// Sigaltstack -// Ioctl -// Reboot -// Execve -// Vfork -// Sbrk -// Sstk -// Ovadvise -// Mincore -// Setitimer -// Swapon -// Select -// Sigsuspend -// Readv -// Writev -// Nfssvc -// Getfh -// Quotactl -// Mount -// Csops -// Waitid -// Add_profil -// Kdebug_trace -// Sigreturn -// Atsocket -// Kqueue_from_portset_np -// Kqueue_portset -// Getattrlist -// Setattrlist -// Getdents -// Getdirentriesattr -// Searchfs -// Delete -// Copyfile -// Watchevent -// Waitevent -// Modwatch -// Fsctl -// Initgroups -// Posix_spawn -// Nfsclnt -// Fhopen -// Minherit -// Semsys -// Msgsys -// Shmsys -// Semctl -// Semget -// Semop -// Msgctl -// Msgget -// Msgsnd -// Msgrcv -// Shmat -// Shmctl -// Shmdt -// Shmget -// Shm_open -// Shm_unlink -// Sem_open -// Sem_close -// Sem_unlink -// Sem_wait -// Sem_trywait -// Sem_post -// Sem_getvalue -// Sem_init -// Sem_destroy -// Open_extended -// Umask_extended -// Stat_extended -// Lstat_extended -// Fstat_extended -// Chmod_extended -// Fchmod_extended -// Access_extended -// Settid -// Gettid -// Setsgroups -// Getsgroups -// Setwgroups -// Getwgroups -// Mkfifo_extended -// Mkdir_extended -// Identitysvc -// Shared_region_check_np -// Shared_region_map_np -// __pthread_mutex_destroy -// __pthread_mutex_init -// __pthread_mutex_lock -// __pthread_mutex_trylock -// __pthread_mutex_unlock -// __pthread_cond_init -// __pthread_cond_destroy -// __pthread_cond_broadcast -// __pthread_cond_signal -// Setsid_with_pid -// __pthread_cond_timedwait -// Aio_fsync -// Aio_return -// Aio_suspend -// Aio_cancel -// Aio_error -// Aio_read -// Aio_write -// Lio_listio -// __pthread_cond_wait -// Iopolicysys -// __pthread_kill -// __pthread_sigmask -// __sigwait -// __disable_threadsignal -// __pthread_markcancel -// __pthread_canceled -// __semwait_signal -// Proc_info -// Stat64_extended -// Lstat64_extended -// Fstat64_extended -// __pthread_chdir -// __pthread_fchdir -// Audit -// Auditon -// Getauid -// Setauid -// Getaudit -// Setaudit -// Getaudit_addr -// Setaudit_addr -// Auditctl -// Bsdthread_create -// Bsdthread_terminate -// Stack_snapshot -// Bsdthread_register -// Workq_open -// Workq_ops -// __mac_execve -// __mac_syscall -// __mac_get_file -// __mac_set_file -// __mac_get_link -// __mac_set_link -// __mac_get_proc -// __mac_set_proc -// __mac_get_fd -// __mac_set_fd -// __mac_get_pid -// __mac_get_lcid -// __mac_get_lctx -// __mac_set_lctx -// Setlcid -// Read_nocancel -// Write_nocancel -// Open_nocancel -// Close_nocancel -// Wait4_nocancel -// Recvmsg_nocancel -// Sendmsg_nocancel -// Recvfrom_nocancel -// Accept_nocancel -// Fcntl_nocancel -// Select_nocancel -// Fsync_nocancel -// Connect_nocancel -// Sigsuspend_nocancel -// Readv_nocancel -// Writev_nocancel -// Sendto_nocancel -// Pread_nocancel -// Pwrite_nocancel -// Waitid_nocancel -// Poll_nocancel -// Msgsnd_nocancel -// Msgrcv_nocancel -// Sem_wait_nocancel -// Aio_suspend_nocancel -// __sigwait_nocancel -// __semwait_signal_nocancel -// __mac_mount -// __mac_get_mount -// __mac_getfsstat diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go index b8da5100..3967bca7 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && freebsd -// +build 386,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go index 47155c48..eff19ada 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && freebsd -// +build amd64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go index 08932093..4f24b517 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && freebsd -// +build arm,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go index d151a0d0..ac30759e 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && freebsd -// +build arm64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go index d5cd64b3..aab725ca 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build riscv64 && freebsd -// +build riscv64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_hurd.go b/vendor/golang.org/x/sys/unix/syscall_hurd.go index 381fd467..ba46651f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_hurd.go +++ b/vendor/golang.org/x/sys/unix/syscall_hurd.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build hurd -// +build hurd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_hurd_386.go b/vendor/golang.org/x/sys/unix/syscall_hurd_386.go index 7cf54a3e..df89f9e6 100644 --- a/vendor/golang.org/x/sys/unix/syscall_hurd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_hurd_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && hurd -// +build 386,hurd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_illumos.go b/vendor/golang.org/x/sys/unix/syscall_illumos.go index 87db5a6a..a863f705 100644 --- a/vendor/golang.org/x/sys/unix/syscall_illumos.go +++ b/vendor/golang.org/x/sys/unix/syscall_illumos.go @@ -5,7 +5,6 @@ // illumos system calls not present on Solaris. //go:build amd64 && illumos -// +build amd64,illumos package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index fbaeb5ff..0f85e29e 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -61,15 +61,23 @@ func FanotifyMark(fd int, flags uint, mask uint64, dirFd int, pathname string) ( } //sys fchmodat(dirfd int, path string, mode uint32) (err error) - -func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { - // Linux fchmodat doesn't support the flags parameter. Mimick glibc's behavior - // and check the flags. Otherwise the mode would be applied to the symlink - // destination which is not what the user expects. - if flags&^AT_SYMLINK_NOFOLLOW != 0 { - return EINVAL - } else if flags&AT_SYMLINK_NOFOLLOW != 0 { - return EOPNOTSUPP +//sys fchmodat2(dirfd int, path string, mode uint32, flags int) (err error) + +func Fchmodat(dirfd int, path string, mode uint32, flags int) error { + // Linux fchmodat doesn't support the flags parameter, but fchmodat2 does. + // Try fchmodat2 if flags are specified. + if flags != 0 { + err := fchmodat2(dirfd, path, mode, flags) + if err == ENOSYS { + // fchmodat2 isn't available. If the flags are known to be valid, + // return EOPNOTSUPP to indicate that fchmodat doesn't support them. + if flags&^(AT_SYMLINK_NOFOLLOW|AT_EMPTY_PATH) != 0 { + return EINVAL + } else if flags&(AT_SYMLINK_NOFOLLOW|AT_EMPTY_PATH) != 0 { + return EOPNOTSUPP + } + } + return err } return fchmodat(dirfd, path, mode) } @@ -417,7 +425,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, _Socklen, error) { if n > 0 { sl += _Socklen(n) + 1 } - if sa.raw.Path[0] == '@' { + if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) { + // Check sl > 3 so we don't change unnamed socket behavior. sa.raw.Path[0] = 0 // Don't count trailing NUL for abstract address. sl-- @@ -693,10 +702,10 @@ type SockaddrALG struct { func (sa *SockaddrALG) sockaddr() (unsafe.Pointer, _Socklen, error) { // Leave room for NUL byte terminator. - if len(sa.Type) > 13 { + if len(sa.Type) > len(sa.raw.Type)-1 { return nil, 0, EINVAL } - if len(sa.Name) > 63 { + if len(sa.Name) > len(sa.raw.Name)-1 { return nil, 0, EINVAL } @@ -704,17 +713,8 @@ func (sa *SockaddrALG) sockaddr() (unsafe.Pointer, _Socklen, error) { sa.raw.Feat = sa.Feature sa.raw.Mask = sa.Mask - typ, err := ByteSliceFromString(sa.Type) - if err != nil { - return nil, 0, err - } - name, err := ByteSliceFromString(sa.Name) - if err != nil { - return nil, 0, err - } - - copy(sa.raw.Type[:], typ) - copy(sa.raw.Name[:], name) + copy(sa.raw.Type[:], sa.Type) + copy(sa.raw.Name[:], sa.Name) return unsafe.Pointer(&sa.raw), SizeofSockaddrALG, nil } @@ -1310,7 +1310,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { return "", err } } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } func GetsockoptTpacketStats(fd, level, opt int) (*TpacketStats, error) { @@ -1699,12 +1699,23 @@ func PtracePokeUser(pid int, addr uintptr, data []byte) (count int, err error) { return ptracePoke(PTRACE_POKEUSR, PTRACE_PEEKUSR, pid, addr, data) } +// elfNT_PRSTATUS is a copy of the debug/elf.NT_PRSTATUS constant so +// x/sys/unix doesn't need to depend on debug/elf and thus +// compress/zlib, debug/dwarf, and other packages. +const elfNT_PRSTATUS = 1 + func PtraceGetRegs(pid int, regsout *PtraceRegs) (err error) { - return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regsout)) + iov.SetLen(int(unsafe.Sizeof(*regsout))) + return ptracePtr(PTRACE_GETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetRegs(pid int, regs *PtraceRegs) (err error) { - return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regs)) + iov.SetLen(int(unsafe.Sizeof(*regs))) + return ptracePtr(PTRACE_SETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetOptions(pid int, options int) (err error) { @@ -1874,7 +1885,7 @@ func Getpgrp() (pid int) { //sys PerfEventOpen(attr *PerfEventAttr, pid int, cpu int, groupFd int, flags int) (fd int, err error) //sys PivotRoot(newroot string, putold string) (err error) = SYS_PIVOT_ROOT //sys Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) -//sys Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) = SYS_PSELECT6 +//sys pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) //sys read(fd int, p []byte) (n int, err error) //sys Removexattr(path string, attr string) (err error) //sys Renameat2(olddirfd int, oldpath string, newdirfd int, newpath string, flags uint) (err error) @@ -1977,8 +1988,6 @@ func Signalfd(fd int, sigmask *Sigset_t, flags int) (newfd int, err error) { //sys Unshare(flags int) (err error) //sys write(fd int, p []byte) (n int, err error) //sys exitThread(code int) (err error) = SYS_EXIT -//sys readlen(fd int, p *byte, np int) (n int, err error) = SYS_READ -//sys writelen(fd int, p *byte, np int) (n int, err error) = SYS_WRITE //sys readv(fd int, iovs []Iovec) (n int, err error) = SYS_READV //sys writev(fd int, iovs []Iovec) (n int, err error) = SYS_WRITEV //sys preadv(fd int, iovs []Iovec, offs_l uintptr, offs_h uintptr) (n int, err error) = SYS_PREADV @@ -2113,21 +2122,7 @@ func writevRacedetect(iovecs []Iovec, n int) { // mmap varies by architecture; see syscall_linux_*.go. //sys munmap(addr uintptr, length uintptr) (err error) - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - +//sys mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) @@ -2136,6 +2131,12 @@ func Munmap(b []byte) (err error) { //sys Munlock(b []byte) (err error) //sys Munlockall() (err error) +const ( + mremapFixed = MREMAP_FIXED + mremapDontunmap = MREMAP_DONTUNMAP + mremapMaymove = MREMAP_MAYMOVE +) + // Vmsplice splices user pages from a slice of Iovecs into a pipe specified by fd, // using the specified flags. func Vmsplice(fd int, iovs []Iovec, flags int) (int, error) { @@ -2420,99 +2421,75 @@ func PthreadSigmask(how int, set, oldset *Sigset_t) error { return rtSigprocmask(how, set, oldset, _C__NSIG/8) } -/* - * Unimplemented - */ -// AfsSyscall -// ArchPrctl -// Brk -// ClockNanosleep -// ClockSettime -// Clone -// EpollCtlOld -// EpollPwait -// EpollWaitOld -// Execve -// Fork -// Futex -// GetKernelSyms -// GetMempolicy -// GetRobustList -// GetThreadArea -// Getpmsg -// IoCancel -// IoDestroy -// IoGetevents -// IoSetup -// IoSubmit -// IoprioGet -// IoprioSet -// KexecLoad -// LookupDcookie -// Mbind -// MigratePages -// Mincore -// ModifyLdt -// Mount -// MovePages -// MqGetsetattr -// MqNotify -// MqOpen -// MqTimedreceive -// MqTimedsend -// MqUnlink -// Mremap -// Msgctl -// Msgget -// Msgrcv -// Msgsnd -// Nfsservctl -// Personality -// Pselect6 -// Ptrace -// Putpmsg -// Quotactl -// Readahead -// Readv -// RemapFilePages -// RestartSyscall -// RtSigaction -// RtSigpending -// RtSigqueueinfo -// RtSigreturn -// RtSigsuspend -// RtSigtimedwait -// SchedGetPriorityMax -// SchedGetPriorityMin -// SchedGetparam -// SchedGetscheduler -// SchedRrGetInterval -// SchedSetparam -// SchedYield -// Security -// Semctl -// Semget -// Semop -// Semtimedop -// SetMempolicy -// SetRobustList -// SetThreadArea -// SetTidAddress -// Sigaltstack -// Swapoff -// Swapon -// Sysfs -// TimerCreate -// TimerDelete -// TimerGetoverrun -// TimerGettime -// TimerSettime -// Tkill (obsolete) -// Tuxcall -// Umount2 -// Uselib -// Utimensat -// Vfork -// Vhangup -// Vserver -// _Sysctl +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) +} + +// Pselect is a wrapper around the Linux pselect6 system call. +// This version does not modify the timeout argument. +func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { + // Per https://man7.org/linux/man-pages/man2/select.2.html#NOTES, + // The Linux pselect6() system call modifies its timeout argument. + // [Not modifying the argument] is the behavior required by POSIX.1-2001. + var mutableTimeout *Timespec + if timeout != nil { + mutableTimeout = new(Timespec) + *mutableTimeout = *timeout + } + + // The final argument of the pselect6() system call is not a + // sigset_t * pointer, but is instead a structure + var kernelMask *sigset_argpack + if sigmask != nil { + wordBits := 32 << (^uintptr(0) >> 63) // see math.intSize + + // A sigset stores one bit per signal, + // offset by 1 (because signal 0 does not exist). + // So the number of words needed is ⌈__C_NSIG - 1 / wordBits⌉. + sigsetWords := (_C__NSIG - 1 + wordBits - 1) / (wordBits) + + sigsetBytes := uintptr(sigsetWords * (wordBits / 8)) + kernelMask = &sigset_argpack{ + ss: sigmask, + ssLen: sigsetBytes, + } + } + + return pselect6(nfd, r, w, e, mutableTimeout, kernelMask) +} + +//sys schedSetattr(pid int, attr *SchedAttr, flags uint) (err error) +//sys schedGetattr(pid int, attr *SchedAttr, size uint, flags uint) (err error) + +// SchedSetAttr is a wrapper for sched_setattr(2) syscall. +// https://man7.org/linux/man-pages/man2/sched_setattr.2.html +func SchedSetAttr(pid int, attr *SchedAttr, flags uint) error { + if attr == nil { + return EINVAL + } + attr.Size = SizeofSchedAttr + return schedSetattr(pid, attr, flags) +} + +// SchedGetAttr is a wrapper for sched_getattr(2) syscall. +// https://man7.org/linux/man-pages/man2/sched_getattr.2.html +func SchedGetAttr(pid int, flags uint) (*SchedAttr, error) { + attr := &SchedAttr{} + if err := schedGetattr(pid, attr, SizeofSchedAttr, flags); err != nil { + return nil, err + } + return attr, nil +} + +//sys Cachestat(fd uint, crange *CachestatRange, cstat *Cachestat_t, flags uint) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_386.go index c7d9945e..506dafa7 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && linux -// +build 386,linux package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go b/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go index 08086ac6..38d55641 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (386 || amd64 || mips || mipsle || mips64 || mipsle || ppc64 || ppc64le || ppc || s390x || sparc64) -// +build linux -// +build 386 amd64 mips mipsle mips64 mipsle ppc64 ppc64le ppc s390x sparc64 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go index 5b21fcfd..d557cf8d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && linux -// +build amd64,linux package unix @@ -40,7 +39,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go b/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go index 8b0f0f3a..facdb83b 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && linux && gc -// +build amd64,linux,gc package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go index da298641..cd2dd797 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && linux -// +build arm,linux package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go index a81f5742..cf2ee6c7 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && linux -// +build arm64,linux package unix @@ -33,7 +32,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gc.go b/vendor/golang.org/x/sys/unix/syscall_linux_gc.go index 2b1168d7..ffc4c2b6 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gc.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && gc -// +build linux,gc package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go index 9843fb48..9ebfdcf4 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && gc && 386 -// +build linux,gc,386 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go index a6008fcc..5f2b57c4 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && gc && linux -// +build arm,gc,linux package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go index 7740af24..d1a3ad82 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && gccgo && 386 -// +build linux,gccgo,386 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go index e16a1229..f2f67423 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && gccgo && arm -// +build linux,gccgo,arm package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go index 69d2d7c3..3d0e9845 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build loong64 && linux -// +build loong64,linux package unix @@ -28,7 +27,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go index 76d56409..70963a95 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (mips64 || mips64le) -// +build linux -// +build mips64 mips64le package unix @@ -31,7 +29,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go index aae7f0ff..c218ebd2 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (mips || mipsle) -// +build linux -// +build mips mipsle package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go index 66eff19a..e6c48500 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && ppc -// +build linux,ppc package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go index 806aa257..7286a9aa 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (ppc64 || ppc64le) -// +build linux -// +build ppc64 ppc64le package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go index 35851ef7..6f5a2889 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build riscv64 && linux -// +build riscv64,linux package unix @@ -32,7 +31,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) @@ -177,3 +176,14 @@ func KexecFileLoad(kernelFd int, initrdFd int, cmdline string, flags int) error } return kexecFileLoad(kernelFd, initrdFd, cmdlineLen, cmdline, flags) } + +//sys riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) + +func RISCVHWProbe(pairs []RISCVHWProbePairs, set *CPUSet, flags uint) (err error) { + var setSize uintptr + + if set != nil { + setSize = uintptr(unsafe.Sizeof(*set)) + } + return riscvHWProbe(pairs, setSize, set, flags) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go index 2f89e8f5..66f31210 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build s390x && linux -// +build s390x,linux package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go index 7ca064ae..11d1f169 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build sparc64 && linux -// +build sparc64,linux package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd.go b/vendor/golang.org/x/sys/unix/syscall_netbsd.go index 018d7d47..88162099 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd.go @@ -356,266 +356,16 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) -/* - * Unimplemented - */ -// ____semctl13 -// __clone -// __fhopen40 -// __fhstat40 -// __fhstatvfs140 -// __fstat30 -// __getcwd -// __getfh30 -// __getlogin -// __lstat30 -// __mount50 -// __msgctl13 -// __msync13 -// __ntp_gettime30 -// __posix_chown -// __posix_fchown -// __posix_lchown -// __posix_rename -// __setlogin -// __shmctl13 -// __sigaction_sigtramp -// __sigaltstack14 -// __sigpending14 -// __sigprocmask14 -// __sigsuspend14 -// __sigtimedwait -// __stat30 -// __syscall -// __vfork14 -// _ksem_close -// _ksem_destroy -// _ksem_getvalue -// _ksem_init -// _ksem_open -// _ksem_post -// _ksem_trywait -// _ksem_unlink -// _ksem_wait -// _lwp_continue -// _lwp_create -// _lwp_ctl -// _lwp_detach -// _lwp_exit -// _lwp_getname -// _lwp_getprivate -// _lwp_kill -// _lwp_park -// _lwp_self -// _lwp_setname -// _lwp_setprivate -// _lwp_suspend -// _lwp_unpark -// _lwp_unpark_all -// _lwp_wait -// _lwp_wakeup -// _pset_bind -// _sched_getaffinity -// _sched_getparam -// _sched_setaffinity -// _sched_setparam -// acct -// aio_cancel -// aio_error -// aio_fsync -// aio_read -// aio_return -// aio_suspend -// aio_write -// break -// clock_getres -// clock_gettime -// clock_settime -// compat_09_ogetdomainname -// compat_09_osetdomainname -// compat_09_ouname -// compat_10_omsgsys -// compat_10_osemsys -// compat_10_oshmsys -// compat_12_fstat12 -// compat_12_getdirentries -// compat_12_lstat12 -// compat_12_msync -// compat_12_oreboot -// compat_12_oswapon -// compat_12_stat12 -// compat_13_sigaction13 -// compat_13_sigaltstack13 -// compat_13_sigpending13 -// compat_13_sigprocmask13 -// compat_13_sigreturn13 -// compat_13_sigsuspend13 -// compat_14___semctl -// compat_14_msgctl -// compat_14_shmctl -// compat_16___sigaction14 -// compat_16___sigreturn14 -// compat_20_fhstatfs -// compat_20_fstatfs -// compat_20_getfsstat -// compat_20_statfs -// compat_30___fhstat30 -// compat_30___fstat13 -// compat_30___lstat13 -// compat_30___stat13 -// compat_30_fhopen -// compat_30_fhstat -// compat_30_fhstatvfs1 -// compat_30_getdents -// compat_30_getfh -// compat_30_ntp_gettime -// compat_30_socket -// compat_40_mount -// compat_43_fstat43 -// compat_43_lstat43 -// compat_43_oaccept -// compat_43_ocreat -// compat_43_oftruncate -// compat_43_ogetdirentries -// compat_43_ogetdtablesize -// compat_43_ogethostid -// compat_43_ogethostname -// compat_43_ogetkerninfo -// compat_43_ogetpagesize -// compat_43_ogetpeername -// compat_43_ogetrlimit -// compat_43_ogetsockname -// compat_43_okillpg -// compat_43_olseek -// compat_43_ommap -// compat_43_oquota -// compat_43_orecv -// compat_43_orecvfrom -// compat_43_orecvmsg -// compat_43_osend -// compat_43_osendmsg -// compat_43_osethostid -// compat_43_osethostname -// compat_43_osigblock -// compat_43_osigsetmask -// compat_43_osigstack -// compat_43_osigvec -// compat_43_otruncate -// compat_43_owait -// compat_43_stat43 -// execve -// extattr_delete_fd -// extattr_delete_file -// extattr_delete_link -// extattr_get_fd -// extattr_get_file -// extattr_get_link -// extattr_list_fd -// extattr_list_file -// extattr_list_link -// extattr_set_fd -// extattr_set_file -// extattr_set_link -// extattrctl -// fchroot -// fdatasync -// fgetxattr -// fktrace -// flistxattr -// fork -// fremovexattr -// fsetxattr -// fstatvfs1 -// fsync_range -// getcontext -// getitimer -// getvfsstat -// getxattr -// ktrace -// lchflags -// lchmod -// lfs_bmapv -// lfs_markv -// lfs_segclean -// lfs_segwait -// lgetxattr -// lio_listio -// listxattr -// llistxattr -// lremovexattr -// lseek -// lsetxattr -// lutimes -// madvise -// mincore -// minherit -// modctl -// mq_close -// mq_getattr -// mq_notify -// mq_open -// mq_receive -// mq_send -// mq_setattr -// mq_timedreceive -// mq_timedsend -// mq_unlink -// mremap -// msgget -// msgrcv -// msgsnd -// nfssvc -// ntp_adjtime -// pmc_control -// pmc_get_info -// pollts -// preadv -// profil -// pselect -// pset_assign -// pset_create -// pset_destroy -// ptrace -// pwritev -// quotactl -// rasctl -// readv -// reboot -// removexattr -// sa_enable -// sa_preempt -// sa_register -// sa_setconcurrency -// sa_stacks -// sa_yield -// sbrk -// sched_yield -// semconfig -// semget -// semop -// setcontext -// setitimer -// setxattr -// shmat -// shmdt -// shmget -// sstk -// statvfs1 -// swapctl -// sysarch -// syscall -// timer_create -// timer_delete -// timer_getoverrun -// timer_gettime -// timer_settime -// undelete -// utrace -// uuidgen -// vadvise -// vfork -// writev +const ( + mremapFixed = MAP_FIXED + mremapDontunmap = 0 + mremapMaymove = 0 +) + +//sys mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) = SYS_MREMAP + +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (uintptr, error) { + return mremapNetBSD(oldaddr, oldlength, newaddr, newlength, flags) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go index 5199d282..7a5eb574 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && netbsd -// +build 386,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go index 70a9c52e..62d8957a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && netbsd -// +build amd64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go index 3eb5942f..ce6a0688 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && netbsd -// +build arm,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go index fc6ccfd8..d46d689d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && netbsd -// +build arm64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd.go b/vendor/golang.org/x/sys/unix/syscall_openbsd.go index f9c7a966..b25343c7 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd.go @@ -137,18 +137,28 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e } func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { - var _p0 unsafe.Pointer + var bufptr *Statfs_t var bufsize uintptr if len(buf) > 0 { - _p0 = unsafe.Pointer(&buf[0]) + bufptr = &buf[0] bufsize = unsafe.Sizeof(Statfs_t{}) * uintptr(len(buf)) } - r0, _, e1 := Syscall(SYS_GETFSSTAT, uintptr(_p0), bufsize, uintptr(flags)) - n = int(r0) - if e1 != 0 { - err = e1 - } - return + return getfsstat(bufptr, bufsize, flags) +} + +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) } //sys ioctl(fd int, req uint, arg uintptr) (err error) @@ -156,6 +166,20 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { //sys sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS___SYSCTL +//sys fcntl(fd int, cmd int, arg int) (n int, err error) +//sys fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) = SYS_FCNTL + +// FcntlInt performs a fcntl syscall on fd with the provided command and argument. +func FcntlInt(fd uintptr, cmd, arg int) (int, error) { + return fcntl(int(fd), cmd, arg) +} + +// FcntlFlock performs a fcntl syscall for the F_GETLK, F_SETLK or F_SETLKW command. +func FcntlFlock(fd uintptr, cmd int, lk *Flock_t) error { + _, err := fcntlPtr(int(fd), cmd, unsafe.Pointer(lk)) + return err +} + //sys ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) func Ppoll(fds []PollFd, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { @@ -311,80 +335,7 @@ func Uname(uname *Utsname) error { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE +//sys getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) - -/* - * Unimplemented - */ -// __getcwd -// __semctl -// __syscall -// __sysctl -// adjfreq -// break -// clock_getres -// clock_gettime -// clock_settime -// closefrom -// execve -// fhopen -// fhstat -// fhstatfs -// fork -// futimens -// getfh -// getgid -// getitimer -// getlogin -// getresgid -// getresuid -// getthrid -// ktrace -// lfs_bmapv -// lfs_markv -// lfs_segclean -// lfs_segwait -// mincore -// minherit -// mount -// mquery -// msgctl -// msgget -// msgrcv -// msgsnd -// nfssvc -// nnpfspioctl -// preadv -// profil -// pwritev -// quotactl -// readv -// reboot -// renameat -// rfork -// sched_yield -// semget -// semop -// setgroups -// setitimer -// setsockopt -// shmat -// shmctl -// shmdt -// shmget -// sigaction -// sigaltstack -// sigpending -// sigprocmask -// sigreturn -// sigsuspend -// sysarch -// syscall -// threxit -// thrsigdivert -// thrsleep -// thrwakeup -// vfork -// writev +//sys pledge(promises *byte, execpromises *byte) (err error) +//sys unveil(path *byte, flags *byte) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go index 6baabcdc..9ddc89f4 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && openbsd -// +build 386,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go index bab25360..70a3c96e 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && openbsd -// +build amd64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go index 8eed3c4d..265caa87 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && openbsd -// +build arm,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go index 483dde99..ac4fda17 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && openbsd -// +build arm64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go index 04aa43f4..0a451e6d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build openbsd -// +build openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go index c2796139..30a308cb 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build ppc64 && openbsd -// +build ppc64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go index 23199a7f..ea954330 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build riscv64 && openbsd -// +build riscv64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris.go b/vendor/golang.org/x/sys/unix/syscall_solaris.go index b600a289..21974af0 100644 --- a/vendor/golang.org/x/sys/unix/syscall_solaris.go +++ b/vendor/golang.org/x/sys/unix/syscall_solaris.go @@ -128,7 +128,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, _Socklen, error) { if n > 0 { sl += _Socklen(n) + 1 } - if sa.raw.Path[0] == '@' { + if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) { + // Check sl > 3 so we don't change unnamed socket behavior. sa.raw.Path[0] = 0 // Don't count trailing NUL for abstract address. sl-- @@ -157,7 +158,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { if err != nil { return "", err } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } const ImplementsGetwd = true @@ -698,38 +699,6 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) = libsocket.setsockopt //sys recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) = libsocket.recvfrom -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procread)), 3, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf), 0, 0, 0) - n = int(r0) - if e1 != 0 { - err = e1 - } - return -} - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwrite)), 3, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf), 0, 0, 0) - n = int(r0) - if e1 != 0 { - err = e1 - } - return -} - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - // Event Ports type fileObjCookie struct { diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go b/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go index 0bd25ef8..e02d8cea 100644 --- a/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && solaris -// +build amd64,solaris package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_unix.go b/vendor/golang.org/x/sys/unix/syscall_unix.go index 8e48c29e..77081de8 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris package unix @@ -147,6 +146,14 @@ func (m *mmapper) Munmap(data []byte) (err error) { return nil } +func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { + return mapper.Mmap(fd, offset, length, prot, flags) +} + +func Munmap(b []byte) (err error) { + return mapper.Munmap(b) +} + func Read(fd int, p []byte) (n int, err error) { n, err = read(fd, p) if raceenabled { @@ -541,6 +548,9 @@ func SetNonblock(fd int, nonblocking bool) (err error) { if err != nil { return err } + if (flag&O_NONBLOCK != 0) == nonblocking { + return nil + } if nonblocking { flag |= O_NONBLOCK } else { diff --git a/vendor/golang.org/x/sys/unix/syscall_unix_gc.go b/vendor/golang.org/x/sys/unix/syscall_unix_gc.go index b6919ca5..05c95bcc 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix_gc.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix_gc.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || dragonfly || freebsd || (linux && !ppc64 && !ppc64le) || netbsd || openbsd || solaris) && gc -// +build darwin dragonfly freebsd linux,!ppc64,!ppc64le netbsd openbsd solaris -// +build gc package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go b/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go index f6f707ac..23f39b7a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (ppc64le || ppc64) && gc -// +build linux -// +build ppc64le ppc64 -// +build gc package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go index d3d49ec3..b473038c 100644 --- a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix @@ -192,7 +191,6 @@ func (cmsg *Cmsghdr) SetLen(length int) { //sys fcntl(fd int, cmd int, arg int) (val int, err error) //sys read(fd int, p []byte) (n int, err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ //sys write(fd int, p []byte) (n int, err error) //sys accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) = SYS___ACCEPT_A @@ -285,25 +283,11 @@ func Close(fd int) (err error) { return } -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - // Dummy function: there are no semantics for Madvise on z/OS func Madvise(b []byte, advice int) (err error) { return } -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Gethostname(buf []byte) (err error) = SYS___GETHOSTNAME_A //sysnb Getegid() (egid int) //sysnb Geteuid() (uid int) @@ -1120,7 +1104,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { return "", err } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) { diff --git a/vendor/golang.org/x/sys/unix/sysvshm_linux.go b/vendor/golang.org/x/sys/unix/sysvshm_linux.go index 2c3a4437..4fcd38de 100644 --- a/vendor/golang.org/x/sys/unix/sysvshm_linux.go +++ b/vendor/golang.org/x/sys/unix/sysvshm_linux.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux -// +build linux package unix diff --git a/vendor/golang.org/x/sys/unix/sysvshm_unix.go b/vendor/golang.org/x/sys/unix/sysvshm_unix.go index 5bb41d17..79a84f18 100644 --- a/vendor/golang.org/x/sys/unix/sysvshm_unix.go +++ b/vendor/golang.org/x/sys/unix/sysvshm_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin && !ios) || linux -// +build darwin,!ios linux package unix diff --git a/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go b/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go index 71bddefd..9eb0db66 100644 --- a/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go +++ b/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin && !ios -// +build darwin,!ios package unix diff --git a/vendor/golang.org/x/sys/unix/timestruct.go b/vendor/golang.org/x/sys/unix/timestruct.go index 616b1b28..7997b190 100644 --- a/vendor/golang.org/x/sys/unix/timestruct.go +++ b/vendor/golang.org/x/sys/unix/timestruct.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/unveil_openbsd.go b/vendor/golang.org/x/sys/unix/unveil_openbsd.go index 168d5ae7..cb7e598c 100644 --- a/vendor/golang.org/x/sys/unix/unveil_openbsd.go +++ b/vendor/golang.org/x/sys/unix/unveil_openbsd.go @@ -4,39 +4,48 @@ package unix -import ( - "syscall" - "unsafe" -) +import "fmt" // Unveil implements the unveil syscall. // For more information see unveil(2). // Note that the special case of blocking further // unveil calls is handled by UnveilBlock. func Unveil(path string, flags string) error { - pathPtr, err := syscall.BytePtrFromString(path) - if err != nil { + if err := supportsUnveil(); err != nil { return err } - flagsPtr, err := syscall.BytePtrFromString(flags) + pathPtr, err := BytePtrFromString(path) if err != nil { return err } - _, _, e := syscall.Syscall(SYS_UNVEIL, uintptr(unsafe.Pointer(pathPtr)), uintptr(unsafe.Pointer(flagsPtr)), 0) - if e != 0 { - return e + flagsPtr, err := BytePtrFromString(flags) + if err != nil { + return err } - return nil + return unveil(pathPtr, flagsPtr) } // UnveilBlock blocks future unveil calls. // For more information see unveil(2). func UnveilBlock() error { - // Both pointers must be nil. - var pathUnsafe, flagsUnsafe unsafe.Pointer - _, _, e := syscall.Syscall(SYS_UNVEIL, uintptr(pathUnsafe), uintptr(flagsUnsafe), 0) - if e != 0 { - return e + if err := supportsUnveil(); err != nil { + return err } + return unveil(nil, nil) +} + +// supportsUnveil checks for availability of the unveil(2) system call based +// on the running OpenBSD version. +func supportsUnveil() error { + maj, min, err := majmin() + if err != nil { + return err + } + + // unveil is not available before 6.4 + if maj < 6 || (maj == 6 && min <= 3) { + return fmt.Errorf("cannot call Unveil on OpenBSD %d.%d", maj, min) + } + return nil } diff --git a/vendor/golang.org/x/sys/unix/xattr_bsd.go b/vendor/golang.org/x/sys/unix/xattr_bsd.go index f5f8e9f3..e1687939 100644 --- a/vendor/golang.org/x/sys/unix/xattr_bsd.go +++ b/vendor/golang.org/x/sys/unix/xattr_bsd.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build freebsd || netbsd -// +build freebsd netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go index ca9799b7..2fb219d7 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && aix -// +build ppc,aix // Created by cgo -godefs - DO NOT EDIT // cgo -godefs -- -maix32 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go index 200c8c26..b0e6f5c8 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && aix -// +build ppc64,aix // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -maix64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go index 14300762..e40fa852 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && darwin -// +build amd64,darwin // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go index ab044a74..bb02aa6c 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && darwin -// +build arm64,darwin // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go index 17bba0e4..c0e0f869 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && dragonfly -// +build amd64,dragonfly // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go index f8c2c513..6c692390 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && freebsd -// +build 386,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m32 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go index 96310c3b..dd9163f8 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && freebsd -// +build amd64,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go index 777b69de..493a2a79 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && freebsd -// +build arm,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go index c557ac2d..8b437b30 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && freebsd -// +build arm64,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go index 341b4d96..67c02dd5 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && freebsd -// +build riscv64,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go index de936b67..a5d3ff8d 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -1,7 +1,6 @@ // Code generated by mkmerge; DO NOT EDIT. //go:build linux -// +build linux package unix @@ -481,10 +480,13 @@ const ( BPF_FROM_BE = 0x8 BPF_FROM_LE = 0x0 BPF_FS_MAGIC = 0xcafe4a11 + BPF_F_AFTER = 0x10 BPF_F_ALLOW_MULTI = 0x2 BPF_F_ALLOW_OVERRIDE = 0x1 BPF_F_ANY_ALIGNMENT = 0x2 - BPF_F_KPROBE_MULTI_RETURN = 0x1 + BPF_F_BEFORE = 0x8 + BPF_F_ID = 0x20 + BPF_F_NETFILTER_IP_DEFRAG = 0x1 BPF_F_QUERY_EFFECTIVE = 0x1 BPF_F_REPLACE = 0x4 BPF_F_SLEEPABLE = 0x10 @@ -493,6 +495,7 @@ const ( BPF_F_TEST_RUN_ON_CPU = 0x1 BPF_F_TEST_STATE_FREQ = 0x8 BPF_F_TEST_XDP_LIVE_FRAMES = 0x2 + BPF_F_XDP_DEV_BOUND_ONLY = 0x40 BPF_F_XDP_HAS_FRAGS = 0x20 BPF_H = 0x8 BPF_IMM = 0x0 @@ -520,6 +523,7 @@ const ( BPF_MAJOR_VERSION = 0x1 BPF_MAXINSNS = 0x1000 BPF_MEM = 0x60 + BPF_MEMSX = 0x80 BPF_MEMWORDS = 0x10 BPF_MINOR_VERSION = 0x1 BPF_MISC = 0x7 @@ -775,6 +779,8 @@ const ( DEVLINK_GENL_MCGRP_CONFIG_NAME = "config" DEVLINK_GENL_NAME = "devlink" DEVLINK_GENL_VERSION = 0x1 + DEVLINK_PORT_FN_CAP_IPSEC_CRYPTO = 0x4 + DEVLINK_PORT_FN_CAP_IPSEC_PACKET = 0x8 DEVLINK_PORT_FN_CAP_MIGRATABLE = 0x2 DEVLINK_PORT_FN_CAP_ROCE = 0x1 DEVLINK_SB_THRESHOLD_TO_ALPHA_MAX = 0x14 @@ -826,9 +832,9 @@ const ( DM_UUID_FLAG = 0x4000 DM_UUID_LEN = 0x81 DM_VERSION = 0xc138fd00 - DM_VERSION_EXTRA = "-ioctl (2022-07-28)" + DM_VERSION_EXTRA = "-ioctl (2023-03-01)" DM_VERSION_MAJOR = 0x4 - DM_VERSION_MINOR = 0x2f + DM_VERSION_MINOR = 0x30 DM_VERSION_PATCHLEVEL = 0x0 DT_BLK = 0x6 DT_CHR = 0x2 @@ -1197,6 +1203,7 @@ const ( FAN_EVENT_METADATA_LEN = 0x18 FAN_EVENT_ON_CHILD = 0x8000000 FAN_FS_ERROR = 0x8000 + FAN_INFO = 0x20 FAN_MARK_ADD = 0x1 FAN_MARK_DONT_FOLLOW = 0x4 FAN_MARK_EVICTABLE = 0x200 @@ -1233,6 +1240,8 @@ const ( FAN_REPORT_PIDFD = 0x80 FAN_REPORT_TARGET_FID = 0x1000 FAN_REPORT_TID = 0x100 + FAN_RESPONSE_INFO_AUDIT_RULE = 0x1 + FAN_RESPONSE_INFO_NONE = 0x0 FAN_UNLIMITED_MARKS = 0x20 FAN_UNLIMITED_QUEUE = 0x10 FD_CLOEXEC = 0x1 @@ -1694,6 +1703,7 @@ const ( KEXEC_ON_CRASH = 0x1 KEXEC_PRESERVE_CONTEXT = 0x2 KEXEC_SEGMENT_MAX = 0x10 + KEXEC_UPDATE_ELFCOREHDR = 0x4 KEYCTL_ASSUME_AUTHORITY = 0x10 KEYCTL_CAPABILITIES = 0x1f KEYCTL_CAPS0_BIG_KEY = 0x10 @@ -1791,6 +1801,7 @@ const ( LOCK_SH = 0x1 LOCK_UN = 0x8 LOOP_CLR_FD = 0x4c01 + LOOP_CONFIGURE = 0x4c0a LOOP_CTL_ADD = 0x4c80 LOOP_CTL_GET_FREE = 0x4c82 LOOP_CTL_REMOVE = 0x4c81 @@ -1860,6 +1871,7 @@ const ( MEMWRITEOOB64 = 0xc0184d15 MFD_ALLOW_SEALING = 0x2 MFD_CLOEXEC = 0x1 + MFD_EXEC = 0x10 MFD_HUGETLB = 0x4 MFD_HUGE_16GB = 0x88000000 MFD_HUGE_16MB = 0x60000000 @@ -1875,6 +1887,7 @@ const ( MFD_HUGE_8MB = 0x5c000000 MFD_HUGE_MASK = 0x3f MFD_HUGE_SHIFT = 0x1a + MFD_NOEXEC_SEAL = 0x8 MINIX2_SUPER_MAGIC = 0x2468 MINIX2_SUPER_MAGIC2 = 0x2478 MINIX3_SUPER_MAGIC = 0x4d5a @@ -1898,6 +1911,9 @@ const ( MOUNT_ATTR_SIZE_VER0 = 0x20 MOUNT_ATTR_STRICTATIME = 0x20 MOUNT_ATTR__ATIME = 0x70 + MREMAP_DONTUNMAP = 0x4 + MREMAP_FIXED = 0x2 + MREMAP_MAYMOVE = 0x1 MSDOS_SUPER_MAGIC = 0x4d44 MSG_BATCH = 0x40000 MSG_CMSG_CLOEXEC = 0x40000000 @@ -2111,6 +2127,60 @@ const ( NFNL_SUBSYS_QUEUE = 0x3 NFNL_SUBSYS_ULOG = 0x4 NFS_SUPER_MAGIC = 0x6969 + NFT_CHAIN_FLAGS = 0x7 + NFT_CHAIN_MAXNAMELEN = 0x100 + NFT_CT_MAX = 0x17 + NFT_DATA_RESERVED_MASK = 0xffffff00 + NFT_DATA_VALUE_MAXLEN = 0x40 + NFT_EXTHDR_OP_MAX = 0x4 + NFT_FIB_RESULT_MAX = 0x3 + NFT_INNER_MASK = 0xf + NFT_LOGLEVEL_MAX = 0x8 + NFT_NAME_MAXLEN = 0x100 + NFT_NG_MAX = 0x1 + NFT_OBJECT_CONNLIMIT = 0x5 + NFT_OBJECT_COUNTER = 0x1 + NFT_OBJECT_CT_EXPECT = 0x9 + NFT_OBJECT_CT_HELPER = 0x3 + NFT_OBJECT_CT_TIMEOUT = 0x7 + NFT_OBJECT_LIMIT = 0x4 + NFT_OBJECT_MAX = 0xa + NFT_OBJECT_QUOTA = 0x2 + NFT_OBJECT_SECMARK = 0x8 + NFT_OBJECT_SYNPROXY = 0xa + NFT_OBJECT_TUNNEL = 0x6 + NFT_OBJECT_UNSPEC = 0x0 + NFT_OBJ_MAXNAMELEN = 0x100 + NFT_OSF_MAXGENRELEN = 0x10 + NFT_QUEUE_FLAG_BYPASS = 0x1 + NFT_QUEUE_FLAG_CPU_FANOUT = 0x2 + NFT_QUEUE_FLAG_MASK = 0x3 + NFT_REG32_COUNT = 0x10 + NFT_REG32_SIZE = 0x4 + NFT_REG_MAX = 0x4 + NFT_REG_SIZE = 0x10 + NFT_REJECT_ICMPX_MAX = 0x3 + NFT_RT_MAX = 0x4 + NFT_SECMARK_CTX_MAXLEN = 0x100 + NFT_SET_MAXNAMELEN = 0x100 + NFT_SOCKET_MAX = 0x3 + NFT_TABLE_F_MASK = 0x3 + NFT_TABLE_MAXNAMELEN = 0x100 + NFT_TRACETYPE_MAX = 0x3 + NFT_TUNNEL_F_MASK = 0x7 + NFT_TUNNEL_MAX = 0x1 + NFT_TUNNEL_MODE_MAX = 0x2 + NFT_USERDATA_MAXLEN = 0x100 + NFT_XFRM_KEY_MAX = 0x6 + NF_NAT_RANGE_MAP_IPS = 0x1 + NF_NAT_RANGE_MASK = 0x7f + NF_NAT_RANGE_NETMAP = 0x40 + NF_NAT_RANGE_PERSISTENT = 0x8 + NF_NAT_RANGE_PROTO_OFFSET = 0x20 + NF_NAT_RANGE_PROTO_RANDOM = 0x4 + NF_NAT_RANGE_PROTO_RANDOM_ALL = 0x14 + NF_NAT_RANGE_PROTO_RANDOM_FULLY = 0x10 + NF_NAT_RANGE_PROTO_SPECIFIED = 0x2 NILFS_SUPER_MAGIC = 0x3434 NL0 = 0x0 NL1 = 0x100 @@ -2204,6 +2274,7 @@ const ( PACKET_USER = 0x6 PACKET_VERSION = 0xa PACKET_VNET_HDR = 0xf + PACKET_VNET_HDR_SZ = 0x18 PARITY_CRC16_PR0 = 0x2 PARITY_CRC16_PR0_CCITT = 0x4 PARITY_CRC16_PR1 = 0x3 @@ -2221,6 +2292,7 @@ const ( PERF_ATTR_SIZE_VER5 = 0x70 PERF_ATTR_SIZE_VER6 = 0x78 PERF_ATTR_SIZE_VER7 = 0x80 + PERF_ATTR_SIZE_VER8 = 0x88 PERF_AUX_FLAG_COLLISION = 0x8 PERF_AUX_FLAG_CORESIGHT_FORMAT_CORESIGHT = 0x0 PERF_AUX_FLAG_CORESIGHT_FORMAT_RAW = 0x100 @@ -2264,6 +2336,7 @@ const ( PERF_MEM_LVLNUM_PMEM = 0xe PERF_MEM_LVLNUM_RAM = 0xd PERF_MEM_LVLNUM_SHIFT = 0x21 + PERF_MEM_LVLNUM_UNC = 0x8 PERF_MEM_LVL_HIT = 0x2 PERF_MEM_LVL_IO = 0x1000 PERF_MEM_LVL_L1 = 0x8 @@ -2361,6 +2434,7 @@ const ( PR_FP_EXC_UND = 0x40000 PR_FP_MODE_FR = 0x1 PR_FP_MODE_FRE = 0x2 + PR_GET_AUXV = 0x41555856 PR_GET_CHILD_SUBREAPER = 0x25 PR_GET_DUMPABLE = 0x3 PR_GET_ENDIAN = 0x13 @@ -2369,6 +2443,8 @@ const ( PR_GET_FP_MODE = 0x2e PR_GET_IO_FLUSHER = 0x3a PR_GET_KEEPCAPS = 0x7 + PR_GET_MDWE = 0x42 + PR_GET_MEMORY_MERGE = 0x44 PR_GET_NAME = 0x10 PR_GET_NO_NEW_PRIVS = 0x27 PR_GET_PDEATHSIG = 0x2 @@ -2389,6 +2465,7 @@ const ( PR_MCE_KILL_GET = 0x22 PR_MCE_KILL_LATE = 0x0 PR_MCE_KILL_SET = 0x1 + PR_MDWE_REFUSE_EXEC_GAIN = 0x1 PR_MPX_DISABLE_MANAGEMENT = 0x2c PR_MPX_ENABLE_MANAGEMENT = 0x2b PR_MTE_TAG_MASK = 0x7fff8 @@ -2406,6 +2483,15 @@ const ( PR_PAC_GET_ENABLED_KEYS = 0x3d PR_PAC_RESET_KEYS = 0x36 PR_PAC_SET_ENABLED_KEYS = 0x3c + PR_RISCV_V_GET_CONTROL = 0x46 + PR_RISCV_V_SET_CONTROL = 0x45 + PR_RISCV_V_VSTATE_CTRL_CUR_MASK = 0x3 + PR_RISCV_V_VSTATE_CTRL_DEFAULT = 0x0 + PR_RISCV_V_VSTATE_CTRL_INHERIT = 0x10 + PR_RISCV_V_VSTATE_CTRL_MASK = 0x1f + PR_RISCV_V_VSTATE_CTRL_NEXT_MASK = 0xc + PR_RISCV_V_VSTATE_CTRL_OFF = 0x1 + PR_RISCV_V_VSTATE_CTRL_ON = 0x2 PR_SCHED_CORE = 0x3e PR_SCHED_CORE_CREATE = 0x1 PR_SCHED_CORE_GET = 0x0 @@ -2423,6 +2509,8 @@ const ( PR_SET_FP_MODE = 0x2d PR_SET_IO_FLUSHER = 0x39 PR_SET_KEEPCAPS = 0x8 + PR_SET_MDWE = 0x41 + PR_SET_MEMORY_MERGE = 0x43 PR_SET_MM = 0x23 PR_SET_MM_ARG_END = 0x9 PR_SET_MM_ARG_START = 0x8 @@ -2506,6 +2594,7 @@ const ( PTRACE_GETSIGMASK = 0x420a PTRACE_GET_RSEQ_CONFIGURATION = 0x420f PTRACE_GET_SYSCALL_INFO = 0x420e + PTRACE_GET_SYSCALL_USER_DISPATCH_CONFIG = 0x4211 PTRACE_INTERRUPT = 0x4207 PTRACE_KILL = 0x8 PTRACE_LISTEN = 0x4208 @@ -2536,6 +2625,7 @@ const ( PTRACE_SETREGSET = 0x4205 PTRACE_SETSIGINFO = 0x4203 PTRACE_SETSIGMASK = 0x420b + PTRACE_SET_SYSCALL_USER_DISPATCH_CONFIG = 0x4210 PTRACE_SINGLESTEP = 0x9 PTRACE_SYSCALL = 0x18 PTRACE_SYSCALL_INFO_ENTRY = 0x1 @@ -2802,6 +2892,23 @@ const ( RWF_SUPPORTED = 0x1f RWF_SYNC = 0x4 RWF_WRITE_LIFE_NOT_SET = 0x0 + SCHED_BATCH = 0x3 + SCHED_DEADLINE = 0x6 + SCHED_FIFO = 0x1 + SCHED_FLAG_ALL = 0x7f + SCHED_FLAG_DL_OVERRUN = 0x4 + SCHED_FLAG_KEEP_ALL = 0x18 + SCHED_FLAG_KEEP_PARAMS = 0x10 + SCHED_FLAG_KEEP_POLICY = 0x8 + SCHED_FLAG_RECLAIM = 0x2 + SCHED_FLAG_RESET_ON_FORK = 0x1 + SCHED_FLAG_UTIL_CLAMP = 0x60 + SCHED_FLAG_UTIL_CLAMP_MAX = 0x40 + SCHED_FLAG_UTIL_CLAMP_MIN = 0x20 + SCHED_IDLE = 0x5 + SCHED_NORMAL = 0x0 + SCHED_RESET_ON_FORK = 0x40000000 + SCHED_RR = 0x2 SCM_CREDENTIALS = 0x2 SCM_RIGHTS = 0x1 SCM_TIMESTAMP = 0x1d @@ -3072,7 +3179,7 @@ const ( TASKSTATS_GENL_NAME = "TASKSTATS" TASKSTATS_GENL_VERSION = 0x1 TASKSTATS_TYPE_MAX = 0x6 - TASKSTATS_VERSION = 0xd + TASKSTATS_VERSION = 0xe TCIFLUSH = 0x0 TCIOFF = 0x2 TCIOFLUSH = 0x2 @@ -3238,6 +3345,7 @@ const ( TP_STATUS_COPY = 0x2 TP_STATUS_CSUMNOTREADY = 0x8 TP_STATUS_CSUM_VALID = 0x80 + TP_STATUS_GSO_TCP = 0x100 TP_STATUS_KERNEL = 0x0 TP_STATUS_LOSING = 0x4 TP_STATUS_SENDING = 0x2 @@ -3415,6 +3523,7 @@ const ( XDP_PACKET_HEADROOM = 0x100 XDP_PGOFF_RX_RING = 0x0 XDP_PGOFF_TX_RING = 0x80000000 + XDP_PKT_CONTD = 0x1 XDP_RING_NEED_WAKEUP = 0x1 XDP_RX_RING = 0x2 XDP_SHARED_UMEM = 0x1 @@ -3427,6 +3536,7 @@ const ( XDP_UMEM_REG = 0x4 XDP_UMEM_UNALIGNED_CHUNK_FLAG = 0x1 XDP_USE_NEED_WAKEUP = 0x8 + XDP_USE_SG = 0x10 XDP_ZEROCOPY = 0x4 XENFS_SUPER_MAGIC = 0xabba1974 XFS_SUPER_MAGIC = 0x58465342 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go index a46df0f1..4920821c 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && linux -// +build 386,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/386/include -m32 _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80041270 BLKBSZSET = 0x40041271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80041272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go index 6cd4a3ea..a0c1e411 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && linux -// +build amd64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/amd64/include -m64 _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -318,10 +326,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go index c7ebee24..c6398556 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && linux -// +build arm,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/arm/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80041270 BLKBSZSET = 0x40041271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80041272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -324,10 +332,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go index 9d5352c3..47cc62e2 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && linux -// +build arm64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/arm64/include -fsigned-char _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -314,10 +322,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 @@ -443,6 +453,7 @@ const ( TIOCSWINSZ = 0x5414 TIOCVHANGUP = 0x5437 TOSTOP = 0x100 + TPIDR2_MAGIC = 0x54504902 TUNATTACHFILTER = 0x401054d5 TUNDETACHFILTER = 0x401054d6 TUNGETDEVNETNS = 0x54e3 @@ -515,6 +526,7 @@ const ( XCASE = 0x4 XTABS = 0x1800 ZA_MAGIC = 0x54366345 + ZT_MAGIC = 0x5a544e01 _HIDIOCGRAWNAME = 0x80804804 _HIDIOCGRAWPHYS = 0x80404805 _HIDIOCGRAWUNIQ = 0x80404808 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go index f26a164f..27ac4a09 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build loong64 && linux -// +build loong64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/loong64/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -109,6 +117,9 @@ const ( IUCLC = 0x200 IXOFF = 0x1000 IXON = 0x400 + LASX_CTX_MAGIC = 0x41535801 + LBT_CTX_MAGIC = 0x42540001 + LSX_CTX_MAGIC = 0x53580001 MAP_ANON = 0x20 MAP_ANONYMOUS = 0x20 MAP_DENYWRITE = 0x800 @@ -308,10 +319,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go index 890bc3c9..54694642 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips && linux -// +build mips,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/mips/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go index 549f26ac..3adb81d7 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && linux -// +build mips64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/mips64/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go index e0365e32..2dfe98f0 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64le && linux -// +build mips64le,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/mips64le/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go index fdccce15..f5398f84 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mipsle && linux -// +build mipsle,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/mipsle/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go index b2205c83..c54f152d 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && linux -// +build ppc,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/ppc/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 @@ -372,10 +380,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x14 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x15 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go index 81aa5ad0..76057dc7 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && linux -// +build ppc64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/ppc64/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 @@ -376,10 +384,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x14 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x15 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go index 76807a1f..e0c3725e 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64le && linux -// +build ppc64le,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/ppc64le/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 @@ -376,10 +384,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x14 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x15 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go index d4a5ab9e..18f2813e 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && linux -// +build riscv64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/riscv64/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -219,6 +227,9 @@ const ( PPPIOCUNBRIDGECHAN = 0x7434 PPPIOCXFERUNIT = 0x744e PR_SET_PTRACER_ANY = 0xffffffffffffffff + PTRACE_GETFDPIC = 0x21 + PTRACE_GETFDPIC_EXEC = 0x0 + PTRACE_GETFDPIC_INTERP = 0x1 RLIMIT_AS = 0x9 RLIMIT_MEMLOCK = 0x8 RLIMIT_NOFILE = 0x7 @@ -305,10 +316,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go index 66e65db9..11619d4e 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build s390x && linux -// +build s390x,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/s390x/include -fsigned-char _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -380,10 +388,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go index f6192526..396d994d 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build sparc64 && linux -// +build sparc64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/sparc64/include _const.go @@ -30,22 +29,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -329,6 +337,54 @@ const ( SCM_WIFI_STATUS = 0x25 SFD_CLOEXEC = 0x400000 SFD_NONBLOCK = 0x4000 + SF_FP = 0x38 + SF_I0 = 0x20 + SF_I1 = 0x24 + SF_I2 = 0x28 + SF_I3 = 0x2c + SF_I4 = 0x30 + SF_I5 = 0x34 + SF_L0 = 0x0 + SF_L1 = 0x4 + SF_L2 = 0x8 + SF_L3 = 0xc + SF_L4 = 0x10 + SF_L5 = 0x14 + SF_L6 = 0x18 + SF_L7 = 0x1c + SF_PC = 0x3c + SF_RETP = 0x40 + SF_V9_FP = 0x70 + SF_V9_I0 = 0x40 + SF_V9_I1 = 0x48 + SF_V9_I2 = 0x50 + SF_V9_I3 = 0x58 + SF_V9_I4 = 0x60 + SF_V9_I5 = 0x68 + SF_V9_L0 = 0x0 + SF_V9_L1 = 0x8 + SF_V9_L2 = 0x10 + SF_V9_L3 = 0x18 + SF_V9_L4 = 0x20 + SF_V9_L5 = 0x28 + SF_V9_L6 = 0x30 + SF_V9_L7 = 0x38 + SF_V9_PC = 0x78 + SF_V9_RETP = 0x80 + SF_V9_XARG0 = 0x88 + SF_V9_XARG1 = 0x90 + SF_V9_XARG2 = 0x98 + SF_V9_XARG3 = 0xa0 + SF_V9_XARG4 = 0xa8 + SF_V9_XARG5 = 0xb0 + SF_V9_XXARG = 0xb8 + SF_XARG0 = 0x44 + SF_XARG1 = 0x48 + SF_XARG2 = 0x4c + SF_XARG3 = 0x50 + SF_XARG4 = 0x54 + SF_XARG5 = 0x58 + SF_XXARG = 0x5c SIOCATMARK = 0x8905 SIOCGPGRP = 0x8904 SIOCGSTAMPNS_NEW = 0x40108907 @@ -371,10 +427,12 @@ const ( SO_NOFCS = 0x27 SO_OOBINLINE = 0x100 SO_PASSCRED = 0x2 + SO_PASSPIDFD = 0x55 SO_PASSSEC = 0x1f SO_PEEK_OFF = 0x26 SO_PEERCRED = 0x40 SO_PEERGROUPS = 0x3d + SO_PEERPIDFD = 0x56 SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x48 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go index 72f7420d..130085df 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && netbsd -// +build 386,netbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m32 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go index 8d4eb0c0..84769a1a 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && netbsd -// +build amd64,netbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go index 9eef9749..602ded00 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && netbsd -// +build arm,netbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -marm _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go index 3b62ba19..efc0406e 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && netbsd -// +build arm64,netbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go index af20e474..5a6500f8 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && openbsd -// +build 386,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m32 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go index 6015fcb2..a5aeeb97 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && openbsd -// +build amd64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go index 8d44955e..0e9748a7 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && openbsd -// +build arm,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go index ae16fe75..4f4449ab 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && openbsd -// +build arm64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go index 03d90fe3..76a363f0 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && openbsd -// +build mips64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go index 8e2c51b1..43ca0cdf 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && openbsd -// +build ppc64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go index 13d40303..b1b8bb20 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && openbsd -// +build riscv64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go index 1afee6a0..d2ddd317 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && solaris -// +build amd64,solaris // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go index fc7d0506..4dfd2e05 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x // Hand edited based on zerrors_linux_s390x.go // TODO: auto-generate. diff --git a/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go b/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go index 97f20ca2..586317c7 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go @@ -1,8 +1,6 @@ // Code generated by linux/mkall.go generatePtracePair("arm", "arm64"). DO NOT EDIT. //go:build linux && (arm || arm64) -// +build linux -// +build arm arm64 package unix diff --git a/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go b/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go index 0b5f7943..d7c881be 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go @@ -1,8 +1,6 @@ // Code generated by linux/mkall.go generatePtracePair("mips", "mips64"). DO NOT EDIT. //go:build linux && (mips || mips64) -// +build linux -// +build mips mips64 package unix diff --git a/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go b/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go index 2807f7e6..2d2de5d2 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go @@ -1,8 +1,6 @@ // Code generated by linux/mkall.go generatePtracePair("mipsle", "mips64le"). DO NOT EDIT. //go:build linux && (mipsle || mips64le) -// +build linux -// +build mipsle mips64le package unix diff --git a/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go b/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go index 281ea64e..5adc79fb 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go @@ -1,8 +1,6 @@ // Code generated by linux/mkall.go generatePtracePair("386", "amd64"). DO NOT EDIT. //go:build linux && (386 || amd64) -// +build linux -// +build 386 amd64 package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go index 9a257219..6ea64a3c 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build aix && ppc -// +build aix,ppc package unix @@ -817,28 +816,6 @@ func write(fd int, p []byte) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, p *byte, np int) (n int, err error) { - r0, er := C.read(C.int(fd), C.uintptr_t(uintptr(unsafe.Pointer(p))), C.size_t(np)) - n = int(r0) - if r0 == -1 && er != nil { - err = er - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, p *byte, np int) (n int, err error) { - r0, er := C.write(C.int(fd), C.uintptr_t(uintptr(unsafe.Pointer(p))), C.size_t(np)) - n = int(r0) - if r0 == -1 && er != nil { - err = er - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Dup2(oldfd int, newfd int) (err error) { r0, er := C.dup2(C.int(oldfd), C.int(newfd)) if r0 == -1 && er != nil { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go index 6de80c20..99ee4399 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build aix && ppc64 -// +build aix,ppc64 package unix @@ -762,28 +761,6 @@ func write(fd int, p []byte) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, p *byte, np int) (n int, err error) { - r0, e1 := callread(fd, uintptr(unsafe.Pointer(p)), np) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, p *byte, np int) (n int, err error) { - r0, e1 := callwrite(fd, uintptr(unsafe.Pointer(p)), np) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Dup2(oldfd int, newfd int) (err error) { _, e1 := calldup2(oldfd, newfd) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go index c4d50ae5..b68a7836 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build aix && ppc64 && gc -// +build aix,ppc64,gc package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go index 6903d3b0..0a87450b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build aix && ppc64 && gccgo -// +build aix,ppc64,gccgo package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go index 4037ccf7..ccb02f24 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build darwin && amd64 -// +build darwin,amd64 package unix @@ -725,6 +724,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -733,10 +738,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -2410,28 +2411,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := syscall_syscall(libc_fstat64_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { @@ -2521,14 +2500,6 @@ func ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) { return } -func ptrace1Ptr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { - _, _, e1 := syscall_syscall6(libc_ptrace_trampoline_addr, uintptr(request), uintptr(pid), addr, uintptr(data), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - var libc_ptrace_trampoline_addr uintptr //go:cgo_import_dynamic libc_ptrace ptrace "/usr/lib/libSystem.B.dylib" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s index 4baaed0b..8b8bb284 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s @@ -5,703 +5,586 @@ TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fdopendir(SB) - GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgroups(SB) - GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgroups(SB) - GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_wait4(SB) - GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_accept(SB) - GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_bind(SB) - GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_connect(SB) - GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socket(SB) - GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockopt(SB) - GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsockopt(SB) - GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpeername(SB) - GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockname(SB) - GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shutdown(SB) - GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socketpair(SB) - GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvfrom(SB) - GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendto(SB) - GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvmsg(SB) - GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendmsg(SB) - GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kevent(SB) - GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimes(SB) - GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_futimes(SB) - GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_poll(SB) - GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_madvise(SB) - GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlock(SB) - GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlockall(SB) - GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mprotect(SB) - GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_msync(SB) - GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlock(SB) - GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlockall(SB) - GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_closedir(SB) - GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readdir_r(SB) - GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) TEXT libc_pipe_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pipe(SB) - GLOBL ·libc_pipe_trampoline_addr(SB), RODATA, $8 DATA ·libc_pipe_trampoline_addr(SB)/8, $libc_pipe_trampoline<>(SB) TEXT libc_getxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getxattr(SB) - GLOBL ·libc_getxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_getxattr_trampoline_addr(SB)/8, $libc_getxattr_trampoline<>(SB) TEXT libc_fgetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fgetxattr(SB) - GLOBL ·libc_fgetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fgetxattr_trampoline_addr(SB)/8, $libc_fgetxattr_trampoline<>(SB) TEXT libc_setxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setxattr(SB) - GLOBL ·libc_setxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_setxattr_trampoline_addr(SB)/8, $libc_setxattr_trampoline<>(SB) TEXT libc_fsetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsetxattr(SB) - GLOBL ·libc_fsetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsetxattr_trampoline_addr(SB)/8, $libc_fsetxattr_trampoline<>(SB) TEXT libc_removexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_removexattr(SB) - GLOBL ·libc_removexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_removexattr_trampoline_addr(SB)/8, $libc_removexattr_trampoline<>(SB) TEXT libc_fremovexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fremovexattr(SB) - GLOBL ·libc_fremovexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fremovexattr_trampoline_addr(SB)/8, $libc_fremovexattr_trampoline<>(SB) TEXT libc_listxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listxattr(SB) - GLOBL ·libc_listxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_listxattr_trampoline_addr(SB)/8, $libc_listxattr_trampoline<>(SB) TEXT libc_flistxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flistxattr(SB) - GLOBL ·libc_flistxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_flistxattr_trampoline_addr(SB)/8, $libc_flistxattr_trampoline<>(SB) TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) - GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fcntl(SB) - GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kill(SB) - GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) - GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sysctl(SB) - GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) TEXT libc_sendfile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendfile(SB) - GLOBL ·libc_sendfile_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendfile_trampoline_addr(SB)/8, $libc_sendfile_trampoline<>(SB) TEXT libc_shmat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmat(SB) - GLOBL ·libc_shmat_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmat_trampoline_addr(SB)/8, $libc_shmat_trampoline<>(SB) TEXT libc_shmctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmctl(SB) - GLOBL ·libc_shmctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmctl_trampoline_addr(SB)/8, $libc_shmctl_trampoline<>(SB) TEXT libc_shmdt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmdt(SB) - GLOBL ·libc_shmdt_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmdt_trampoline_addr(SB)/8, $libc_shmdt_trampoline<>(SB) TEXT libc_shmget_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmget(SB) - GLOBL ·libc_shmget_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmget_trampoline_addr(SB)/8, $libc_shmget_trampoline<>(SB) TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_access(SB) - GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_adjtime(SB) - GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chdir(SB) - GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chflags(SB) - GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chmod(SB) - GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chown(SB) - GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chroot(SB) - GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clock_gettime(SB) - GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $8 DATA ·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB) TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_close(SB) - GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) TEXT libc_clonefile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefile(SB) - GLOBL ·libc_clonefile_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefile_trampoline_addr(SB)/8, $libc_clonefile_trampoline<>(SB) TEXT libc_clonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefileat(SB) - GLOBL ·libc_clonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefileat_trampoline_addr(SB)/8, $libc_clonefileat_trampoline<>(SB) TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup(SB) - GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup2(SB) - GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) TEXT libc_exchangedata_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exchangedata(SB) - GLOBL ·libc_exchangedata_trampoline_addr(SB), RODATA, $8 DATA ·libc_exchangedata_trampoline_addr(SB)/8, $libc_exchangedata_trampoline<>(SB) TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exit(SB) - GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_faccessat(SB) - GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchdir(SB) - GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchflags(SB) - GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmod(SB) - GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmodat(SB) - GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchown(SB) - GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchownat(SB) - GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) TEXT libc_fclonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fclonefileat(SB) - GLOBL ·libc_fclonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fclonefileat_trampoline_addr(SB)/8, $libc_fclonefileat_trampoline<>(SB) TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flock(SB) - GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fpathconf(SB) - GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsync(SB) - GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ftruncate(SB) - GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getcwd(SB) - GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) TEXT libc_getdtablesize_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getdtablesize(SB) - GLOBL ·libc_getdtablesize_trampoline_addr(SB), RODATA, $8 DATA ·libc_getdtablesize_trampoline_addr(SB)/8, $libc_getdtablesize_trampoline<>(SB) TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getegid(SB) - GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_geteuid(SB) - GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgid(SB) - GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgid(SB) - GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgrp(SB) - GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpid(SB) - GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getppid(SB) - GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpriority(SB) - GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrlimit(SB) - GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrusage(SB) - GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsid(SB) - GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_gettimeofday(SB) - GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getuid(SB) - GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_issetugid(SB) - GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kqueue(SB) - GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lchown(SB) - GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_link(SB) - GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_linkat(SB) - GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listen(SB) - GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdir(SB) - GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdirat(SB) - GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkfifo(SB) - GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mknod(SB) - GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) TEXT libc_mount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mount(SB) - GLOBL ·libc_mount_trampoline_addr(SB), RODATA, $8 DATA ·libc_mount_trampoline_addr(SB)/8, $libc_mount_trampoline<>(SB) TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_open(SB) - GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_openat(SB) - GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pathconf(SB) - GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pread(SB) - GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pwrite(SB) - GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_read(SB) - GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlink(SB) - GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlinkat(SB) - GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rename(SB) - GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_renameat(SB) - GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_revoke(SB) - GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rmdir(SB) - GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lseek(SB) - GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_select(SB) - GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) @@ -712,192 +595,160 @@ DATA ·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setegid(SB) - GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_seteuid(SB) - GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgid(SB) - GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setlogin(SB) - GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpgid(SB) - GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpriority(SB) - GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) TEXT libc_setprivexec_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setprivexec(SB) - GLOBL ·libc_setprivexec_trampoline_addr(SB), RODATA, $8 DATA ·libc_setprivexec_trampoline_addr(SB)/8, $libc_setprivexec_trampoline<>(SB) TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setregid(SB) - GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setreuid(SB) - GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsid(SB) - GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_settimeofday(SB) - GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setuid(SB) - GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlink(SB) - GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlinkat(SB) - GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sync(SB) - GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_truncate(SB) - GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_umask(SB) - GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) TEXT libc_undelete_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_undelete(SB) - GLOBL ·libc_undelete_trampoline_addr(SB), RODATA, $8 DATA ·libc_undelete_trampoline_addr(SB)/8, $libc_undelete_trampoline<>(SB) TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlink(SB) - GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlinkat(SB) - GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unmount(SB) - GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_write(SB) - GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mmap(SB) - GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munmap(SB) - GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) TEXT libc_fstat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstat64(SB) - GLOBL ·libc_fstat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstat64_trampoline_addr(SB)/8, $libc_fstat64_trampoline<>(SB) TEXT libc_fstatat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatat64(SB) - GLOBL ·libc_fstatat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatat64_trampoline_addr(SB)/8, $libc_fstatat64_trampoline<>(SB) TEXT libc_fstatfs64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatfs64(SB) - GLOBL ·libc_fstatfs64_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatfs64_trampoline_addr(SB)/8, $libc_fstatfs64_trampoline<>(SB) TEXT libc_getfsstat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getfsstat64(SB) - GLOBL ·libc_getfsstat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_getfsstat64_trampoline_addr(SB)/8, $libc_getfsstat64_trampoline<>(SB) TEXT libc_lstat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lstat64(SB) - GLOBL ·libc_lstat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_lstat64_trampoline_addr(SB)/8, $libc_lstat64_trampoline<>(SB) TEXT libc_ptrace_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ptrace(SB) - GLOBL ·libc_ptrace_trampoline_addr(SB), RODATA, $8 DATA ·libc_ptrace_trampoline_addr(SB)/8, $libc_ptrace_trampoline<>(SB) TEXT libc_stat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_stat64(SB) - GLOBL ·libc_stat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_stat64_trampoline_addr(SB)/8, $libc_stat64_trampoline<>(SB) TEXT libc_statfs64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_statfs64(SB) - GLOBL ·libc_statfs64_trampoline_addr(SB), RODATA, $8 DATA ·libc_statfs64_trampoline_addr(SB)/8, $libc_statfs64_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go index 51d6f3fb..1b40b997 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build darwin && arm64 -// +build darwin,arm64 package unix @@ -725,6 +724,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -733,10 +738,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -2410,28 +2411,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { @@ -2521,14 +2500,6 @@ func ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) { return } -func ptrace1Ptr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { - _, _, e1 := syscall_syscall6(libc_ptrace_trampoline_addr, uintptr(request), uintptr(pid), addr, uintptr(data), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - var libc_ptrace_trampoline_addr uintptr //go:cgo_import_dynamic libc_ptrace ptrace "/usr/lib/libSystem.B.dylib" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s index c3b82c03..08362c1a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s @@ -5,703 +5,586 @@ TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fdopendir(SB) - GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgroups(SB) - GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgroups(SB) - GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_wait4(SB) - GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_accept(SB) - GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_bind(SB) - GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_connect(SB) - GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socket(SB) - GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockopt(SB) - GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsockopt(SB) - GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpeername(SB) - GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockname(SB) - GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shutdown(SB) - GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socketpair(SB) - GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvfrom(SB) - GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendto(SB) - GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvmsg(SB) - GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendmsg(SB) - GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kevent(SB) - GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimes(SB) - GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_futimes(SB) - GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_poll(SB) - GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_madvise(SB) - GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlock(SB) - GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlockall(SB) - GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mprotect(SB) - GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_msync(SB) - GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlock(SB) - GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlockall(SB) - GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_closedir(SB) - GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readdir_r(SB) - GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) TEXT libc_pipe_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pipe(SB) - GLOBL ·libc_pipe_trampoline_addr(SB), RODATA, $8 DATA ·libc_pipe_trampoline_addr(SB)/8, $libc_pipe_trampoline<>(SB) TEXT libc_getxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getxattr(SB) - GLOBL ·libc_getxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_getxattr_trampoline_addr(SB)/8, $libc_getxattr_trampoline<>(SB) TEXT libc_fgetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fgetxattr(SB) - GLOBL ·libc_fgetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fgetxattr_trampoline_addr(SB)/8, $libc_fgetxattr_trampoline<>(SB) TEXT libc_setxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setxattr(SB) - GLOBL ·libc_setxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_setxattr_trampoline_addr(SB)/8, $libc_setxattr_trampoline<>(SB) TEXT libc_fsetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsetxattr(SB) - GLOBL ·libc_fsetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsetxattr_trampoline_addr(SB)/8, $libc_fsetxattr_trampoline<>(SB) TEXT libc_removexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_removexattr(SB) - GLOBL ·libc_removexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_removexattr_trampoline_addr(SB)/8, $libc_removexattr_trampoline<>(SB) TEXT libc_fremovexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fremovexattr(SB) - GLOBL ·libc_fremovexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fremovexattr_trampoline_addr(SB)/8, $libc_fremovexattr_trampoline<>(SB) TEXT libc_listxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listxattr(SB) - GLOBL ·libc_listxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_listxattr_trampoline_addr(SB)/8, $libc_listxattr_trampoline<>(SB) TEXT libc_flistxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flistxattr(SB) - GLOBL ·libc_flistxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_flistxattr_trampoline_addr(SB)/8, $libc_flistxattr_trampoline<>(SB) TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) - GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fcntl(SB) - GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kill(SB) - GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) - GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sysctl(SB) - GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) TEXT libc_sendfile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendfile(SB) - GLOBL ·libc_sendfile_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendfile_trampoline_addr(SB)/8, $libc_sendfile_trampoline<>(SB) TEXT libc_shmat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmat(SB) - GLOBL ·libc_shmat_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmat_trampoline_addr(SB)/8, $libc_shmat_trampoline<>(SB) TEXT libc_shmctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmctl(SB) - GLOBL ·libc_shmctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmctl_trampoline_addr(SB)/8, $libc_shmctl_trampoline<>(SB) TEXT libc_shmdt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmdt(SB) - GLOBL ·libc_shmdt_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmdt_trampoline_addr(SB)/8, $libc_shmdt_trampoline<>(SB) TEXT libc_shmget_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmget(SB) - GLOBL ·libc_shmget_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmget_trampoline_addr(SB)/8, $libc_shmget_trampoline<>(SB) TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_access(SB) - GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_adjtime(SB) - GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chdir(SB) - GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chflags(SB) - GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chmod(SB) - GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chown(SB) - GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chroot(SB) - GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clock_gettime(SB) - GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $8 DATA ·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB) TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_close(SB) - GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) TEXT libc_clonefile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefile(SB) - GLOBL ·libc_clonefile_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefile_trampoline_addr(SB)/8, $libc_clonefile_trampoline<>(SB) TEXT libc_clonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefileat(SB) - GLOBL ·libc_clonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefileat_trampoline_addr(SB)/8, $libc_clonefileat_trampoline<>(SB) TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup(SB) - GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup2(SB) - GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) TEXT libc_exchangedata_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exchangedata(SB) - GLOBL ·libc_exchangedata_trampoline_addr(SB), RODATA, $8 DATA ·libc_exchangedata_trampoline_addr(SB)/8, $libc_exchangedata_trampoline<>(SB) TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exit(SB) - GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_faccessat(SB) - GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchdir(SB) - GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchflags(SB) - GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmod(SB) - GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmodat(SB) - GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchown(SB) - GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchownat(SB) - GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) TEXT libc_fclonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fclonefileat(SB) - GLOBL ·libc_fclonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fclonefileat_trampoline_addr(SB)/8, $libc_fclonefileat_trampoline<>(SB) TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flock(SB) - GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fpathconf(SB) - GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsync(SB) - GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ftruncate(SB) - GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getcwd(SB) - GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) TEXT libc_getdtablesize_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getdtablesize(SB) - GLOBL ·libc_getdtablesize_trampoline_addr(SB), RODATA, $8 DATA ·libc_getdtablesize_trampoline_addr(SB)/8, $libc_getdtablesize_trampoline<>(SB) TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getegid(SB) - GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_geteuid(SB) - GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgid(SB) - GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgid(SB) - GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgrp(SB) - GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpid(SB) - GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getppid(SB) - GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpriority(SB) - GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrlimit(SB) - GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrusage(SB) - GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsid(SB) - GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_gettimeofday(SB) - GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getuid(SB) - GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_issetugid(SB) - GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kqueue(SB) - GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lchown(SB) - GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_link(SB) - GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_linkat(SB) - GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listen(SB) - GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdir(SB) - GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdirat(SB) - GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkfifo(SB) - GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mknod(SB) - GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) TEXT libc_mount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mount(SB) - GLOBL ·libc_mount_trampoline_addr(SB), RODATA, $8 DATA ·libc_mount_trampoline_addr(SB)/8, $libc_mount_trampoline<>(SB) TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_open(SB) - GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_openat(SB) - GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pathconf(SB) - GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pread(SB) - GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pwrite(SB) - GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_read(SB) - GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlink(SB) - GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlinkat(SB) - GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rename(SB) - GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_renameat(SB) - GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_revoke(SB) - GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rmdir(SB) - GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lseek(SB) - GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_select(SB) - GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) @@ -712,192 +595,160 @@ DATA ·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setegid(SB) - GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_seteuid(SB) - GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgid(SB) - GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setlogin(SB) - GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpgid(SB) - GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpriority(SB) - GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) TEXT libc_setprivexec_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setprivexec(SB) - GLOBL ·libc_setprivexec_trampoline_addr(SB), RODATA, $8 DATA ·libc_setprivexec_trampoline_addr(SB)/8, $libc_setprivexec_trampoline<>(SB) TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setregid(SB) - GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setreuid(SB) - GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsid(SB) - GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_settimeofday(SB) - GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setuid(SB) - GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlink(SB) - GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlinkat(SB) - GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sync(SB) - GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_truncate(SB) - GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_umask(SB) - GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) TEXT libc_undelete_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_undelete(SB) - GLOBL ·libc_undelete_trampoline_addr(SB), RODATA, $8 DATA ·libc_undelete_trampoline_addr(SB)/8, $libc_undelete_trampoline<>(SB) TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlink(SB) - GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlinkat(SB) - GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unmount(SB) - GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_write(SB) - GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mmap(SB) - GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munmap(SB) - GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstat(SB) - GLOBL ·libc_fstat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstat_trampoline_addr(SB)/8, $libc_fstat_trampoline<>(SB) TEXT libc_fstatat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatat(SB) - GLOBL ·libc_fstatat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatat_trampoline_addr(SB)/8, $libc_fstatat_trampoline<>(SB) TEXT libc_fstatfs_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatfs(SB) - GLOBL ·libc_fstatfs_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatfs_trampoline_addr(SB)/8, $libc_fstatfs_trampoline<>(SB) TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getfsstat(SB) - GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) TEXT libc_lstat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lstat(SB) - GLOBL ·libc_lstat_trampoline_addr(SB), RODATA, $8 DATA ·libc_lstat_trampoline_addr(SB)/8, $libc_lstat_trampoline<>(SB) TEXT libc_ptrace_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ptrace(SB) - GLOBL ·libc_ptrace_trampoline_addr(SB), RODATA, $8 DATA ·libc_ptrace_trampoline_addr(SB)/8, $libc_ptrace_trampoline<>(SB) TEXT libc_stat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_stat(SB) - GLOBL ·libc_stat_trampoline_addr(SB), RODATA, $8 DATA ·libc_stat_trampoline_addr(SB)/8, $libc_stat_trampoline<>(SB) TEXT libc_statfs_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_statfs(SB) - GLOBL ·libc_statfs_trampoline_addr(SB), RODATA, $8 DATA ·libc_statfs_trampoline_addr(SB)/8, $libc_statfs_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go index 0eabac7a..aad65fc7 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build dragonfly && amd64 -// +build dragonfly,amd64 package unix @@ -1642,28 +1641,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go index ee313eb0..c0096391 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && 386 -// +build freebsd,386 package unix @@ -1862,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go index 4c986e44..7664df74 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && amd64 -// +build freebsd,amd64 package unix @@ -1862,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go index 55521694..ae099182 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && arm -// +build freebsd,arm package unix @@ -1862,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go index 67a226fb..11fd5d45 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && arm64 -// +build freebsd,arm64 package unix @@ -1862,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go index f0b9ddaa..c3d2d653 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && riscv64 -// +build freebsd,riscv64 package unix @@ -1862,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go index b57c7050..c698cbc0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build illumos && amd64 -// +build illumos,amd64 package unix @@ -40,7 +39,7 @@ func readv(fd int, iovs []Iovec) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procreadv)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -55,7 +54,7 @@ func preadv(fd int, iovs []Iovec, off int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpreadv)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), uintptr(off), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -70,7 +69,7 @@ func writev(fd int, iovs []Iovec) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwritev)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -85,7 +84,7 @@ func pwritev(fd int, iovs []Iovec, off int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpwritev)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), uintptr(off), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -96,7 +95,7 @@ func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procaccept4)), 4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index da63d9d7..1488d271 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -1,7 +1,6 @@ // Code generated by mkmerge; DO NOT EDIT. //go:build linux -// +build linux package unix @@ -38,6 +37,21 @@ func fchmodat(dirfd int, path string, mode uint32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fchmodat2(dirfd int, path string, mode uint32, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall6(SYS_FCHMODAT2, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -1356,7 +1370,7 @@ func Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) ( // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { +func pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) { r0, _, e1 := Syscall6(SYS_PSELECT6, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask))) n = int(r0) if e1 != 0 { @@ -1734,28 +1748,6 @@ func exitThread(code int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, p *byte, np int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(p)), uintptr(np)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, p *byte, np int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(p)), uintptr(np)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func readv(fd int, iovs []Iovec) (n int, err error) { var _p0 unsafe.Pointer if len(iovs) > 0 { @@ -1868,6 +1860,17 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldaddr), uintptr(oldlength), uintptr(newlength), uintptr(flags), uintptr(newaddr), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Madvise(b []byte, advice int) (err error) { var _p0 unsafe.Pointer if len(b) > 0 { @@ -2172,3 +2175,47 @@ func rtSigprocmask(how int, set *Sigset_t, oldset *Sigset_t, sigsetsize uintptr) } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + RawSyscallNoError(SYS_GETRESUID, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + RawSyscallNoError(SYS_GETRESGID, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func schedSetattr(pid int, attr *SchedAttr, flags uint) (err error) { + _, _, e1 := Syscall(SYS_SCHED_SETATTR, uintptr(pid), uintptr(unsafe.Pointer(attr)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func schedGetattr(pid int, attr *SchedAttr, size uint, flags uint) (err error) { + _, _, e1 := Syscall6(SYS_SCHED_GETATTR, uintptr(pid), uintptr(unsafe.Pointer(attr)), uintptr(size), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Cachestat(fd uint, crange *CachestatRange, cstat *Cachestat_t, flags uint) (err error) { + _, _, e1 := Syscall6(SYS_CACHESTAT, uintptr(fd), uintptr(unsafe.Pointer(crange)), uintptr(unsafe.Pointer(cstat)), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go index 07b549cc..4def3e9f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && 386 -// +build linux,386 package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go index 5f481bf8..fef2bc8b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && amd64 -// +build linux,amd64 package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go index 824cd52c..a9fd76a8 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && arm -// +build linux,arm package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go index e77aecfe..46006502 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && arm64 -// +build linux,arm64 package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go index 806ffd1e..c8987d26 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && loong64 -// +build linux,loong64 package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go index 961a3afb..921f4306 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mips -// +build linux,mips package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go index ed05005e..44f06782 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mips64 -// +build linux,mips64 package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go index d365b718..e7fa0abf 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mips64le -// +build linux,mips64le package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go index c3f1b8bb..8c512567 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mipsle -// +build linux,mipsle package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go index a6574cf9..7392fd45 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && ppc -// +build linux,ppc package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go index f4099026..41180434 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && ppc64 -// +build linux,ppc64 package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go index 9dfcc299..40c6ce7a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && ppc64le -// +build linux,ppc64le package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go index 0b292395..2cfe34ad 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && riscv64 -// +build linux,riscv64 package unix @@ -531,3 +530,19 @@ func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, f } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) { + var _p0 unsafe.Pointer + if len(pairs) > 0 { + _p0 = unsafe.Pointer(&pairs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall6(SYS_RISCV_HWPROBE, uintptr(_p0), uintptr(len(pairs)), uintptr(cpuCount), uintptr(unsafe.Pointer(cpus)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go index 6cde3223..61e6f070 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && s390x -// +build linux,s390x package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go index 5253d65b..834b8420 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && sparc64 -// +build linux,sparc64 package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go index cdb2af5a..e91ebc14 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build netbsd && 386 -// +build netbsd,386 package unix @@ -1824,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1846,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go index 9d25f76b..be28babb 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build netbsd && amd64 -// +build netbsd,amd64 package unix @@ -1824,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1846,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go index d3f80351..fb587e82 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build netbsd && arm -// +build netbsd,arm package unix @@ -1824,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1846,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go index 887188a5..d576438b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build netbsd && arm64 -// +build netbsd,arm64 package unix @@ -1824,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1846,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go index 6699a783..9dc42410 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && 386 -// +build openbsd,386 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -2189,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2198,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2227,3 +2269,31 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s index 04f0de34..41b56173 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $4 DATA ·libc_sysctl_trampoline_addr(SB)/4, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fcntl_trampoline_addr(SB)/4, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $4 @@ -658,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $4 DATA ·libc_munmap_trampoline_addr(SB)/4, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getfsstat_trampoline_addr(SB)/4, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $4 DATA ·libc_utimensat_trampoline_addr(SB)/4, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $4 +DATA ·libc_pledge_trampoline_addr(SB)/4, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $4 +DATA ·libc_unveil_trampoline_addr(SB)/4, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go index 1e775fe0..0d3a0751 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && amd64 -// +build openbsd,amd64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -2189,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2198,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2227,3 +2269,31 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s index 27b6f4df..4019a656 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 @@ -658,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go index 7f642789..c39f7776 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && arm -// +build openbsd,arm package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -2189,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2198,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2227,3 +2269,31 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s index b797045f..ac4af24f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $4 DATA ·libc_sysctl_trampoline_addr(SB)/4, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fcntl_trampoline_addr(SB)/4, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $4 @@ -658,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $4 DATA ·libc_munmap_trampoline_addr(SB)/4, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getfsstat_trampoline_addr(SB)/4, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $4 DATA ·libc_utimensat_trampoline_addr(SB)/4, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $4 +DATA ·libc_pledge_trampoline_addr(SB)/4, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $4 +DATA ·libc_unveil_trampoline_addr(SB)/4, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go index 756ef7b1..57571d07 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && arm64 -// +build openbsd,arm64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -2189,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2198,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2227,3 +2269,31 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s index a8712662..f77d5321 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 @@ -658,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go index 7bc2e24e..e62963e6 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && mips64 -// +build openbsd,mips64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -2189,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2198,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2227,3 +2269,31 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s index 05d4bffd..fae140b6 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 @@ -658,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go index 739be621..00831354 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && ppc64 -// +build openbsd,ppc64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -2189,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2198,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2227,3 +2269,31 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s index 74a25f8d..9d1e0ff0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s @@ -189,6 +189,18 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresuid(SB) + RET +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresgid(SB) + RET +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_ioctl(SB) RET @@ -201,6 +213,12 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fcntl(SB) + RET +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_ppoll(SB) RET @@ -789,8 +807,26 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getfsstat(SB) + RET +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_utimensat(SB) RET GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_pledge(SB) + RET +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_unveil(SB) + RET +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go index 7d95a197..79029ed5 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && riscv64 -// +build openbsd,riscv64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -2189,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2198,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2227,3 +2269,31 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s index 990be245..da115f9a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 @@ -658,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go index 609d1c59..829b87fe 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build solaris && amd64 -// +build solaris,amd64 package unix @@ -436,7 +435,7 @@ func pipe(p *[2]_C_int) (n int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procpipe)), 1, uintptr(unsafe.Pointer(p)), 0, 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -446,7 +445,7 @@ func pipe(p *[2]_C_int) (n int, err error) { func pipe2(p *[2]_C_int, flags int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procpipe2)), 2, uintptr(unsafe.Pointer(p)), uintptr(flags), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -456,7 +455,7 @@ func pipe2(p *[2]_C_int, flags int) (err error) { func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgetsockname)), 3, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -471,7 +470,7 @@ func Getcwd(buf []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetcwd)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -482,7 +481,7 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procgetgroups)), 2, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -492,7 +491,7 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) { func setgroups(ngid int, gid *_Gid_t) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procsetgroups)), 2, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -503,7 +502,7 @@ func wait4(pid int32, statusp *_C_int, options int, rusage *Rusage) (wpid int32, r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwait4)), 4, uintptr(pid), uintptr(unsafe.Pointer(statusp)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) wpid = int32(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -518,7 +517,7 @@ func gethostname(buf []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgethostname)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -533,7 +532,7 @@ func utimes(path string, times *[2]Timeval) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procutimes)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -548,7 +547,7 @@ func utimensat(fd int, path string, times *[2]Timespec, flag int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procutimensat)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flag), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -559,7 +558,7 @@ func fcntl(fd int, cmd int, arg int) (val int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procfcntl)), 3, uintptr(fd), uintptr(cmd), uintptr(arg), 0, 0, 0) val = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -569,7 +568,7 @@ func fcntl(fd int, cmd int, arg int) (val int, err error) { func futimesat(fildes int, path *byte, times *[2]Timeval) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procfutimesat)), 3, uintptr(fildes), uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(times)), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -580,7 +579,7 @@ func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procaccept)), 3, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -591,7 +590,7 @@ func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_recvmsg)), 3, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -602,7 +601,7 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_sendmsg)), 3, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -612,7 +611,7 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { func acct(path *byte) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procacct)), 1, uintptr(unsafe.Pointer(path)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -647,7 +646,7 @@ func ioctlRet(fd int, req int, arg uintptr) (ret int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0) ret = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -658,7 +657,7 @@ func ioctlPtrRet(fd int, req int, arg unsafe.Pointer) (ret int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0) ret = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -669,7 +668,7 @@ func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpoll)), 3, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -684,7 +683,7 @@ func Access(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procAccess)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -694,7 +693,7 @@ func Access(path string, mode uint32) (err error) { func Adjtime(delta *Timeval, olddelta *Timeval) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procAdjtime)), 2, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -709,7 +708,7 @@ func Chdir(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChdir)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -724,7 +723,7 @@ func Chmod(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChmod)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -739,7 +738,7 @@ func Chown(path string, uid int, gid int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChown)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -754,7 +753,7 @@ func Chroot(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChroot)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -764,7 +763,7 @@ func Chroot(path string) (err error) { func ClockGettime(clockid int32, time *Timespec) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procClockGettime)), 2, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -774,7 +773,7 @@ func ClockGettime(clockid int32, time *Timespec) (err error) { func Close(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procClose)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -790,7 +789,7 @@ func Creat(path string, mode uint32) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procCreat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -801,7 +800,7 @@ func Dup(fd int) (nfd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procDup)), 1, uintptr(fd), 0, 0, 0, 0, 0) nfd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -811,7 +810,7 @@ func Dup(fd int) (nfd int, err error) { func Dup2(oldfd int, newfd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procDup2)), 2, uintptr(oldfd), uintptr(newfd), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -833,7 +832,7 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFaccessat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -843,7 +842,7 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { func Fchdir(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchdir)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -853,7 +852,7 @@ func Fchdir(fd int) (err error) { func Fchmod(fd int, mode uint32) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchmod)), 2, uintptr(fd), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -868,7 +867,7 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchmodat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -878,7 +877,7 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { func Fchown(fd int, uid int, gid int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchown)), 3, uintptr(fd), uintptr(uid), uintptr(gid), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -893,7 +892,7 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchownat)), 5, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -903,7 +902,7 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { func Fdatasync(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFdatasync)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -913,7 +912,7 @@ func Fdatasync(fd int) (err error) { func Flock(fd int, how int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFlock)), 2, uintptr(fd), uintptr(how), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -924,7 +923,7 @@ func Fpathconf(fd int, name int) (val int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFpathconf)), 2, uintptr(fd), uintptr(name), 0, 0, 0, 0) val = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -934,7 +933,7 @@ func Fpathconf(fd int, name int) (val int, err error) { func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstat)), 2, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -949,7 +948,7 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstatat)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -959,7 +958,7 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { func Fstatvfs(fd int, vfsstat *Statvfs_t) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstatvfs)), 2, uintptr(fd), uintptr(unsafe.Pointer(vfsstat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -974,7 +973,7 @@ func Getdents(fd int, buf []byte, basep *uintptr) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetdents)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), uintptr(unsafe.Pointer(basep)), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1001,7 +1000,7 @@ func Getpgid(pid int) (pgid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetpgid)), 1, uintptr(pid), 0, 0, 0, 0, 0) pgid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1012,7 +1011,7 @@ func Getpgrp() (pgid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetpgrp)), 0, 0, 0, 0, 0, 0, 0) pgid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1047,7 +1046,7 @@ func Getpriority(which int, who int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetpriority)), 2, uintptr(which), uintptr(who), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1057,7 +1056,7 @@ func Getpriority(which int, who int) (n int, err error) { func Getrlimit(which int, lim *Rlimit) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetrlimit)), 2, uintptr(which), uintptr(unsafe.Pointer(lim)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1067,7 +1066,7 @@ func Getrlimit(which int, lim *Rlimit) (err error) { func Getrusage(who int, rusage *Rusage) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetrusage)), 2, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1078,7 +1077,7 @@ func Getsid(pid int) (sid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetsid)), 1, uintptr(pid), 0, 0, 0, 0, 0) sid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1088,7 +1087,7 @@ func Getsid(pid int) (sid int, err error) { func Gettimeofday(tv *Timeval) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGettimeofday)), 1, uintptr(unsafe.Pointer(tv)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1106,7 +1105,7 @@ func Getuid() (uid int) { func Kill(pid int, signum syscall.Signal) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procKill)), 2, uintptr(pid), uintptr(signum), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1121,7 +1120,7 @@ func Lchown(path string, uid int, gid int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLchown)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1141,7 +1140,7 @@ func Link(path string, link string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLink)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1151,7 +1150,7 @@ func Link(path string, link string) (err error) { func Listen(s int, backlog int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_llisten)), 2, uintptr(s), uintptr(backlog), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1166,7 +1165,7 @@ func Lstat(path string, stat *Stat_t) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLstat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1180,7 +1179,7 @@ func Madvise(b []byte, advice int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMadvise)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(advice), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1195,7 +1194,7 @@ func Mkdir(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkdir)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1210,7 +1209,7 @@ func Mkdirat(dirfd int, path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkdirat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1225,7 +1224,7 @@ func Mkfifo(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkfifo)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1240,7 +1239,7 @@ func Mkfifoat(dirfd int, path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkfifoat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1255,7 +1254,7 @@ func Mknod(path string, mode uint32, dev int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMknod)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1270,7 +1269,7 @@ func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMknodat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1284,7 +1283,7 @@ func Mlock(b []byte) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMlock)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1294,7 +1293,7 @@ func Mlock(b []byte) (err error) { func Mlockall(flags int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMlockall)), 1, uintptr(flags), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1308,7 +1307,7 @@ func Mprotect(b []byte, prot int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMprotect)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(prot), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1322,7 +1321,7 @@ func Msync(b []byte, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMsync)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(flags), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1336,7 +1335,7 @@ func Munlock(b []byte) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMunlock)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1346,7 +1345,7 @@ func Munlock(b []byte) (err error) { func Munlockall() (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMunlockall)), 0, 0, 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1356,7 +1355,7 @@ func Munlockall() (err error) { func Nanosleep(time *Timespec, leftover *Timespec) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procNanosleep)), 2, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1372,7 +1371,7 @@ func Open(path string, mode int, perm uint32) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procOpen)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1388,7 +1387,7 @@ func Openat(dirfd int, path string, flags int, mode uint32) (fd int, err error) r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procOpenat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags), uintptr(mode), 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1404,7 +1403,7 @@ func Pathconf(path string, name int) (val int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procPathconf)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0, 0, 0, 0) val = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1414,7 +1413,7 @@ func Pathconf(path string, name int) (val int, err error) { func Pause() (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procPause)), 0, 0, 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1429,7 +1428,7 @@ func pread(fd int, p []byte, offset int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpread)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1444,7 +1443,7 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpwrite)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1459,7 +1458,7 @@ func read(fd int, p []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procread)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1479,7 +1478,7 @@ func Readlink(path string, buf []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procReadlink)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(len(buf)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1499,7 +1498,7 @@ func Rename(from string, to string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRename)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1519,7 +1518,7 @@ func Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err e } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRenameat)), 4, uintptr(olddirfd), uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1)), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1534,7 +1533,7 @@ func Rmdir(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRmdir)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1545,7 +1544,7 @@ func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proclseek)), 3, uintptr(fd), uintptr(offset), uintptr(whence), 0, 0, 0) newoffset = int64(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1556,7 +1555,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSelect)), 5, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1566,7 +1565,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err func Setegid(egid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetegid)), 1, uintptr(egid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1576,7 +1575,7 @@ func Setegid(egid int) (err error) { func Seteuid(euid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSeteuid)), 1, uintptr(euid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1586,7 +1585,7 @@ func Seteuid(euid int) (err error) { func Setgid(gid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetgid)), 1, uintptr(gid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1600,7 +1599,7 @@ func Sethostname(p []byte) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSethostname)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1610,7 +1609,7 @@ func Sethostname(p []byte) (err error) { func Setpgid(pid int, pgid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetpgid)), 2, uintptr(pid), uintptr(pgid), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1620,7 +1619,7 @@ func Setpgid(pid int, pgid int) (err error) { func Setpriority(which int, who int, prio int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSetpriority)), 3, uintptr(which), uintptr(who), uintptr(prio), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1630,7 +1629,7 @@ func Setpriority(which int, who int, prio int) (err error) { func Setregid(rgid int, egid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetregid)), 2, uintptr(rgid), uintptr(egid), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1640,7 +1639,7 @@ func Setregid(rgid int, egid int) (err error) { func Setreuid(ruid int, euid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetreuid)), 2, uintptr(ruid), uintptr(euid), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1651,7 +1650,7 @@ func Setsid() (pid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetsid)), 0, 0, 0, 0, 0, 0, 0) pid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1661,7 +1660,7 @@ func Setsid() (pid int, err error) { func Setuid(uid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetuid)), 1, uintptr(uid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1671,7 +1670,7 @@ func Setuid(uid int) (err error) { func Shutdown(s int, how int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procshutdown)), 2, uintptr(s), uintptr(how), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1686,7 +1685,7 @@ func Stat(path string, stat *Stat_t) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procStat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1701,7 +1700,7 @@ func Statvfs(path string, vfsstat *Statvfs_t) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procStatvfs)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(vfsstat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1721,7 +1720,7 @@ func Symlink(path string, link string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSymlink)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1731,7 +1730,7 @@ func Symlink(path string, link string) (err error) { func Sync() (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSync)), 0, 0, 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1742,7 +1741,7 @@ func Sysconf(which int) (n int64, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSysconf)), 1, uintptr(which), 0, 0, 0, 0, 0) n = int64(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1753,7 +1752,7 @@ func Times(tms *Tms) (ticks uintptr, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procTimes)), 1, uintptr(unsafe.Pointer(tms)), 0, 0, 0, 0, 0) ticks = uintptr(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1768,7 +1767,7 @@ func Truncate(path string, length int64) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procTruncate)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1778,7 +1777,7 @@ func Truncate(path string, length int64) (err error) { func Fsync(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFsync)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1788,7 +1787,7 @@ func Fsync(fd int) (err error) { func Ftruncate(fd int, length int64) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFtruncate)), 2, uintptr(fd), uintptr(length), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1806,7 +1805,7 @@ func Umask(mask int) (oldmask int) { func Uname(buf *Utsname) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procUname)), 1, uintptr(unsafe.Pointer(buf)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1821,7 +1820,7 @@ func Unmount(target string, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procumount)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1836,7 +1835,7 @@ func Unlink(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUnlink)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1851,7 +1850,7 @@ func Unlinkat(dirfd int, path string, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUnlinkat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1861,7 +1860,7 @@ func Unlinkat(dirfd int, path string, flags int) (err error) { func Ustat(dev int, ubuf *Ustat_t) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUstat)), 2, uintptr(dev), uintptr(unsafe.Pointer(ubuf)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1876,7 +1875,7 @@ func Utime(path string, buf *Utimbuf) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUtime)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(buf)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1886,7 +1885,7 @@ func Utime(path string, buf *Utimbuf) (err error) { func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_bind)), 3, uintptr(s), uintptr(addr), uintptr(addrlen), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1896,7 +1895,7 @@ func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_connect)), 3, uintptr(s), uintptr(addr), uintptr(addrlen), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1907,7 +1906,7 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) ( r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procmmap)), 6, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos)) ret = uintptr(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1917,7 +1916,7 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) ( func munmap(addr uintptr, length uintptr) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procmunmap)), 2, uintptr(addr), uintptr(length), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1928,7 +1927,7 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procsendfile)), 4, uintptr(outfd), uintptr(infd), uintptr(unsafe.Pointer(offset)), uintptr(count), 0, 0) written = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1942,7 +1941,7 @@ func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) ( } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_sendto)), 6, uintptr(s), uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1953,7 +1952,7 @@ func socket(domain int, typ int, proto int) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_socket)), 3, uintptr(domain), uintptr(typ), uintptr(proto), 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1963,7 +1962,7 @@ func socket(domain int, typ int, proto int) (fd int, err error) { func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&proc__xnet_socketpair)), 4, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1978,7 +1977,7 @@ func write(fd int, p []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwrite)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1988,7 +1987,7 @@ func write(fd int, p []byte) (n int, err error) { func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_getsockopt)), 5, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1998,7 +1997,7 @@ func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procgetpeername)), 3, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2008,7 +2007,7 @@ func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procsetsockopt)), 5, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2023,7 +2022,7 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procrecvfrom)), 6, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2034,7 +2033,7 @@ func port_create() (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_create)), 0, 0, 0, 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2045,7 +2044,7 @@ func port_associate(port int, source int, object uintptr, events int, user *byte r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_associate)), 5, uintptr(port), uintptr(source), uintptr(object), uintptr(events), uintptr(unsafe.Pointer(user)), 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2056,7 +2055,7 @@ func port_dissociate(port int, source int, object uintptr) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_dissociate)), 3, uintptr(port), uintptr(source), uintptr(object), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2067,7 +2066,7 @@ func port_get(port int, pe *portEvent, timeout *Timespec) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_get)), 3, uintptr(port), uintptr(unsafe.Pointer(pe)), uintptr(unsafe.Pointer(timeout)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2078,7 +2077,7 @@ func port_getn(port int, pe *portEvent, max uint32, nget *uint32, timeout *Times r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_getn)), 5, uintptr(port), uintptr(unsafe.Pointer(pe)), uintptr(max), uintptr(unsafe.Pointer(nget)), uintptr(unsafe.Pointer(timeout)), 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2088,7 +2087,7 @@ func port_getn(port int, pe *portEvent, max uint32, nget *uint32, timeout *Times func putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procputmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2098,7 +2097,7 @@ func putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) { func getmsg(fd int, clptr *strbuf, dataptr *strbuf, flags *int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgetmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(unsafe.Pointer(flags)), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go index c3168174..94f01123 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build zos && s390x -// +build zos,s390x package unix @@ -40,17 +39,6 @@ func read(fd int, p []byte) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func write(fd int, p []byte) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go index 55e04847..3a58ae81 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build 386 && openbsd -// +build 386,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go index d2243cf8..dcb7a0eb 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build amd64 && openbsd -// +build amd64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go index 82dc51bd..db5a7bf1 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build arm && openbsd -// +build arm,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go index cbdda1a4..7be575a7 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build arm64 && openbsd -// +build arm64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go index f55eae1a..d6e3174c 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build mips64 && openbsd -// +build mips64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go index e4405447..ee97157d 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build ppc64 && openbsd -// +build ppc64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go index a0db82fc..35c3b91d 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build riscv64 && openbsd -// +build riscv64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go index f8298ff9..5edda768 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && darwin -// +build amd64,darwin package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go index 5eb433bb..0dc9e8b4 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && darwin -// +build arm64,darwin package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go index 703675c0..308ddf3a 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && dragonfly -// +build amd64,dragonfly package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go index 4e0d9610..418664e3 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && freebsd -// +build 386,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go index 01636b83..34d0b86d 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && freebsd -// +build amd64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go index ad99bc10..b71cf45e 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && freebsd -// +build arm,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go index 89dcc427..e32df1c1 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && freebsd -// +build arm64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go index ee37aaa0..15ad6111 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && freebsd -// +build riscv64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go index c9c4ad03..fcf3ecbd 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && linux -// +build 386,linux package unix @@ -447,4 +446,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go index 12ff3417..f56dc250 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && linux -// +build amd64,linux package unix @@ -369,4 +368,7 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 + SYS_MAP_SHADOW_STACK = 453 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go index c3fb5e77..974bf246 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && linux -// +build arm,linux package unix @@ -411,4 +410,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go index 358c847a..39a2739e 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && linux -// +build arm64,linux package unix @@ -314,4 +313,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go index 81c4849b..cf9c9d77 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build loong64 && linux -// +build loong64,linux package unix @@ -308,4 +307,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go index 202a57e9..10b7362e 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips && linux -// +build mips,linux package unix @@ -431,4 +430,6 @@ const ( SYS_PROCESS_MRELEASE = 4448 SYS_FUTEX_WAITV = 4449 SYS_SET_MEMPOLICY_HOME_NODE = 4450 + SYS_CACHESTAT = 4451 + SYS_FCHMODAT2 = 4452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go index 1fbceb52..cd4d8b4f 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && linux -// +build mips64,linux package unix @@ -361,4 +360,6 @@ const ( SYS_PROCESS_MRELEASE = 5448 SYS_FUTEX_WAITV = 5449 SYS_SET_MEMPOLICY_HOME_NODE = 5450 + SYS_CACHESTAT = 5451 + SYS_FCHMODAT2 = 5452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go index b4ffb7a2..2c0efca8 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64le && linux -// +build mips64le,linux package unix @@ -361,4 +360,6 @@ const ( SYS_PROCESS_MRELEASE = 5448 SYS_FUTEX_WAITV = 5449 SYS_SET_MEMPOLICY_HOME_NODE = 5450 + SYS_CACHESTAT = 5451 + SYS_FCHMODAT2 = 5452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go index 867985f9..a72e31d3 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mipsle && linux -// +build mipsle,linux package unix @@ -431,4 +430,6 @@ const ( SYS_PROCESS_MRELEASE = 4448 SYS_FUTEX_WAITV = 4449 SYS_SET_MEMPOLICY_HOME_NODE = 4450 + SYS_CACHESTAT = 4451 + SYS_FCHMODAT2 = 4452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go index a8cce69e..c7d1e374 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && linux -// +build ppc,linux package unix @@ -438,4 +437,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go index d44c5b39..f4d4838c 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && linux -// +build ppc64,linux package unix @@ -410,4 +409,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go index 4214dd9c..b64f0e59 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64le && linux -// +build ppc64le,linux package unix @@ -410,4 +409,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go index 3e594a8c..95711195 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && linux -// +build riscv64,linux package unix @@ -251,6 +250,8 @@ const ( SYS_ACCEPT4 = 242 SYS_RECVMMSG = 243 SYS_ARCH_SPECIFIC_SYSCALL = 244 + SYS_RISCV_HWPROBE = 258 + SYS_RISCV_FLUSH_ICACHE = 259 SYS_WAIT4 = 260 SYS_PRLIMIT64 = 261 SYS_FANOTIFY_INIT = 262 @@ -313,4 +314,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go index 7ea46520..f94e943b 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build s390x && linux -// +build s390x,linux package unix @@ -372,7 +371,10 @@ const ( SYS_LANDLOCK_CREATE_RULESET = 444 SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 + SYS_MEMFD_SECRET = 447 SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go index 92f628ef..ba0c2bc5 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build sparc64 && linux -// +build sparc64,linux package unix @@ -389,4 +388,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go index 3a6699eb..b2aa8cd4 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && netbsd -// +build 386,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go index 5677cd4f..524a1b1c 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && netbsd -// +build amd64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go index e784cb6d..d59b943a 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && netbsd -// +build arm,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go index bd4952ef..31e771d5 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build arm64 && netbsd -// +build arm64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go index 59773381..9fd77c6c 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && openbsd -// +build 386,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go index 16af2918..af10af28 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && openbsd -// +build amd64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go index f59b18a9..cc2028af 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && openbsd -// +build arm,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go index 721ef591..c06dd441 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && openbsd -// +build arm64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go index 01c43a01..9ddbf3e0 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && openbsd -// +build mips64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go index f258cfa2..19a6ee41 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && openbsd -// +build ppc64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go index 07919e0e..05192a78 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && openbsd -// +build riscv64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go index 073daad4..b2e30858 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go index 7a8161c1..3e6d57ca 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && aix -// +build ppc,aix package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go index 07ed733c..3a219bdc 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && aix -// +build ppc64,aix package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go index 690cefc3..091d107f 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && darwin -// +build amd64,darwin package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go index 5bffc10e..28ff4ef7 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && darwin -// +build arm64,darwin package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go index d0ba8e9b..30e405bb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && dragonfly -// +build amd64,dragonfly package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go index 29dc4833..6cbd094a 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && freebsd -// +build 386,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go index 0a89b289..7c03b6ee 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && freebsd -// +build amd64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go index c8666bb1..422107ee 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && freebsd -// +build arm,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go index 88fb48a8..505a12ac 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && freebsd -// +build arm64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go index 698dc975..cc986c79 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && freebsd -// +build riscv64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index ca84727c..bbf8399f 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -1,7 +1,6 @@ // Code generated by mkmerge; DO NOT EDIT. //go:build linux -// +build linux package unix @@ -866,6 +865,11 @@ const ( POLLNVAL = 0x20 ) +type sigset_argpack struct { + ss *Sigset_t + ssLen uintptr +} + type SignalfdSiginfo struct { Signo uint32 Errno int32 @@ -1538,6 +1542,10 @@ const ( IFLA_GRO_MAX_SIZE = 0x3a IFLA_TSO_MAX_SIZE = 0x3b IFLA_TSO_MAX_SEGS = 0x3c + IFLA_ALLMULTI = 0x3d + IFLA_DEVLINK_PORT = 0x3e + IFLA_GSO_IPV4_MAX_SIZE = 0x3f + IFLA_GRO_IPV4_MAX_SIZE = 0x40 IFLA_PROTO_DOWN_REASON_UNSPEC = 0x0 IFLA_PROTO_DOWN_REASON_MASK = 0x1 IFLA_PROTO_DOWN_REASON_VALUE = 0x2 @@ -1968,7 +1976,7 @@ const ( NFT_MSG_GETFLOWTABLE = 0x17 NFT_MSG_DELFLOWTABLE = 0x18 NFT_MSG_GETRULE_RESET = 0x19 - NFT_MSG_MAX = 0x1a + NFT_MSG_MAX = 0x22 NFTA_LIST_UNSPEC = 0x0 NFTA_LIST_ELEM = 0x1 NFTA_HOOK_UNSPEC = 0x0 @@ -2555,6 +2563,11 @@ const ( BPF_REG_8 = 0x8 BPF_REG_9 = 0x9 BPF_REG_10 = 0xa + BPF_CGROUP_ITER_ORDER_UNSPEC = 0x0 + BPF_CGROUP_ITER_SELF_ONLY = 0x1 + BPF_CGROUP_ITER_DESCENDANTS_PRE = 0x2 + BPF_CGROUP_ITER_DESCENDANTS_POST = 0x3 + BPF_CGROUP_ITER_ANCESTORS_UP = 0x4 BPF_MAP_CREATE = 0x0 BPF_MAP_LOOKUP_ELEM = 0x1 BPF_MAP_UPDATE_ELEM = 0x2 @@ -2566,6 +2579,7 @@ const ( BPF_PROG_ATTACH = 0x8 BPF_PROG_DETACH = 0x9 BPF_PROG_TEST_RUN = 0xa + BPF_PROG_RUN = 0xa BPF_PROG_GET_NEXT_ID = 0xb BPF_MAP_GET_NEXT_ID = 0xc BPF_PROG_GET_FD_BY_ID = 0xd @@ -2610,6 +2624,7 @@ const ( BPF_MAP_TYPE_CPUMAP = 0x10 BPF_MAP_TYPE_XSKMAP = 0x11 BPF_MAP_TYPE_SOCKHASH = 0x12 + BPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATED = 0x13 BPF_MAP_TYPE_CGROUP_STORAGE = 0x13 BPF_MAP_TYPE_REUSEPORT_SOCKARRAY = 0x14 BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE = 0x15 @@ -2620,6 +2635,10 @@ const ( BPF_MAP_TYPE_STRUCT_OPS = 0x1a BPF_MAP_TYPE_RINGBUF = 0x1b BPF_MAP_TYPE_INODE_STORAGE = 0x1c + BPF_MAP_TYPE_TASK_STORAGE = 0x1d + BPF_MAP_TYPE_BLOOM_FILTER = 0x1e + BPF_MAP_TYPE_USER_RINGBUF = 0x1f + BPF_MAP_TYPE_CGRP_STORAGE = 0x20 BPF_PROG_TYPE_UNSPEC = 0x0 BPF_PROG_TYPE_SOCKET_FILTER = 0x1 BPF_PROG_TYPE_KPROBE = 0x2 @@ -2651,6 +2670,8 @@ const ( BPF_PROG_TYPE_EXT = 0x1c BPF_PROG_TYPE_LSM = 0x1d BPF_PROG_TYPE_SK_LOOKUP = 0x1e + BPF_PROG_TYPE_SYSCALL = 0x1f + BPF_PROG_TYPE_NETFILTER = 0x20 BPF_CGROUP_INET_INGRESS = 0x0 BPF_CGROUP_INET_EGRESS = 0x1 BPF_CGROUP_INET_SOCK_CREATE = 0x2 @@ -2689,6 +2710,17 @@ const ( BPF_XDP_CPUMAP = 0x23 BPF_SK_LOOKUP = 0x24 BPF_XDP = 0x25 + BPF_SK_SKB_VERDICT = 0x26 + BPF_SK_REUSEPORT_SELECT = 0x27 + BPF_SK_REUSEPORT_SELECT_OR_MIGRATE = 0x28 + BPF_PERF_EVENT = 0x29 + BPF_TRACE_KPROBE_MULTI = 0x2a + BPF_LSM_CGROUP = 0x2b + BPF_STRUCT_OPS = 0x2c + BPF_NETFILTER = 0x2d + BPF_TCX_INGRESS = 0x2e + BPF_TCX_EGRESS = 0x2f + BPF_TRACE_UPROBE_MULTI = 0x30 BPF_LINK_TYPE_UNSPEC = 0x0 BPF_LINK_TYPE_RAW_TRACEPOINT = 0x1 BPF_LINK_TYPE_TRACING = 0x2 @@ -2696,6 +2728,21 @@ const ( BPF_LINK_TYPE_ITER = 0x4 BPF_LINK_TYPE_NETNS = 0x5 BPF_LINK_TYPE_XDP = 0x6 + BPF_LINK_TYPE_PERF_EVENT = 0x7 + BPF_LINK_TYPE_KPROBE_MULTI = 0x8 + BPF_LINK_TYPE_STRUCT_OPS = 0x9 + BPF_LINK_TYPE_NETFILTER = 0xa + BPF_LINK_TYPE_TCX = 0xb + BPF_LINK_TYPE_UPROBE_MULTI = 0xc + BPF_PERF_EVENT_UNSPEC = 0x0 + BPF_PERF_EVENT_UPROBE = 0x1 + BPF_PERF_EVENT_URETPROBE = 0x2 + BPF_PERF_EVENT_KPROBE = 0x3 + BPF_PERF_EVENT_KRETPROBE = 0x4 + BPF_PERF_EVENT_TRACEPOINT = 0x5 + BPF_PERF_EVENT_EVENT = 0x6 + BPF_F_KPROBE_MULTI_RETURN = 0x1 + BPF_F_UPROBE_MULTI_RETURN = 0x1 BPF_ANY = 0x0 BPF_NOEXIST = 0x1 BPF_EXIST = 0x2 @@ -2713,6 +2760,8 @@ const ( BPF_F_MMAPABLE = 0x400 BPF_F_PRESERVE_ELEMS = 0x800 BPF_F_INNER_MAP = 0x1000 + BPF_F_LINK = 0x2000 + BPF_F_PATH_FD = 0x4000 BPF_STATS_RUN_TIME = 0x0 BPF_STACK_BUILD_ID_EMPTY = 0x0 BPF_STACK_BUILD_ID_VALID = 0x1 @@ -2733,6 +2782,8 @@ const ( BPF_F_ZERO_CSUM_TX = 0x2 BPF_F_DONT_FRAGMENT = 0x4 BPF_F_SEQ_NUMBER = 0x8 + BPF_F_NO_TUNNEL_KEY = 0x10 + BPF_F_TUNINFO_FLAGS = 0x10 BPF_F_INDEX_MASK = 0xffffffff BPF_F_CURRENT_CPU = 0xffffffff BPF_F_CTXLEN_MASK = 0xfffff00000000 @@ -2747,6 +2798,9 @@ const ( BPF_F_ADJ_ROOM_ENCAP_L4_GRE = 0x8 BPF_F_ADJ_ROOM_ENCAP_L4_UDP = 0x10 BPF_F_ADJ_ROOM_NO_CSUM_RESET = 0x20 + BPF_F_ADJ_ROOM_ENCAP_L2_ETH = 0x40 + BPF_F_ADJ_ROOM_DECAP_L3_IPV4 = 0x80 + BPF_F_ADJ_ROOM_DECAP_L3_IPV6 = 0x100 BPF_ADJ_ROOM_ENCAP_L2_MASK = 0xff BPF_ADJ_ROOM_ENCAP_L2_SHIFT = 0x38 BPF_F_SYSCTL_BASE_NAME = 0x1 @@ -2771,10 +2825,16 @@ const ( BPF_LWT_ENCAP_SEG6 = 0x0 BPF_LWT_ENCAP_SEG6_INLINE = 0x1 BPF_LWT_ENCAP_IP = 0x2 + BPF_F_BPRM_SECUREEXEC = 0x1 + BPF_F_BROADCAST = 0x8 + BPF_F_EXCLUDE_INGRESS = 0x10 + BPF_SKB_TSTAMP_UNSPEC = 0x0 + BPF_SKB_TSTAMP_DELIVERY_MONO = 0x1 BPF_OK = 0x0 BPF_DROP = 0x2 BPF_REDIRECT = 0x7 BPF_LWT_REROUTE = 0x80 + BPF_FLOW_DISSECTOR_CONTINUE = 0x81 BPF_SOCK_OPS_RTO_CB_FLAG = 0x1 BPF_SOCK_OPS_RETRANS_CB_FLAG = 0x2 BPF_SOCK_OPS_STATE_CB_FLAG = 0x4 @@ -2829,6 +2889,8 @@ const ( BPF_DEVCG_DEV_CHAR = 0x2 BPF_FIB_LOOKUP_DIRECT = 0x1 BPF_FIB_LOOKUP_OUTPUT = 0x2 + BPF_FIB_LOOKUP_SKIP_NEIGH = 0x4 + BPF_FIB_LOOKUP_TBID = 0x8 BPF_FIB_LKUP_RET_SUCCESS = 0x0 BPF_FIB_LKUP_RET_BLACKHOLE = 0x1 BPF_FIB_LKUP_RET_UNREACHABLE = 0x2 @@ -2838,6 +2900,10 @@ const ( BPF_FIB_LKUP_RET_UNSUPP_LWT = 0x6 BPF_FIB_LKUP_RET_NO_NEIGH = 0x7 BPF_FIB_LKUP_RET_FRAG_NEEDED = 0x8 + BPF_MTU_CHK_SEGS = 0x1 + BPF_MTU_CHK_RET_SUCCESS = 0x0 + BPF_MTU_CHK_RET_FRAG_NEEDED = 0x1 + BPF_MTU_CHK_RET_SEGS_TOOBIG = 0x2 BPF_FD_TYPE_RAW_TRACEPOINT = 0x0 BPF_FD_TYPE_TRACEPOINT = 0x1 BPF_FD_TYPE_KPROBE = 0x2 @@ -2847,6 +2913,20 @@ const ( BPF_FLOW_DISSECTOR_F_PARSE_1ST_FRAG = 0x1 BPF_FLOW_DISSECTOR_F_STOP_AT_FLOW_LABEL = 0x2 BPF_FLOW_DISSECTOR_F_STOP_AT_ENCAP = 0x4 + BPF_CORE_FIELD_BYTE_OFFSET = 0x0 + BPF_CORE_FIELD_BYTE_SIZE = 0x1 + BPF_CORE_FIELD_EXISTS = 0x2 + BPF_CORE_FIELD_SIGNED = 0x3 + BPF_CORE_FIELD_LSHIFT_U64 = 0x4 + BPF_CORE_FIELD_RSHIFT_U64 = 0x5 + BPF_CORE_TYPE_ID_LOCAL = 0x6 + BPF_CORE_TYPE_ID_TARGET = 0x7 + BPF_CORE_TYPE_EXISTS = 0x8 + BPF_CORE_TYPE_SIZE = 0x9 + BPF_CORE_ENUMVAL_EXISTS = 0xa + BPF_CORE_ENUMVAL_VALUE = 0xb + BPF_CORE_TYPE_MATCHES = 0xc + BPF_F_TIMER_ABS = 0x1 ) const ( @@ -2925,6 +3005,12 @@ type LoopInfo64 struct { Encrypt_key [32]uint8 Init [2]uint64 } +type LoopConfig struct { + Fd uint32 + Size uint32 + Info LoopInfo64 + _ [8]uint64 +} type TIPCSocketAddr struct { Ref uint32 @@ -3605,7 +3691,7 @@ const ( ETHTOOL_MSG_PSE_GET = 0x24 ETHTOOL_MSG_PSE_SET = 0x25 ETHTOOL_MSG_RSS_GET = 0x26 - ETHTOOL_MSG_USER_MAX = 0x26 + ETHTOOL_MSG_USER_MAX = 0x2b ETHTOOL_MSG_KERNEL_NONE = 0x0 ETHTOOL_MSG_STRSET_GET_REPLY = 0x1 ETHTOOL_MSG_LINKINFO_GET_REPLY = 0x2 @@ -3645,7 +3731,7 @@ const ( ETHTOOL_MSG_MODULE_NTF = 0x24 ETHTOOL_MSG_PSE_GET_REPLY = 0x25 ETHTOOL_MSG_RSS_GET_REPLY = 0x26 - ETHTOOL_MSG_KERNEL_MAX = 0x26 + ETHTOOL_MSG_KERNEL_MAX = 0x2b ETHTOOL_A_HEADER_UNSPEC = 0x0 ETHTOOL_A_HEADER_DEV_INDEX = 0x1 ETHTOOL_A_HEADER_DEV_NAME = 0x2 @@ -3749,7 +3835,7 @@ const ( ETHTOOL_A_RINGS_TCP_DATA_SPLIT = 0xb ETHTOOL_A_RINGS_CQE_SIZE = 0xc ETHTOOL_A_RINGS_TX_PUSH = 0xd - ETHTOOL_A_RINGS_MAX = 0xd + ETHTOOL_A_RINGS_MAX = 0x10 ETHTOOL_A_CHANNELS_UNSPEC = 0x0 ETHTOOL_A_CHANNELS_HEADER = 0x1 ETHTOOL_A_CHANNELS_RX_MAX = 0x2 @@ -3787,14 +3873,14 @@ const ( ETHTOOL_A_COALESCE_RATE_SAMPLE_INTERVAL = 0x17 ETHTOOL_A_COALESCE_USE_CQE_MODE_TX = 0x18 ETHTOOL_A_COALESCE_USE_CQE_MODE_RX = 0x19 - ETHTOOL_A_COALESCE_MAX = 0x19 + ETHTOOL_A_COALESCE_MAX = 0x1c ETHTOOL_A_PAUSE_UNSPEC = 0x0 ETHTOOL_A_PAUSE_HEADER = 0x1 ETHTOOL_A_PAUSE_AUTONEG = 0x2 ETHTOOL_A_PAUSE_RX = 0x3 ETHTOOL_A_PAUSE_TX = 0x4 ETHTOOL_A_PAUSE_STATS = 0x5 - ETHTOOL_A_PAUSE_MAX = 0x5 + ETHTOOL_A_PAUSE_MAX = 0x6 ETHTOOL_A_PAUSE_STAT_UNSPEC = 0x0 ETHTOOL_A_PAUSE_STAT_PAD = 0x1 ETHTOOL_A_PAUSE_STAT_TX_FRAMES = 0x2 @@ -4444,7 +4530,7 @@ const ( NL80211_ATTR_MAC_HINT = 0xc8 NL80211_ATTR_MAC_MASK = 0xd7 NL80211_ATTR_MAX_AP_ASSOC_STA = 0xca - NL80211_ATTR_MAX = 0x141 + NL80211_ATTR_MAX = 0x146 NL80211_ATTR_MAX_CRIT_PROT_DURATION = 0xb4 NL80211_ATTR_MAX_CSA_COUNTERS = 0xce NL80211_ATTR_MAX_MATCH_SETS = 0x85 @@ -4673,7 +4759,7 @@ const ( NL80211_BAND_ATTR_HT_CAPA = 0x4 NL80211_BAND_ATTR_HT_MCS_SET = 0x3 NL80211_BAND_ATTR_IFTYPE_DATA = 0x9 - NL80211_BAND_ATTR_MAX = 0xb + NL80211_BAND_ATTR_MAX = 0xd NL80211_BAND_ATTR_RATES = 0x2 NL80211_BAND_ATTR_VHT_CAPA = 0x8 NL80211_BAND_ATTR_VHT_MCS_SET = 0x7 @@ -4814,7 +4900,7 @@ const ( NL80211_CMD_LEAVE_IBSS = 0x2c NL80211_CMD_LEAVE_MESH = 0x45 NL80211_CMD_LEAVE_OCB = 0x6d - NL80211_CMD_MAX = 0x98 + NL80211_CMD_MAX = 0x9a NL80211_CMD_MICHAEL_MIC_FAILURE = 0x29 NL80211_CMD_MODIFY_LINK_STA = 0x97 NL80211_CMD_NAN_MATCH = 0x78 @@ -5448,7 +5534,7 @@ const ( NL80211_RATE_INFO_HE_RU_ALLOC_52 = 0x1 NL80211_RATE_INFO_HE_RU_ALLOC_996 = 0x5 NL80211_RATE_INFO_HE_RU_ALLOC = 0x11 - NL80211_RATE_INFO_MAX = 0x16 + NL80211_RATE_INFO_MAX = 0x1d NL80211_RATE_INFO_MCS = 0x2 NL80211_RATE_INFO_SHORT_GI = 0x4 NL80211_RATE_INFO_VHT_MCS = 0x6 @@ -5795,6 +5881,8 @@ const ( TUN_F_TSO6 = 0x4 TUN_F_TSO_ECN = 0x8 TUN_F_UFO = 0x10 + TUN_F_USO4 = 0x20 + TUN_F_USO6 = 0x40 ) const ( @@ -5804,9 +5892,37 @@ const ( ) const ( - VIRTIO_NET_HDR_GSO_NONE = 0x0 - VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 - VIRTIO_NET_HDR_GSO_UDP = 0x3 - VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 - VIRTIO_NET_HDR_GSO_ECN = 0x80 + VIRTIO_NET_HDR_GSO_NONE = 0x0 + VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 + VIRTIO_NET_HDR_GSO_UDP = 0x3 + VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 + VIRTIO_NET_HDR_GSO_UDP_L4 = 0x5 + VIRTIO_NET_HDR_GSO_ECN = 0x80 ) + +type SchedAttr struct { + Size uint32 + Policy uint32 + Flags uint64 + Nice int32 + Priority uint32 + Runtime uint64 + Deadline uint64 + Period uint64 + Util_min uint32 + Util_max uint32 +} + +const SizeofSchedAttr = 0x38 + +type Cachestat_t struct { + Cache uint64 + Dirty uint64 + Writeback uint64 + Evicted uint64 + Recently_evicted uint64 +} +type CachestatRange struct { + Off uint64 + Len uint64 +} diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go index 4ecc1495..438a30af 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && linux -// +build 386,linux package unix @@ -337,6 +336,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go index 34fddff9..adceca35 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && linux -// +build amd64,linux package unix @@ -350,6 +349,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go index 3b14a603..eeaa00a3 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && linux -// +build arm,linux package unix @@ -328,6 +327,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go index 0517651a..6739aa91 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && linux -// +build arm64,linux package unix @@ -329,6 +328,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go index 3b0c5181..9920ef63 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build loong64 && linux -// +build loong64,linux package unix @@ -330,6 +329,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go index fccdf4dd..2923b799 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips && linux -// +build mips,linux package unix @@ -333,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go index 500de8fc..ce2750ee 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && linux -// +build mips64,linux package unix @@ -332,6 +331,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go index d0434cd2..3038811d 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64le && linux -// +build mips64le,linux package unix @@ -332,6 +331,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go index 84206ba5..efc6fed1 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mipsle && linux -// +build mipsle,linux package unix @@ -333,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go index ab078cf1..9a654b75 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && linux -// +build ppc,linux package unix @@ -340,6 +339,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go index 42eb2c4c..40d358e3 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && linux -// +build ppc64,linux package unix @@ -339,6 +338,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go index 31304a4e..148c6ceb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64le && linux -// +build ppc64le,linux package unix @@ -339,6 +338,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go index c311f961..72ba8154 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && linux -// +build riscv64,linux package unix @@ -357,6 +356,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -716,3 +717,30 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +type RISCVHWProbePairs struct { + Key int64 + Value uint64 +} + +const ( + RISCV_HWPROBE_KEY_MVENDORID = 0x0 + RISCV_HWPROBE_KEY_MARCHID = 0x1 + RISCV_HWPROBE_KEY_MIMPID = 0x2 + RISCV_HWPROBE_KEY_BASE_BEHAVIOR = 0x3 + RISCV_HWPROBE_BASE_BEHAVIOR_IMA = 0x1 + RISCV_HWPROBE_KEY_IMA_EXT_0 = 0x4 + RISCV_HWPROBE_IMA_FD = 0x1 + RISCV_HWPROBE_IMA_C = 0x2 + RISCV_HWPROBE_IMA_V = 0x4 + RISCV_HWPROBE_EXT_ZBA = 0x8 + RISCV_HWPROBE_EXT_ZBB = 0x10 + RISCV_HWPROBE_EXT_ZBS = 0x20 + RISCV_HWPROBE_KEY_CPUPERF_0 = 0x5 + RISCV_HWPROBE_MISALIGNED_UNKNOWN = 0x0 + RISCV_HWPROBE_MISALIGNED_EMULATED = 0x1 + RISCV_HWPROBE_MISALIGNED_SLOW = 0x2 + RISCV_HWPROBE_MISALIGNED_FAST = 0x3 + RISCV_HWPROBE_MISALIGNED_UNSUPPORTED = 0x4 + RISCV_HWPROBE_MISALIGNED_MASK = 0x7 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go index bba3cefa..71e76550 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build s390x && linux -// +build s390x,linux package unix @@ -352,6 +351,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go index ad8a0138..4abbdb9d 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build sparc64 && linux -// +build sparc64,linux package unix @@ -334,6 +333,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go index 9bc4c8f9..f22e7947 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && netbsd -// +build 386,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go index bb05f655..066a7d83 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && netbsd -// +build amd64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go index db40e3a1..439548ec 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && netbsd -// +build arm,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go index 11121151..16085d3b 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && netbsd -// +build arm64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go index 26eba23b..afd13a3a 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && openbsd -// +build 386,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go index 5a547988..5d97f1f9 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && openbsd -// +build amd64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go index be58c4e1..34871cdc 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && openbsd -// +build arm,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go index 52338266..5911bceb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && openbsd -// +build arm64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go index 605cfdb1..e4f24f3b 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && openbsd -// +build mips64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go index d6724c01..ca50a793 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && openbsd -// +build ppc64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go index ddfd27a4..d7d7f790 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && openbsd -// +build riscv64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go index 0400747c..14160576 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && solaris -// +build amd64,solaris package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go index aec1efcb..54f31be6 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x // Hand edited based on ztypes_linux_s390x.go // TODO: auto-generate. diff --git a/vendor/golang.org/x/sys/windows/aliases.go b/vendor/golang.org/x/sys/windows/aliases.go index a20ebea6..ce2d713d 100644 --- a/vendor/golang.org/x/sys/windows/aliases.go +++ b/vendor/golang.org/x/sys/windows/aliases.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows && go1.9 -// +build windows,go1.9 package windows diff --git a/vendor/golang.org/x/sys/windows/empty.s b/vendor/golang.org/x/sys/windows/empty.s index fdbbbcd3..ba64caca 100644 --- a/vendor/golang.org/x/sys/windows/empty.s +++ b/vendor/golang.org/x/sys/windows/empty.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !go1.12 -// +build !go1.12 // This file is here to allow bodyless functions with go:linkname for Go 1.11 // and earlier (see https://golang.org/issue/23311). diff --git a/vendor/golang.org/x/sys/windows/eventlog.go b/vendor/golang.org/x/sys/windows/eventlog.go index 2cd60645..6c366955 100644 --- a/vendor/golang.org/x/sys/windows/eventlog.go +++ b/vendor/golang.org/x/sys/windows/eventlog.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows -// +build windows package windows diff --git a/vendor/golang.org/x/sys/windows/exec_windows.go b/vendor/golang.org/x/sys/windows/exec_windows.go index a52e0331..9cabbb69 100644 --- a/vendor/golang.org/x/sys/windows/exec_windows.go +++ b/vendor/golang.org/x/sys/windows/exec_windows.go @@ -22,7 +22,7 @@ import ( // but only if there is space or tab inside s. func EscapeArg(s string) string { if len(s) == 0 { - return "\"\"" + return `""` } n := len(s) hasSpace := false @@ -35,7 +35,7 @@ func EscapeArg(s string) string { } } if hasSpace { - n += 2 + n += 2 // Reserve space for quotes. } if n == len(s) { return s @@ -82,20 +82,68 @@ func EscapeArg(s string) string { // in CreateProcess's CommandLine argument, CreateService/ChangeServiceConfig's BinaryPathName argument, // or any program that uses CommandLineToArgv. func ComposeCommandLine(args []string) string { - var commandLine string - for i := range args { - if i > 0 { - commandLine += " " + if len(args) == 0 { + return "" + } + + // Per https://learn.microsoft.com/en-us/windows/win32/api/shellapi/nf-shellapi-commandlinetoargvw: + // “This function accepts command lines that contain a program name; the + // program name can be enclosed in quotation marks or not.” + // + // Unfortunately, it provides no means of escaping interior quotation marks + // within that program name, and we have no way to report them here. + prog := args[0] + mustQuote := len(prog) == 0 + for i := 0; i < len(prog); i++ { + c := prog[i] + if c <= ' ' || (c == '"' && i == 0) { + // Force quotes for not only the ASCII space and tab as described in the + // MSDN article, but also ASCII control characters. + // The documentation for CommandLineToArgvW doesn't say what happens when + // the first argument is not a valid program name, but it empirically + // seems to drop unquoted control characters. + mustQuote = true + break + } + } + var commandLine []byte + if mustQuote { + commandLine = make([]byte, 0, len(prog)+2) + commandLine = append(commandLine, '"') + for i := 0; i < len(prog); i++ { + c := prog[i] + if c == '"' { + // This quote would interfere with our surrounding quotes. + // We have no way to report an error, so just strip out + // the offending character instead. + continue + } + commandLine = append(commandLine, c) } - commandLine += EscapeArg(args[i]) + commandLine = append(commandLine, '"') + } else { + if len(args) == 1 { + // args[0] is a valid command line representing itself. + // No need to allocate a new slice or string for it. + return prog + } + commandLine = []byte(prog) } - return commandLine + + for _, arg := range args[1:] { + commandLine = append(commandLine, ' ') + // TODO(bcmills): since we're already appending to a slice, it would be nice + // to avoid the intermediate allocations of EscapeArg. + // Perhaps we can factor out an appendEscapedArg function. + commandLine = append(commandLine, EscapeArg(arg)...) + } + return string(commandLine) } // DecomposeCommandLine breaks apart its argument command line into unescaped parts using CommandLineToArgv, // as gathered from GetCommandLine, QUERY_SERVICE_CONFIG's BinaryPathName argument, or elsewhere that // command lines are passed around. -// DecomposeCommandLine returns error if commandLine contains NUL. +// DecomposeCommandLine returns an error if commandLine contains NUL. func DecomposeCommandLine(commandLine string) ([]string, error) { if len(commandLine) == 0 { return []string{}, nil @@ -105,18 +153,35 @@ func DecomposeCommandLine(commandLine string) ([]string, error) { return nil, errorspkg.New("string with NUL passed to DecomposeCommandLine") } var argc int32 - argv, err := CommandLineToArgv(&utf16CommandLine[0], &argc) + argv, err := commandLineToArgv(&utf16CommandLine[0], &argc) if err != nil { return nil, err } defer LocalFree(Handle(unsafe.Pointer(argv))) + var args []string - for _, v := range (*argv)[:argc] { - args = append(args, UTF16ToString((*v)[:])) + for _, p := range unsafe.Slice(argv, argc) { + args = append(args, UTF16PtrToString(p)) } return args, nil } +// CommandLineToArgv parses a Unicode command line string and sets +// argc to the number of parsed arguments. +// +// The returned memory should be freed using a single call to LocalFree. +// +// Note that although the return type of CommandLineToArgv indicates 8192 +// entries of up to 8192 characters each, the actual count of parsed arguments +// may exceed 8192, and the documentation for CommandLineToArgvW does not mention +// any bound on the lengths of the individual argument strings. +// (See https://go.dev/issue/63236.) +func CommandLineToArgv(cmd *uint16, argc *int32) (argv *[8192]*[8192]uint16, err error) { + argp, err := commandLineToArgv(cmd, argc) + argv = (*[8192]*[8192]uint16)(unsafe.Pointer(argp)) + return argv, err +} + func CloseOnExec(fd Handle) { SetHandleInformation(Handle(fd), HANDLE_FLAG_INHERIT, 0) } diff --git a/vendor/golang.org/x/sys/windows/mksyscall.go b/vendor/golang.org/x/sys/windows/mksyscall.go index 8563f79c..dbcdb090 100644 --- a/vendor/golang.org/x/sys/windows/mksyscall.go +++ b/vendor/golang.org/x/sys/windows/mksyscall.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build generate -// +build generate package windows diff --git a/vendor/golang.org/x/sys/windows/race.go b/vendor/golang.org/x/sys/windows/race.go index 9196b089..0f1bdc38 100644 --- a/vendor/golang.org/x/sys/windows/race.go +++ b/vendor/golang.org/x/sys/windows/race.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows && race -// +build windows,race package windows diff --git a/vendor/golang.org/x/sys/windows/race0.go b/vendor/golang.org/x/sys/windows/race0.go index 7bae4817..0c78da78 100644 --- a/vendor/golang.org/x/sys/windows/race0.go +++ b/vendor/golang.org/x/sys/windows/race0.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows && !race -// +build windows,!race package windows diff --git a/vendor/golang.org/x/sys/windows/security_windows.go b/vendor/golang.org/x/sys/windows/security_windows.go index d414ef13..26be94a8 100644 --- a/vendor/golang.org/x/sys/windows/security_windows.go +++ b/vendor/golang.org/x/sys/windows/security_windows.go @@ -7,8 +7,6 @@ package windows import ( "syscall" "unsafe" - - "golang.org/x/sys/internal/unsafeheader" ) const ( @@ -1341,21 +1339,14 @@ func (selfRelativeSD *SECURITY_DESCRIPTOR) copySelfRelativeSecurityDescriptor() sdLen = min } - var src []byte - h := (*unsafeheader.Slice)(unsafe.Pointer(&src)) - h.Data = unsafe.Pointer(selfRelativeSD) - h.Len = sdLen - h.Cap = sdLen - + src := unsafe.Slice((*byte)(unsafe.Pointer(selfRelativeSD)), sdLen) + // SECURITY_DESCRIPTOR has pointers in it, which means checkptr expects for it to + // be aligned properly. When we're copying a Windows-allocated struct to a + // Go-allocated one, make sure that the Go allocation is aligned to the + // pointer size. const psize = int(unsafe.Sizeof(uintptr(0))) - - var dst []byte - h = (*unsafeheader.Slice)(unsafe.Pointer(&dst)) alloc := make([]uintptr, (sdLen+psize-1)/psize) - h.Data = (*unsafeheader.Slice)(unsafe.Pointer(&alloc)).Data - h.Len = sdLen - h.Cap = sdLen - + dst := unsafe.Slice((*byte)(unsafe.Pointer(&alloc[0])), sdLen) copy(dst, src) return (*SECURITY_DESCRIPTOR)(unsafe.Pointer(&dst[0])) } diff --git a/vendor/golang.org/x/sys/windows/service.go b/vendor/golang.org/x/sys/windows/service.go index c964b684..a9dc6308 100644 --- a/vendor/golang.org/x/sys/windows/service.go +++ b/vendor/golang.org/x/sys/windows/service.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows -// +build windows package windows @@ -218,6 +217,10 @@ type SERVICE_FAILURE_ACTIONS struct { Actions *SC_ACTION } +type SERVICE_FAILURE_ACTIONS_FLAG struct { + FailureActionsOnNonCrashFailures int32 +} + type SC_ACTION struct { Type uint32 Delay uint32 diff --git a/vendor/golang.org/x/sys/windows/str.go b/vendor/golang.org/x/sys/windows/str.go index 4fc01434..6a4f9ce6 100644 --- a/vendor/golang.org/x/sys/windows/str.go +++ b/vendor/golang.org/x/sys/windows/str.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows -// +build windows package windows diff --git a/vendor/golang.org/x/sys/windows/syscall.go b/vendor/golang.org/x/sys/windows/syscall.go index 8732cdb9..e85ed6b9 100644 --- a/vendor/golang.org/x/sys/windows/syscall.go +++ b/vendor/golang.org/x/sys/windows/syscall.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows -// +build windows // Package windows contains an interface to the low-level operating system // primitives. OS details vary depending on the underlying system, and diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go index 3723b2c2..ffb8708c 100644 --- a/vendor/golang.org/x/sys/windows/syscall_windows.go +++ b/vendor/golang.org/x/sys/windows/syscall_windows.go @@ -15,8 +15,6 @@ import ( "time" "unicode/utf16" "unsafe" - - "golang.org/x/sys/internal/unsafeheader" ) type Handle uintptr @@ -135,14 +133,14 @@ func Getpagesize() int { return 4096 } // NewCallback converts a Go function to a function pointer conforming to the stdcall calling convention. // This is useful when interoperating with Windows code requiring callbacks. -// The argument is expected to be a function with with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. +// The argument is expected to be a function with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. func NewCallback(fn interface{}) uintptr { return syscall.NewCallback(fn) } // NewCallbackCDecl converts a Go function to a function pointer conforming to the cdecl calling convention. // This is useful when interoperating with Windows code requiring callbacks. -// The argument is expected to be a function with with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. +// The argument is expected to be a function with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. func NewCallbackCDecl(fn interface{}) uintptr { return syscall.NewCallbackCDecl(fn) } @@ -157,6 +155,8 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys GetModuleFileName(module Handle, filename *uint16, size uint32) (n uint32, err error) = kernel32.GetModuleFileNameW //sys GetModuleHandleEx(flags uint32, moduleName *uint16, module *Handle) (err error) = kernel32.GetModuleHandleExW //sys SetDefaultDllDirectories(directoryFlags uint32) (err error) +//sys AddDllDirectory(path *uint16) (cookie uintptr, err error) = kernel32.AddDllDirectory +//sys RemoveDllDirectory(cookie uintptr) (err error) = kernel32.RemoveDllDirectory //sys SetDllDirectory(path string) (err error) = kernel32.SetDllDirectoryW //sys GetVersion() (ver uint32, err error) //sys FormatMessage(flags uint32, msgsrc uintptr, msgid uint32, langid uint32, buf []uint16, args *byte) (n uint32, err error) = FormatMessageW @@ -194,6 +194,7 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys GetComputerName(buf *uint16, n *uint32) (err error) = GetComputerNameW //sys GetComputerNameEx(nametype uint32, buf *uint16, n *uint32) (err error) = GetComputerNameExW //sys SetEndOfFile(handle Handle) (err error) +//sys SetFileValidData(handle Handle, validDataLength int64) (err error) //sys GetSystemTimeAsFileTime(time *Filetime) //sys GetSystemTimePreciseAsFileTime(time *Filetime) //sys GetTimeZoneInformation(tzi *Timezoneinformation) (rc uint32, err error) [failretval==0xffffffff] @@ -216,7 +217,7 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys shGetKnownFolderPath(id *KNOWNFOLDERID, flags uint32, token Token, path **uint16) (ret error) = shell32.SHGetKnownFolderPath //sys TerminateProcess(handle Handle, exitcode uint32) (err error) //sys GetExitCodeProcess(handle Handle, exitcode *uint32) (err error) -//sys GetStartupInfo(startupInfo *StartupInfo) (err error) = GetStartupInfoW +//sys getStartupInfo(startupInfo *StartupInfo) = GetStartupInfoW //sys GetProcessTimes(handle Handle, creationTime *Filetime, exitTime *Filetime, kernelTime *Filetime, userTime *Filetime) (err error) //sys DuplicateHandle(hSourceProcessHandle Handle, hSourceHandle Handle, hTargetProcessHandle Handle, lpTargetHandle *Handle, dwDesiredAccess uint32, bInheritHandle bool, dwOptions uint32) (err error) //sys WaitForSingleObject(handle Handle, waitMilliseconds uint32) (event uint32, err error) [failretval==0xffffffff] @@ -235,12 +236,13 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys CreateEnvironmentBlock(block **uint16, token Token, inheritExisting bool) (err error) = userenv.CreateEnvironmentBlock //sys DestroyEnvironmentBlock(block *uint16) (err error) = userenv.DestroyEnvironmentBlock //sys getTickCount64() (ms uint64) = kernel32.GetTickCount64 +//sys GetFileTime(handle Handle, ctime *Filetime, atime *Filetime, wtime *Filetime) (err error) //sys SetFileTime(handle Handle, ctime *Filetime, atime *Filetime, wtime *Filetime) (err error) //sys GetFileAttributes(name *uint16) (attrs uint32, err error) [failretval==INVALID_FILE_ATTRIBUTES] = kernel32.GetFileAttributesW //sys SetFileAttributes(name *uint16, attrs uint32) (err error) = kernel32.SetFileAttributesW //sys GetFileAttributesEx(name *uint16, level uint32, info *byte) (err error) = kernel32.GetFileAttributesExW //sys GetCommandLine() (cmd *uint16) = kernel32.GetCommandLineW -//sys CommandLineToArgv(cmd *uint16, argc *int32) (argv *[8192]*[8192]uint16, err error) [failretval==nil] = shell32.CommandLineToArgvW +//sys commandLineToArgv(cmd *uint16, argc *int32) (argv **uint16, err error) [failretval==nil] = shell32.CommandLineToArgvW //sys LocalFree(hmem Handle) (handle Handle, err error) [failretval!=0] //sys LocalAlloc(flags uint32, length uint32) (ptr uintptr, err error) //sys SetHandleInformation(handle Handle, mask uint32, flags uint32) (err error) @@ -299,12 +301,15 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys RegNotifyChangeKeyValue(key Handle, watchSubtree bool, notifyFilter uint32, event Handle, asynchronous bool) (regerrno error) = advapi32.RegNotifyChangeKeyValue //sys GetCurrentProcessId() (pid uint32) = kernel32.GetCurrentProcessId //sys ProcessIdToSessionId(pid uint32, sessionid *uint32) (err error) = kernel32.ProcessIdToSessionId +//sys ClosePseudoConsole(console Handle) = kernel32.ClosePseudoConsole +//sys createPseudoConsole(size uint32, in Handle, out Handle, flags uint32, pconsole *Handle) (hr error) = kernel32.CreatePseudoConsole //sys GetConsoleMode(console Handle, mode *uint32) (err error) = kernel32.GetConsoleMode //sys SetConsoleMode(console Handle, mode uint32) (err error) = kernel32.SetConsoleMode //sys GetConsoleScreenBufferInfo(console Handle, info *ConsoleScreenBufferInfo) (err error) = kernel32.GetConsoleScreenBufferInfo //sys setConsoleCursorPosition(console Handle, position uint32) (err error) = kernel32.SetConsoleCursorPosition //sys WriteConsole(console Handle, buf *uint16, towrite uint32, written *uint32, reserved *byte) (err error) = kernel32.WriteConsoleW //sys ReadConsole(console Handle, buf *uint16, toread uint32, read *uint32, inputControl *byte) (err error) = kernel32.ReadConsoleW +//sys resizePseudoConsole(pconsole Handle, size uint32) (hr error) = kernel32.ResizePseudoConsole //sys CreateToolhelp32Snapshot(flags uint32, processId uint32) (handle Handle, err error) [failretval==InvalidHandle] = kernel32.CreateToolhelp32Snapshot //sys Module32First(snapshot Handle, moduleEntry *ModuleEntry32) (err error) = kernel32.Module32FirstW //sys Module32Next(snapshot Handle, moduleEntry *ModuleEntry32) (err error) = kernel32.Module32NextW @@ -405,7 +410,7 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys VerQueryValue(block unsafe.Pointer, subBlock string, pointerToBufferPointer unsafe.Pointer, bufSize *uint32) (err error) = version.VerQueryValueW // Process Status API (PSAPI) -//sys EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses +//sys enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses //sys EnumProcessModules(process Handle, module *Handle, cb uint32, cbNeeded *uint32) (err error) = psapi.EnumProcessModules //sys EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *uint32, filterFlag uint32) (err error) = psapi.EnumProcessModulesEx //sys GetModuleInformation(process Handle, module Handle, modinfo *ModuleInfo, cb uint32) (err error) = psapi.GetModuleInformation @@ -437,6 +442,10 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys DwmGetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) = dwmapi.DwmGetWindowAttribute //sys DwmSetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) = dwmapi.DwmSetWindowAttribute +// Windows Multimedia API +//sys TimeBeginPeriod (period uint32) (err error) [failretval != 0] = winmm.timeBeginPeriod +//sys TimeEndPeriod (period uint32) (err error) [failretval != 0] = winmm.timeEndPeriod + // syscall interface implementation for other packages // GetCurrentProcess returns the handle for the current process. @@ -964,7 +973,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, int32, error) { if n > 0 { sl += int32(n) + 1 } - if sa.raw.Path[0] == '@' { + if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) { + // Check sl > 3 so we don't change unnamed socket behavior. sa.raw.Path[0] = 0 // Don't count trailing NUL for abstract address. sl-- @@ -1354,6 +1364,17 @@ func SetsockoptIPv6Mreq(fd Handle, level, opt int, mreq *IPv6Mreq) (err error) { return syscall.EWINDOWS } +func EnumProcesses(processIds []uint32, bytesReturned *uint32) error { + // EnumProcesses syscall expects the size parameter to be in bytes, but the code generated with mksyscall uses + // the length of the processIds slice instead. Hence, this wrapper function is added to fix the discrepancy. + var p *uint32 + if len(processIds) > 0 { + p = &processIds[0] + } + size := uint32(len(processIds) * 4) + return enumProcesses(p, size, bytesReturned) +} + func Getpid() (pid int) { return int(GetCurrentProcessId()) } func FindFirstFile(name *uint16, data *Win32finddata) (handle Handle, err error) { @@ -1613,6 +1634,11 @@ func SetConsoleCursorPosition(console Handle, position Coord) error { return setConsoleCursorPosition(console, *((*uint32)(unsafe.Pointer(&position)))) } +func GetStartupInfo(startupInfo *StartupInfo) error { + getStartupInfo(startupInfo) + return nil +} + func (s NTStatus) Errno() syscall.Errno { return rtlNtStatusToDosErrorNoTeb(s) } @@ -1647,12 +1673,8 @@ func NewNTUnicodeString(s string) (*NTUnicodeString, error) { // Slice returns a uint16 slice that aliases the data in the NTUnicodeString. func (s *NTUnicodeString) Slice() []uint16 { - var slice []uint16 - hdr := (*unsafeheader.Slice)(unsafe.Pointer(&slice)) - hdr.Data = unsafe.Pointer(s.Buffer) - hdr.Len = int(s.Length) - hdr.Cap = int(s.MaximumLength) - return slice + slice := unsafe.Slice(s.Buffer, s.MaximumLength) + return slice[:s.Length] } func (s *NTUnicodeString) String() string { @@ -1675,12 +1697,8 @@ func NewNTString(s string) (*NTString, error) { // Slice returns a byte slice that aliases the data in the NTString. func (s *NTString) Slice() []byte { - var slice []byte - hdr := (*unsafeheader.Slice)(unsafe.Pointer(&slice)) - hdr.Data = unsafe.Pointer(s.Buffer) - hdr.Len = int(s.Length) - hdr.Cap = int(s.MaximumLength) - return slice + slice := unsafe.Slice(s.Buffer, s.MaximumLength) + return slice[:s.Length] } func (s *NTString) String() string { @@ -1732,10 +1750,7 @@ func LoadResourceData(module, resInfo Handle) (data []byte, err error) { if err != nil { return } - h := (*unsafeheader.Slice)(unsafe.Pointer(&data)) - h.Data = unsafe.Pointer(ptr) - h.Len = int(size) - h.Cap = int(size) + data = unsafe.Slice((*byte)(unsafe.Pointer(ptr)), size) return } @@ -1806,3 +1821,17 @@ type PSAPI_WORKING_SET_EX_INFORMATION struct { // A PSAPI_WORKING_SET_EX_BLOCK union that indicates the attributes of the page at VirtualAddress. VirtualAttributes PSAPI_WORKING_SET_EX_BLOCK } + +// CreatePseudoConsole creates a windows pseudo console. +func CreatePseudoConsole(size Coord, in Handle, out Handle, flags uint32, pconsole *Handle) error { + // We need this wrapper to manually cast Coord to uint32. The autogenerated wrappers only + // accept arguments that can be casted to uintptr, and Coord can't. + return createPseudoConsole(*((*uint32)(unsafe.Pointer(&size))), in, out, flags, pconsole) +} + +// ResizePseudoConsole resizes the internal buffers of the pseudo console to the width and height specified in `size`. +func ResizePseudoConsole(pconsole Handle, size Coord) error { + // We need this wrapper to manually cast Coord to uint32. The autogenerated wrappers only + // accept arguments that can be casted to uintptr, and Coord can't. + return resizePseudoConsole(pconsole, *((*uint32)(unsafe.Pointer(&size)))) +} diff --git a/vendor/golang.org/x/sys/windows/types_windows.go b/vendor/golang.org/x/sys/windows/types_windows.go index 88e62a63..359780f6 100644 --- a/vendor/golang.org/x/sys/windows/types_windows.go +++ b/vendor/golang.org/x/sys/windows/types_windows.go @@ -247,6 +247,7 @@ const ( PROC_THREAD_ATTRIBUTE_MITIGATION_POLICY = 0x00020007 PROC_THREAD_ATTRIBUTE_UMS_THREAD = 0x00030006 PROC_THREAD_ATTRIBUTE_PROTECTION_LEVEL = 0x0002000b + PROC_THREAD_ATTRIBUTE_PSEUDOCONSOLE = 0x00020016 ) const ( @@ -1093,7 +1094,33 @@ const ( SOMAXCONN = 0x7fffffff - TCP_NODELAY = 1 + TCP_NODELAY = 1 + TCP_EXPEDITED_1122 = 2 + TCP_KEEPALIVE = 3 + TCP_MAXSEG = 4 + TCP_MAXRT = 5 + TCP_STDURG = 6 + TCP_NOURG = 7 + TCP_ATMARK = 8 + TCP_NOSYNRETRIES = 9 + TCP_TIMESTAMPS = 10 + TCP_OFFLOAD_PREFERENCE = 11 + TCP_CONGESTION_ALGORITHM = 12 + TCP_DELAY_FIN_ACK = 13 + TCP_MAXRTMS = 14 + TCP_FASTOPEN = 15 + TCP_KEEPCNT = 16 + TCP_KEEPIDLE = TCP_KEEPALIVE + TCP_KEEPINTVL = 17 + TCP_FAIL_CONNECT_ON_ICMP_ERROR = 18 + TCP_ICMP_ERROR_INFO = 19 + + UDP_NOCHECKSUM = 1 + UDP_SEND_MSG_SIZE = 2 + UDP_RECV_MAX_COALESCED_SIZE = 3 + UDP_CHECKSUM_COVERAGE = 20 + + UDP_COALESCED_INFO = 3 SHUT_RD = 0 SHUT_WR = 1 @@ -2139,6 +2166,12 @@ const ( ENABLE_LVB_GRID_WORLDWIDE = 0x10 ) +// Pseudo console related constants used for the flags parameter to +// CreatePseudoConsole. See: https://learn.microsoft.com/en-us/windows/console/createpseudoconsole +const ( + PSEUDOCONSOLE_INHERIT_CURSOR = 0x1 +) + type Coord struct { X int16 Y int16 diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go index a81ea2c7..e8791c82 100644 --- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go +++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go @@ -55,6 +55,7 @@ var ( moduser32 = NewLazySystemDLL("user32.dll") moduserenv = NewLazySystemDLL("userenv.dll") modversion = NewLazySystemDLL("version.dll") + modwinmm = NewLazySystemDLL("winmm.dll") modwintrust = NewLazySystemDLL("wintrust.dll") modws2_32 = NewLazySystemDLL("ws2_32.dll") modwtsapi32 = NewLazySystemDLL("wtsapi32.dll") @@ -183,10 +184,12 @@ var ( procGetAdaptersInfo = modiphlpapi.NewProc("GetAdaptersInfo") procGetBestInterfaceEx = modiphlpapi.NewProc("GetBestInterfaceEx") procGetIfEntry = modiphlpapi.NewProc("GetIfEntry") + procAddDllDirectory = modkernel32.NewProc("AddDllDirectory") procAssignProcessToJobObject = modkernel32.NewProc("AssignProcessToJobObject") procCancelIo = modkernel32.NewProc("CancelIo") procCancelIoEx = modkernel32.NewProc("CancelIoEx") procCloseHandle = modkernel32.NewProc("CloseHandle") + procClosePseudoConsole = modkernel32.NewProc("ClosePseudoConsole") procConnectNamedPipe = modkernel32.NewProc("ConnectNamedPipe") procCreateDirectoryW = modkernel32.NewProc("CreateDirectoryW") procCreateEventExW = modkernel32.NewProc("CreateEventExW") @@ -201,6 +204,7 @@ var ( procCreateNamedPipeW = modkernel32.NewProc("CreateNamedPipeW") procCreatePipe = modkernel32.NewProc("CreatePipe") procCreateProcessW = modkernel32.NewProc("CreateProcessW") + procCreatePseudoConsole = modkernel32.NewProc("CreatePseudoConsole") procCreateSymbolicLinkW = modkernel32.NewProc("CreateSymbolicLinkW") procCreateToolhelp32Snapshot = modkernel32.NewProc("CreateToolhelp32Snapshot") procDefineDosDeviceW = modkernel32.NewProc("DefineDosDeviceW") @@ -250,6 +254,7 @@ var ( procGetFileAttributesW = modkernel32.NewProc("GetFileAttributesW") procGetFileInformationByHandle = modkernel32.NewProc("GetFileInformationByHandle") procGetFileInformationByHandleEx = modkernel32.NewProc("GetFileInformationByHandleEx") + procGetFileTime = modkernel32.NewProc("GetFileTime") procGetFileType = modkernel32.NewProc("GetFileType") procGetFinalPathNameByHandleW = modkernel32.NewProc("GetFinalPathNameByHandleW") procGetFullPathNameW = modkernel32.NewProc("GetFullPathNameW") @@ -326,7 +331,9 @@ var ( procReadProcessMemory = modkernel32.NewProc("ReadProcessMemory") procReleaseMutex = modkernel32.NewProc("ReleaseMutex") procRemoveDirectoryW = modkernel32.NewProc("RemoveDirectoryW") + procRemoveDllDirectory = modkernel32.NewProc("RemoveDllDirectory") procResetEvent = modkernel32.NewProc("ResetEvent") + procResizePseudoConsole = modkernel32.NewProc("ResizePseudoConsole") procResumeThread = modkernel32.NewProc("ResumeThread") procSetCommTimeouts = modkernel32.NewProc("SetCommTimeouts") procSetConsoleCursorPosition = modkernel32.NewProc("SetConsoleCursorPosition") @@ -335,6 +342,7 @@ var ( procSetDefaultDllDirectories = modkernel32.NewProc("SetDefaultDllDirectories") procSetDllDirectoryW = modkernel32.NewProc("SetDllDirectoryW") procSetEndOfFile = modkernel32.NewProc("SetEndOfFile") + procSetFileValidData = modkernel32.NewProc("SetFileValidData") procSetEnvironmentVariableW = modkernel32.NewProc("SetEnvironmentVariableW") procSetErrorMode = modkernel32.NewProc("SetErrorMode") procSetEvent = modkernel32.NewProc("SetEvent") @@ -468,6 +476,8 @@ var ( procGetFileVersionInfoSizeW = modversion.NewProc("GetFileVersionInfoSizeW") procGetFileVersionInfoW = modversion.NewProc("GetFileVersionInfoW") procVerQueryValueW = modversion.NewProc("VerQueryValueW") + proctimeBeginPeriod = modwinmm.NewProc("timeBeginPeriod") + proctimeEndPeriod = modwinmm.NewProc("timeEndPeriod") procWinVerifyTrustEx = modwintrust.NewProc("WinVerifyTrustEx") procFreeAddrInfoW = modws2_32.NewProc("FreeAddrInfoW") procGetAddrInfoW = modws2_32.NewProc("GetAddrInfoW") @@ -1598,6 +1608,15 @@ func GetIfEntry(pIfRow *MibIfRow) (errcode error) { return } +func AddDllDirectory(path *uint16) (cookie uintptr, err error) { + r0, _, e1 := syscall.Syscall(procAddDllDirectory.Addr(), 1, uintptr(unsafe.Pointer(path)), 0, 0) + cookie = uintptr(r0) + if cookie == 0 { + err = errnoErr(e1) + } + return +} + func AssignProcessToJobObject(job Handle, process Handle) (err error) { r1, _, e1 := syscall.Syscall(procAssignProcessToJobObject.Addr(), 2, uintptr(job), uintptr(process), 0) if r1 == 0 { @@ -1630,6 +1649,11 @@ func CloseHandle(handle Handle) (err error) { return } +func ClosePseudoConsole(console Handle) { + syscall.Syscall(procClosePseudoConsole.Addr(), 1, uintptr(console), 0, 0) + return +} + func ConnectNamedPipe(pipe Handle, overlapped *Overlapped) (err error) { r1, _, e1 := syscall.Syscall(procConnectNamedPipe.Addr(), 2, uintptr(pipe), uintptr(unsafe.Pointer(overlapped)), 0) if r1 == 0 { @@ -1759,6 +1783,14 @@ func CreateProcess(appName *uint16, commandLine *uint16, procSecurity *SecurityA return } +func createPseudoConsole(size uint32, in Handle, out Handle, flags uint32, pconsole *Handle) (hr error) { + r0, _, _ := syscall.Syscall6(procCreatePseudoConsole.Addr(), 5, uintptr(size), uintptr(in), uintptr(out), uintptr(flags), uintptr(unsafe.Pointer(pconsole)), 0) + if r0 != 0 { + hr = syscall.Errno(r0) + } + return +} + func CreateSymbolicLink(symlinkfilename *uint16, targetfilename *uint16, flags uint32) (err error) { r1, _, e1 := syscall.Syscall(procCreateSymbolicLinkW.Addr(), 3, uintptr(unsafe.Pointer(symlinkfilename)), uintptr(unsafe.Pointer(targetfilename)), uintptr(flags)) if r1&0xff == 0 { @@ -2166,6 +2198,14 @@ func GetFileInformationByHandleEx(handle Handle, class uint32, outBuffer *byte, return } +func GetFileTime(handle Handle, ctime *Filetime, atime *Filetime, wtime *Filetime) (err error) { + r1, _, e1 := syscall.Syscall6(procGetFileTime.Addr(), 4, uintptr(handle), uintptr(unsafe.Pointer(ctime)), uintptr(unsafe.Pointer(atime)), uintptr(unsafe.Pointer(wtime)), 0, 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func GetFileType(filehandle Handle) (n uint32, err error) { r0, _, e1 := syscall.Syscall(procGetFileType.Addr(), 1, uintptr(filehandle), 0, 0) n = uint32(r0) @@ -2367,11 +2407,8 @@ func GetShortPathName(longpath *uint16, shortpath *uint16, buflen uint32) (n uin return } -func GetStartupInfo(startupInfo *StartupInfo) (err error) { - r1, _, e1 := syscall.Syscall(procGetStartupInfoW.Addr(), 1, uintptr(unsafe.Pointer(startupInfo)), 0, 0) - if r1 == 0 { - err = errnoErr(e1) - } +func getStartupInfo(startupInfo *StartupInfo) { + syscall.Syscall(procGetStartupInfoW.Addr(), 1, uintptr(unsafe.Pointer(startupInfo)), 0, 0) return } @@ -2854,6 +2891,14 @@ func RemoveDirectory(path *uint16) (err error) { return } +func RemoveDllDirectory(cookie uintptr) (err error) { + r1, _, e1 := syscall.Syscall(procRemoveDllDirectory.Addr(), 1, uintptr(cookie), 0, 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func ResetEvent(event Handle) (err error) { r1, _, e1 := syscall.Syscall(procResetEvent.Addr(), 1, uintptr(event), 0, 0) if r1 == 0 { @@ -2862,6 +2907,14 @@ func ResetEvent(event Handle) (err error) { return } +func resizePseudoConsole(pconsole Handle, size uint32) (hr error) { + r0, _, _ := syscall.Syscall(procResizePseudoConsole.Addr(), 2, uintptr(pconsole), uintptr(size), 0) + if r0 != 0 { + hr = syscall.Errno(r0) + } + return +} + func ResumeThread(thread Handle) (ret uint32, err error) { r0, _, e1 := syscall.Syscall(procResumeThread.Addr(), 1, uintptr(thread), 0, 0) ret = uint32(r0) @@ -2936,6 +2989,14 @@ func SetEndOfFile(handle Handle) (err error) { return } +func SetFileValidData(handle Handle, validDataLength int64) (err error) { + r1, _, e1 := syscall.Syscall(procSetFileValidData.Addr(), 2, uintptr(handle), uintptr(validDataLength), 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func SetEnvironmentVariable(name *uint16, value *uint16) (err error) { r1, _, e1 := syscall.Syscall(procSetEnvironmentVariableW.Addr(), 2, uintptr(unsafe.Pointer(name)), uintptr(unsafe.Pointer(value)), 0) if r1 == 0 { @@ -3516,12 +3577,8 @@ func EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *u return } -func EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) { - var _p0 *uint32 - if len(processIds) > 0 { - _p0 = &processIds[0] - } - r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(processIds)), uintptr(unsafe.Pointer(bytesReturned))) +func enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) { + r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(processIds)), uintptr(nSize), uintptr(unsafe.Pointer(bytesReturned))) if r1 == 0 { err = errnoErr(e1) } @@ -3824,9 +3881,9 @@ func setupUninstallOEMInf(infFileName *uint16, flags SUOI, reserved uintptr) (er return } -func CommandLineToArgv(cmd *uint16, argc *int32) (argv *[8192]*[8192]uint16, err error) { +func commandLineToArgv(cmd *uint16, argc *int32) (argv **uint16, err error) { r0, _, e1 := syscall.Syscall(procCommandLineToArgvW.Addr(), 2, uintptr(unsafe.Pointer(cmd)), uintptr(unsafe.Pointer(argc)), 0) - argv = (*[8192]*[8192]uint16)(unsafe.Pointer(r0)) + argv = (**uint16)(unsafe.Pointer(r0)) if argv == nil { err = errnoErr(e1) } @@ -4021,6 +4078,22 @@ func _VerQueryValue(block unsafe.Pointer, subBlock *uint16, pointerToBufferPoint return } +func TimeBeginPeriod(period uint32) (err error) { + r1, _, e1 := syscall.Syscall(proctimeBeginPeriod.Addr(), 1, uintptr(period), 0, 0) + if r1 != 0 { + err = errnoErr(e1) + } + return +} + +func TimeEndPeriod(period uint32) (err error) { + r1, _, e1 := syscall.Syscall(proctimeEndPeriod.Addr(), 1, uintptr(period), 0, 0) + if r1 != 0 { + err = errnoErr(e1) + } + return +} + func WinVerifyTrustEx(hwnd HWND, actionId *GUID, data *WinTrustData) (ret error) { r0, _, _ := syscall.Syscall(procWinVerifyTrustEx.Addr(), 3, uintptr(hwnd), uintptr(unsafe.Pointer(actionId)), uintptr(unsafe.Pointer(data))) if r0 != 0 { diff --git a/vendor/golang.org/x/term/term_unix.go b/vendor/golang.org/x/term/term_unix.go index a4e31ab1..1ad0ddfe 100644 --- a/vendor/golang.org/x/term/term_unix.go +++ b/vendor/golang.org/x/term/term_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package term @@ -60,7 +59,7 @@ func restore(fd int, state *State) error { func getSize(fd int) (width, height int, err error) { ws, err := unix.IoctlGetWinsize(fd, unix.TIOCGWINSZ) if err != nil { - return -1, -1, err + return 0, 0, err } return int(ws.Col), int(ws.Row), nil } diff --git a/vendor/golang.org/x/term/term_unix_bsd.go b/vendor/golang.org/x/term/term_unix_bsd.go index 853b3d69..9dbf5462 100644 --- a/vendor/golang.org/x/term/term_unix_bsd.go +++ b/vendor/golang.org/x/term/term_unix_bsd.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin || dragonfly || freebsd || netbsd || openbsd -// +build darwin dragonfly freebsd netbsd openbsd package term diff --git a/vendor/golang.org/x/term/term_unix_other.go b/vendor/golang.org/x/term/term_unix_other.go index 1e8955c9..1b36de79 100644 --- a/vendor/golang.org/x/term/term_unix_other.go +++ b/vendor/golang.org/x/term/term_unix_other.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || linux || solaris || zos -// +build aix linux solaris zos package term diff --git a/vendor/golang.org/x/term/term_unsupported.go b/vendor/golang.org/x/term/term_unsupported.go index f1df8506..3c409e58 100644 --- a/vendor/golang.org/x/term/term_unsupported.go +++ b/vendor/golang.org/x/term/term_unsupported.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !zos && !windows && !solaris && !plan9 -// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!zos,!windows,!solaris,!plan9 package term diff --git a/vendor/golang.org/x/text/cases/icu.go b/vendor/golang.org/x/text/cases/icu.go index 2dc84b39..db7c237c 100644 --- a/vendor/golang.org/x/text/cases/icu.go +++ b/vendor/golang.org/x/text/cases/icu.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build icu -// +build icu package cases diff --git a/vendor/golang.org/x/text/cases/tables10.0.0.go b/vendor/golang.org/x/text/cases/tables10.0.0.go index ca992310..bd28ae14 100644 --- a/vendor/golang.org/x/text/cases/tables10.0.0.go +++ b/vendor/golang.org/x/text/cases/tables10.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build go1.10 && !go1.13 -// +build go1.10,!go1.13 package cases diff --git a/vendor/golang.org/x/text/cases/tables11.0.0.go b/vendor/golang.org/x/text/cases/tables11.0.0.go index b1106b41..ce00ce37 100644 --- a/vendor/golang.org/x/text/cases/tables11.0.0.go +++ b/vendor/golang.org/x/text/cases/tables11.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build go1.13 && !go1.14 -// +build go1.13,!go1.14 package cases diff --git a/vendor/golang.org/x/text/cases/tables12.0.0.go b/vendor/golang.org/x/text/cases/tables12.0.0.go index ae7dc240..84d841b1 100644 --- a/vendor/golang.org/x/text/cases/tables12.0.0.go +++ b/vendor/golang.org/x/text/cases/tables12.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build go1.14 && !go1.16 -// +build go1.14,!go1.16 package cases diff --git a/vendor/golang.org/x/text/cases/tables13.0.0.go b/vendor/golang.org/x/text/cases/tables13.0.0.go index cd874775..6187e6b4 100644 --- a/vendor/golang.org/x/text/cases/tables13.0.0.go +++ b/vendor/golang.org/x/text/cases/tables13.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 package cases diff --git a/vendor/golang.org/x/text/cases/tables15.0.0.go b/vendor/golang.org/x/text/cases/tables15.0.0.go new file mode 100644 index 00000000..aee0f310 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables15.0.0.go @@ -0,0 +1,2527 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +var xorData string = "" + // Size: 213 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + + "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + + "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x03'" + + "\x00\x03)\x00\x03+\x00\x03/\x00\x03\x19\x00\x03\x1b\x00\x03\x1f\x00\x01" + + "\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2450 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" + + "ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" + + "φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" + + "\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" + + "\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" + + "\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" + + "\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" + + "\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" + + "\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" + + "\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" + + "СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" + + "\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" + + "\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" + + "\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" + + "\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" + + "\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" + + "ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" + + "\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" + + "\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" + + "\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" + + "\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" + + "ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" + + "Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" + + "̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" + + "́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" + + "\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" + + "\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" + + "\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" + + "\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" + + "\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" + + "STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" + + "խ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 13398 bytes (13.08 KiB). Checksum: 544af6e6b1b70931. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 22: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 22 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 24 blocks, 1536 entries, 3072 bytes +// The third block is the zero block. +var caseValues = [1536]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a, + 0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, 0x28a: 0x0010, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x0010, 0x2c1: 0x0010, 0x2c2: 0x0010, 0x2c3: 0x0010, 0x2c4: 0x0010, 0x2c5: 0x0010, + 0x2c6: 0x0010, 0x2c7: 0x0010, 0x2c8: 0x0010, 0x2c9: 0x0014, 0x2ca: 0x0024, 0x2cb: 0x0024, + 0x2cc: 0x0024, 0x2cd: 0x0024, 0x2ce: 0x0024, 0x2cf: 0x0034, 0x2d0: 0x0034, 0x2d1: 0x0034, + 0x2d2: 0x0034, 0x2d3: 0x0034, 0x2d4: 0x0024, 0x2d5: 0x0024, 0x2d6: 0x0024, 0x2d7: 0x0024, + 0x2d8: 0x0024, 0x2d9: 0x0024, 0x2da: 0x0024, 0x2db: 0x0024, 0x2dc: 0x0024, 0x2dd: 0x0024, + 0x2de: 0x0024, 0x2df: 0x0024, 0x2e0: 0x0024, 0x2e1: 0x0024, 0x2e2: 0x0014, 0x2e3: 0x0034, + 0x2e4: 0x0024, 0x2e5: 0x0024, 0x2e6: 0x0034, 0x2e7: 0x0024, 0x2e8: 0x0024, 0x2e9: 0x0034, + 0x2ea: 0x0024, 0x2eb: 0x0024, 0x2ec: 0x0024, 0x2ed: 0x0034, 0x2ee: 0x0034, 0x2ef: 0x0034, + 0x2f0: 0x0034, 0x2f1: 0x0034, 0x2f2: 0x0034, 0x2f3: 0x0024, 0x2f4: 0x0024, 0x2f5: 0x0024, + 0x2f6: 0x0034, 0x2f7: 0x0024, 0x2f8: 0x0024, 0x2f9: 0x0034, 0x2fa: 0x0034, 0x2fb: 0x0024, + 0x2fc: 0x0024, 0x2fd: 0x0024, 0x2fe: 0x0024, 0x2ff: 0x0024, + // Block 0xc, offset 0x300 + 0x300: 0x7053, 0x301: 0x7053, 0x302: 0x7053, 0x303: 0x7053, 0x304: 0x7053, 0x305: 0x7053, + 0x307: 0x7053, + 0x30d: 0x7053, 0x310: 0x1aea, 0x311: 0x1b6a, + 0x312: 0x1bea, 0x313: 0x1c6a, 0x314: 0x1cea, 0x315: 0x1d6a, 0x316: 0x1dea, 0x317: 0x1e6a, + 0x318: 0x1eea, 0x319: 0x1f6a, 0x31a: 0x1fea, 0x31b: 0x206a, 0x31c: 0x20ea, 0x31d: 0x216a, + 0x31e: 0x21ea, 0x31f: 0x226a, 0x320: 0x22ea, 0x321: 0x236a, 0x322: 0x23ea, 0x323: 0x246a, + 0x324: 0x24ea, 0x325: 0x256a, 0x326: 0x25ea, 0x327: 0x266a, 0x328: 0x26ea, 0x329: 0x276a, + 0x32a: 0x27ea, 0x32b: 0x286a, 0x32c: 0x28ea, 0x32d: 0x296a, 0x32e: 0x29ea, 0x32f: 0x2a6a, + 0x330: 0x2aea, 0x331: 0x2b6a, 0x332: 0x2bea, 0x333: 0x2c6a, 0x334: 0x2cea, 0x335: 0x2d6a, + 0x336: 0x2dea, 0x337: 0x2e6a, 0x338: 0x2eea, 0x339: 0x2f6a, 0x33a: 0x2fea, + 0x33c: 0x0015, 0x33d: 0x306a, 0x33e: 0x30ea, 0x33f: 0x316a, + // Block 0xd, offset 0x340 + 0x340: 0x0812, 0x341: 0x0812, 0x342: 0x0812, 0x343: 0x0812, 0x344: 0x0812, 0x345: 0x0812, + 0x348: 0x0813, 0x349: 0x0813, 0x34a: 0x0813, 0x34b: 0x0813, + 0x34c: 0x0813, 0x34d: 0x0813, 0x350: 0x3b1a, 0x351: 0x0812, + 0x352: 0x3bfa, 0x353: 0x0812, 0x354: 0x3d3a, 0x355: 0x0812, 0x356: 0x3e7a, 0x357: 0x0812, + 0x359: 0x0813, 0x35b: 0x0813, 0x35d: 0x0813, + 0x35f: 0x0813, 0x360: 0x0812, 0x361: 0x0812, 0x362: 0x0812, 0x363: 0x0812, + 0x364: 0x0812, 0x365: 0x0812, 0x366: 0x0812, 0x367: 0x0812, 0x368: 0x0813, 0x369: 0x0813, + 0x36a: 0x0813, 0x36b: 0x0813, 0x36c: 0x0813, 0x36d: 0x0813, 0x36e: 0x0813, 0x36f: 0x0813, + 0x370: 0x9252, 0x371: 0x9252, 0x372: 0x9552, 0x373: 0x9552, 0x374: 0x9852, 0x375: 0x9852, + 0x376: 0x9b52, 0x377: 0x9b52, 0x378: 0x9e52, 0x379: 0x9e52, 0x37a: 0xa152, 0x37b: 0xa152, + 0x37c: 0x4d52, 0x37d: 0x4d52, + // Block 0xe, offset 0x380 + 0x380: 0x3fba, 0x381: 0x40aa, 0x382: 0x419a, 0x383: 0x428a, 0x384: 0x437a, 0x385: 0x446a, + 0x386: 0x455a, 0x387: 0x464a, 0x388: 0x4739, 0x389: 0x4829, 0x38a: 0x4919, 0x38b: 0x4a09, + 0x38c: 0x4af9, 0x38d: 0x4be9, 0x38e: 0x4cd9, 0x38f: 0x4dc9, 0x390: 0x4eba, 0x391: 0x4faa, + 0x392: 0x509a, 0x393: 0x518a, 0x394: 0x527a, 0x395: 0x536a, 0x396: 0x545a, 0x397: 0x554a, + 0x398: 0x5639, 0x399: 0x5729, 0x39a: 0x5819, 0x39b: 0x5909, 0x39c: 0x59f9, 0x39d: 0x5ae9, + 0x39e: 0x5bd9, 0x39f: 0x5cc9, 0x3a0: 0x5dba, 0x3a1: 0x5eaa, 0x3a2: 0x5f9a, 0x3a3: 0x608a, + 0x3a4: 0x617a, 0x3a5: 0x626a, 0x3a6: 0x635a, 0x3a7: 0x644a, 0x3a8: 0x6539, 0x3a9: 0x6629, + 0x3aa: 0x6719, 0x3ab: 0x6809, 0x3ac: 0x68f9, 0x3ad: 0x69e9, 0x3ae: 0x6ad9, 0x3af: 0x6bc9, + 0x3b0: 0x0812, 0x3b1: 0x0812, 0x3b2: 0x6cba, 0x3b3: 0x6dca, 0x3b4: 0x6e9a, + 0x3b6: 0x6f7a, 0x3b7: 0x705a, 0x3b8: 0x0813, 0x3b9: 0x0813, 0x3ba: 0x9253, 0x3bb: 0x9253, + 0x3bc: 0x7199, 0x3bd: 0x0004, 0x3be: 0x726a, 0x3bf: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x0004, 0x3c1: 0x0004, 0x3c2: 0x72ea, 0x3c3: 0x73fa, 0x3c4: 0x74ca, + 0x3c6: 0x75aa, 0x3c7: 0x768a, 0x3c8: 0x9553, 0x3c9: 0x9553, 0x3ca: 0x9853, 0x3cb: 0x9853, + 0x3cc: 0x77c9, 0x3cd: 0x0004, 0x3ce: 0x0004, 0x3cf: 0x0004, 0x3d0: 0x0812, 0x3d1: 0x0812, + 0x3d2: 0x789a, 0x3d3: 0x79da, 0x3d6: 0x7b1a, 0x3d7: 0x7bfa, + 0x3d8: 0x0813, 0x3d9: 0x0813, 0x3da: 0x9b53, 0x3db: 0x9b53, 0x3dd: 0x0004, + 0x3de: 0x0004, 0x3df: 0x0004, 0x3e0: 0x0812, 0x3e1: 0x0812, 0x3e2: 0x7d3a, 0x3e3: 0x7e7a, + 0x3e4: 0x7fba, 0x3e5: 0x0912, 0x3e6: 0x809a, 0x3e7: 0x817a, 0x3e8: 0x0813, 0x3e9: 0x0813, + 0x3ea: 0xa153, 0x3eb: 0xa153, 0x3ec: 0x0913, 0x3ed: 0x0004, 0x3ee: 0x0004, 0x3ef: 0x0004, + 0x3f2: 0x82ba, 0x3f3: 0x83ca, 0x3f4: 0x849a, + 0x3f6: 0x857a, 0x3f7: 0x865a, 0x3f8: 0x9e53, 0x3f9: 0x9e53, 0x3fa: 0x4d53, 0x3fb: 0x4d53, + 0x3fc: 0x8799, 0x3fd: 0x0004, 0x3fe: 0x0004, + // Block 0x10, offset 0x400 + 0x402: 0x0013, + 0x407: 0x0013, 0x40a: 0x0012, 0x40b: 0x0013, + 0x40c: 0x0013, 0x40d: 0x0013, 0x40e: 0x0012, 0x40f: 0x0012, 0x410: 0x0013, 0x411: 0x0013, + 0x412: 0x0013, 0x413: 0x0012, 0x415: 0x0013, + 0x419: 0x0013, 0x41a: 0x0013, 0x41b: 0x0013, 0x41c: 0x0013, 0x41d: 0x0013, + 0x424: 0x0013, 0x426: 0x886b, 0x428: 0x0013, + 0x42a: 0x88cb, 0x42b: 0x890b, 0x42c: 0x0013, 0x42d: 0x0013, 0x42f: 0x0012, + 0x430: 0x0013, 0x431: 0x0013, 0x432: 0xa453, 0x433: 0x0013, 0x434: 0x0012, 0x435: 0x0010, + 0x436: 0x0010, 0x437: 0x0010, 0x438: 0x0010, 0x439: 0x0012, + 0x43c: 0x0012, 0x43d: 0x0012, 0x43e: 0x0013, 0x43f: 0x0013, + // Block 0x11, offset 0x440 + 0x440: 0x1a13, 0x441: 0x1a13, 0x442: 0x1e13, 0x443: 0x1e13, 0x444: 0x1a13, 0x445: 0x1a13, + 0x446: 0x2613, 0x447: 0x2613, 0x448: 0x2a13, 0x449: 0x2a13, 0x44a: 0x2e13, 0x44b: 0x2e13, + 0x44c: 0x2a13, 0x44d: 0x2a13, 0x44e: 0x2613, 0x44f: 0x2613, 0x450: 0xa752, 0x451: 0xa752, + 0x452: 0xaa52, 0x453: 0xaa52, 0x454: 0xad52, 0x455: 0xad52, 0x456: 0xaa52, 0x457: 0xaa52, + 0x458: 0xa752, 0x459: 0xa752, 0x45a: 0x1a12, 0x45b: 0x1a12, 0x45c: 0x1e12, 0x45d: 0x1e12, + 0x45e: 0x1a12, 0x45f: 0x1a12, 0x460: 0x2612, 0x461: 0x2612, 0x462: 0x2a12, 0x463: 0x2a12, + 0x464: 0x2e12, 0x465: 0x2e12, 0x466: 0x2a12, 0x467: 0x2a12, 0x468: 0x2612, 0x469: 0x2612, + // Block 0x12, offset 0x480 + 0x480: 0x6552, 0x481: 0x6552, 0x482: 0x6552, 0x483: 0x6552, 0x484: 0x6552, 0x485: 0x6552, + 0x486: 0x6552, 0x487: 0x6552, 0x488: 0x6552, 0x489: 0x6552, 0x48a: 0x6552, 0x48b: 0x6552, + 0x48c: 0x6552, 0x48d: 0x6552, 0x48e: 0x6552, 0x48f: 0x6552, 0x490: 0xb052, 0x491: 0xb052, + 0x492: 0xb052, 0x493: 0xb052, 0x494: 0xb052, 0x495: 0xb052, 0x496: 0xb052, 0x497: 0xb052, + 0x498: 0xb052, 0x499: 0xb052, 0x49a: 0xb052, 0x49b: 0xb052, 0x49c: 0xb052, 0x49d: 0xb052, + 0x49e: 0xb052, 0x49f: 0xb052, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x896b, 0x4a3: 0x8b53, + 0x4a4: 0x89cb, 0x4a5: 0x8a2a, 0x4a6: 0x8a8a, 0x4a7: 0x0f13, 0x4a8: 0x0f12, 0x4a9: 0x0313, + 0x4aa: 0x0312, 0x4ab: 0x0713, 0x4ac: 0x0712, 0x4ad: 0x8aeb, 0x4ae: 0x8b4b, 0x4af: 0x8bab, + 0x4b0: 0x8c0b, 0x4b1: 0x0012, 0x4b2: 0x0113, 0x4b3: 0x0112, 0x4b4: 0x0012, 0x4b5: 0x0313, + 0x4b6: 0x0312, 0x4b7: 0x0012, 0x4b8: 0x0012, 0x4b9: 0x0012, 0x4ba: 0x0012, 0x4bb: 0x0012, + 0x4bc: 0x0015, 0x4bd: 0x0015, 0x4be: 0x8c6b, 0x4bf: 0x8ccb, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x0113, 0x4c1: 0x0112, 0x4c2: 0x0113, 0x4c3: 0x0112, 0x4c4: 0x0113, 0x4c5: 0x0112, + 0x4c6: 0x0113, 0x4c7: 0x0112, 0x4c8: 0x0014, 0x4c9: 0x0014, 0x4ca: 0x0014, 0x4cb: 0x0713, + 0x4cc: 0x0712, 0x4cd: 0x8d2b, 0x4ce: 0x0012, 0x4cf: 0x0010, 0x4d0: 0x0113, 0x4d1: 0x0112, + 0x4d2: 0x0113, 0x4d3: 0x0112, 0x4d4: 0x6552, 0x4d5: 0x0012, 0x4d6: 0x0113, 0x4d7: 0x0112, + 0x4d8: 0x0113, 0x4d9: 0x0112, 0x4da: 0x0113, 0x4db: 0x0112, 0x4dc: 0x0113, 0x4dd: 0x0112, + 0x4de: 0x0113, 0x4df: 0x0112, 0x4e0: 0x0113, 0x4e1: 0x0112, 0x4e2: 0x0113, 0x4e3: 0x0112, + 0x4e4: 0x0113, 0x4e5: 0x0112, 0x4e6: 0x0113, 0x4e7: 0x0112, 0x4e8: 0x0113, 0x4e9: 0x0112, + 0x4ea: 0x8d8b, 0x4eb: 0x8deb, 0x4ec: 0x8e4b, 0x4ed: 0x8eab, 0x4ee: 0x8f0b, 0x4ef: 0x0012, + 0x4f0: 0x8f6b, 0x4f1: 0x8fcb, 0x4f2: 0x902b, 0x4f3: 0xb353, 0x4f4: 0x0113, 0x4f5: 0x0112, + 0x4f6: 0x0113, 0x4f7: 0x0112, 0x4f8: 0x0113, 0x4f9: 0x0112, 0x4fa: 0x0113, 0x4fb: 0x0112, + 0x4fc: 0x0113, 0x4fd: 0x0112, 0x4fe: 0x0113, 0x4ff: 0x0112, + // Block 0x14, offset 0x500 + 0x500: 0x90ea, 0x501: 0x916a, 0x502: 0x91ea, 0x503: 0x926a, 0x504: 0x931a, 0x505: 0x93ca, + 0x506: 0x944a, + 0x513: 0x94ca, 0x514: 0x95aa, 0x515: 0x968a, 0x516: 0x976a, 0x517: 0x984a, + 0x51d: 0x0010, + 0x51e: 0x0034, 0x51f: 0x0010, 0x520: 0x0010, 0x521: 0x0010, 0x522: 0x0010, 0x523: 0x0010, + 0x524: 0x0010, 0x525: 0x0010, 0x526: 0x0010, 0x527: 0x0010, 0x528: 0x0010, + 0x52a: 0x0010, 0x52b: 0x0010, 0x52c: 0x0010, 0x52d: 0x0010, 0x52e: 0x0010, 0x52f: 0x0010, + 0x530: 0x0010, 0x531: 0x0010, 0x532: 0x0010, 0x533: 0x0010, 0x534: 0x0010, 0x535: 0x0010, + 0x536: 0x0010, 0x538: 0x0010, 0x539: 0x0010, 0x53a: 0x0010, 0x53b: 0x0010, + 0x53c: 0x0010, 0x53e: 0x0010, + // Block 0x15, offset 0x540 + 0x540: 0x2713, 0x541: 0x2913, 0x542: 0x2b13, 0x543: 0x2913, 0x544: 0x2f13, 0x545: 0x2913, + 0x546: 0x2b13, 0x547: 0x2913, 0x548: 0x2713, 0x549: 0x3913, 0x54a: 0x3b13, + 0x54c: 0x3f13, 0x54d: 0x3913, 0x54e: 0x3b13, 0x54f: 0x3913, 0x550: 0x2713, 0x551: 0x2913, + 0x552: 0x2b13, 0x554: 0x2f13, 0x555: 0x2913, 0x557: 0xbc52, + 0x558: 0xbf52, 0x559: 0xc252, 0x55a: 0xbf52, 0x55b: 0xc552, 0x55c: 0xbf52, 0x55d: 0xc252, + 0x55e: 0xbf52, 0x55f: 0xbc52, 0x560: 0xc852, 0x561: 0xcb52, 0x563: 0xce52, + 0x564: 0xc852, 0x565: 0xcb52, 0x566: 0xc852, 0x567: 0x2712, 0x568: 0x2912, 0x569: 0x2b12, + 0x56a: 0x2912, 0x56b: 0x2f12, 0x56c: 0x2912, 0x56d: 0x2b12, 0x56e: 0x2912, 0x56f: 0x2712, + 0x570: 0x3912, 0x571: 0x3b12, 0x573: 0x3f12, 0x574: 0x3912, 0x575: 0x3b12, + 0x576: 0x3912, 0x577: 0x2712, 0x578: 0x2912, 0x579: 0x2b12, 0x57b: 0x2f12, + 0x57c: 0x2912, + // Block 0x16, offset 0x580 + 0x580: 0x2213, 0x581: 0x2213, 0x582: 0x2613, 0x583: 0x2613, 0x584: 0x2213, 0x585: 0x2213, + 0x586: 0x2e13, 0x587: 0x2e13, 0x588: 0x2213, 0x589: 0x2213, 0x58a: 0x2613, 0x58b: 0x2613, + 0x58c: 0x2213, 0x58d: 0x2213, 0x58e: 0x3e13, 0x58f: 0x3e13, 0x590: 0x2213, 0x591: 0x2213, + 0x592: 0x2613, 0x593: 0x2613, 0x594: 0x2213, 0x595: 0x2213, 0x596: 0x2e13, 0x597: 0x2e13, + 0x598: 0x2213, 0x599: 0x2213, 0x59a: 0x2613, 0x59b: 0x2613, 0x59c: 0x2213, 0x59d: 0x2213, + 0x59e: 0xd153, 0x59f: 0xd153, 0x5a0: 0xd453, 0x5a1: 0xd453, 0x5a2: 0x2212, 0x5a3: 0x2212, + 0x5a4: 0x2612, 0x5a5: 0x2612, 0x5a6: 0x2212, 0x5a7: 0x2212, 0x5a8: 0x2e12, 0x5a9: 0x2e12, + 0x5aa: 0x2212, 0x5ab: 0x2212, 0x5ac: 0x2612, 0x5ad: 0x2612, 0x5ae: 0x2212, 0x5af: 0x2212, + 0x5b0: 0x3e12, 0x5b1: 0x3e12, 0x5b2: 0x2212, 0x5b3: 0x2212, 0x5b4: 0x2612, 0x5b5: 0x2612, + 0x5b6: 0x2212, 0x5b7: 0x2212, 0x5b8: 0x2e12, 0x5b9: 0x2e12, 0x5ba: 0x2212, 0x5bb: 0x2212, + 0x5bc: 0x2612, 0x5bd: 0x2612, 0x5be: 0x2212, 0x5bf: 0x2212, + // Block 0x17, offset 0x5c0 + 0x5c2: 0x0010, + 0x5c7: 0x0010, 0x5c9: 0x0010, 0x5cb: 0x0010, + 0x5cd: 0x0010, 0x5ce: 0x0010, 0x5cf: 0x0010, 0x5d1: 0x0010, + 0x5d2: 0x0010, 0x5d4: 0x0010, 0x5d7: 0x0010, + 0x5d9: 0x0010, 0x5db: 0x0010, 0x5dd: 0x0010, + 0x5df: 0x0010, 0x5e1: 0x0010, 0x5e2: 0x0010, + 0x5e4: 0x0010, 0x5e7: 0x0010, 0x5e8: 0x0010, 0x5e9: 0x0010, + 0x5ea: 0x0010, 0x5ec: 0x0010, 0x5ed: 0x0010, 0x5ee: 0x0010, 0x5ef: 0x0010, + 0x5f0: 0x0010, 0x5f1: 0x0010, 0x5f2: 0x0010, 0x5f4: 0x0010, 0x5f5: 0x0010, + 0x5f6: 0x0010, 0x5f7: 0x0010, 0x5f9: 0x0010, 0x5fa: 0x0010, 0x5fb: 0x0010, + 0x5fc: 0x0010, 0x5fe: 0x0010, +} + +// caseIndex: 27 blocks, 1728 entries, 3456 bytes +// Block 0 is the zero block. +var caseIndex = [1728]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x16, 0xc3: 0x17, 0xc4: 0x18, 0xc5: 0x19, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x1a, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x1b, 0xcc: 0x1c, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1d, 0xd1: 0x1e, 0xd2: 0x1f, 0xd3: 0x20, 0xd4: 0x21, 0xd5: 0x22, 0xd6: 0x08, 0xd7: 0x23, + 0xd8: 0x24, 0xd9: 0x25, 0xda: 0x26, 0xdb: 0x27, 0xdc: 0x28, 0xdd: 0x29, 0xde: 0x2a, 0xdf: 0x2b, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x16, 0xf3: 0x18, + // Block 0x4, offset 0x100 + 0x120: 0x2c, 0x121: 0x2d, 0x122: 0x2e, 0x123: 0x09, 0x124: 0x2f, 0x125: 0x30, 0x126: 0x31, 0x127: 0x32, + 0x128: 0x33, 0x129: 0x34, 0x12a: 0x35, 0x12b: 0x36, 0x12c: 0x37, 0x12d: 0x38, 0x12e: 0x39, 0x12f: 0x3a, + 0x130: 0x3b, 0x131: 0x3c, 0x132: 0x3d, 0x133: 0x3e, 0x134: 0x3f, 0x135: 0x40, 0x136: 0x41, 0x137: 0x42, + 0x138: 0x43, 0x139: 0x44, 0x13a: 0x45, 0x13b: 0x46, 0x13c: 0x47, 0x13d: 0x48, 0x13e: 0x49, 0x13f: 0x4a, + // Block 0x5, offset 0x140 + 0x140: 0x4b, 0x141: 0x4c, 0x142: 0x4d, 0x143: 0x0a, 0x144: 0x26, 0x145: 0x26, 0x146: 0x26, 0x147: 0x26, + 0x148: 0x26, 0x149: 0x4e, 0x14a: 0x4f, 0x14b: 0x50, 0x14c: 0x51, 0x14d: 0x52, 0x14e: 0x53, 0x14f: 0x54, + 0x150: 0x55, 0x151: 0x26, 0x152: 0x26, 0x153: 0x26, 0x154: 0x26, 0x155: 0x26, 0x156: 0x26, 0x157: 0x26, + 0x158: 0x26, 0x159: 0x56, 0x15a: 0x57, 0x15b: 0x58, 0x15c: 0x59, 0x15d: 0x5a, 0x15e: 0x5b, 0x15f: 0x5c, + 0x160: 0x5d, 0x161: 0x5e, 0x162: 0x5f, 0x163: 0x60, 0x164: 0x61, 0x165: 0x62, 0x167: 0x63, + 0x168: 0x64, 0x169: 0x65, 0x16a: 0x66, 0x16b: 0x67, 0x16c: 0x68, 0x16d: 0x69, 0x16e: 0x6a, 0x16f: 0x6b, + 0x170: 0x6c, 0x171: 0x6d, 0x172: 0x6e, 0x173: 0x6f, 0x174: 0x70, 0x175: 0x71, 0x176: 0x72, 0x177: 0x73, + 0x178: 0x74, 0x179: 0x74, 0x17a: 0x75, 0x17b: 0x74, 0x17c: 0x76, 0x17d: 0x0b, 0x17e: 0x0c, 0x17f: 0x0d, + // Block 0x6, offset 0x180 + 0x180: 0x77, 0x181: 0x78, 0x182: 0x79, 0x183: 0x7a, 0x184: 0x0e, 0x185: 0x7b, 0x186: 0x7c, + 0x192: 0x7d, 0x193: 0x0f, + 0x1b0: 0x7e, 0x1b1: 0x10, 0x1b2: 0x74, 0x1b3: 0x7f, 0x1b4: 0x80, 0x1b5: 0x81, 0x1b6: 0x82, 0x1b7: 0x83, + 0x1b8: 0x84, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x85, 0x1c2: 0x86, 0x1c3: 0x87, 0x1c4: 0x88, 0x1c5: 0x26, 0x1c6: 0x89, + // Block 0x8, offset 0x200 + 0x200: 0x8a, 0x201: 0x26, 0x202: 0x26, 0x203: 0x26, 0x204: 0x26, 0x205: 0x26, 0x206: 0x26, 0x207: 0x26, + 0x208: 0x26, 0x209: 0x26, 0x20a: 0x26, 0x20b: 0x26, 0x20c: 0x26, 0x20d: 0x26, 0x20e: 0x26, 0x20f: 0x26, + 0x210: 0x26, 0x211: 0x26, 0x212: 0x8b, 0x213: 0x8c, 0x214: 0x26, 0x215: 0x26, 0x216: 0x26, 0x217: 0x26, + 0x218: 0x8d, 0x219: 0x8e, 0x21a: 0x8f, 0x21b: 0x90, 0x21c: 0x91, 0x21d: 0x92, 0x21e: 0x11, 0x21f: 0x93, + 0x220: 0x94, 0x221: 0x95, 0x222: 0x26, 0x223: 0x96, 0x224: 0x97, 0x225: 0x98, 0x226: 0x99, 0x227: 0x9a, + 0x228: 0x9b, 0x229: 0x9c, 0x22a: 0x9d, 0x22b: 0x9e, 0x22c: 0x9f, 0x22d: 0xa0, 0x22e: 0xa1, 0x22f: 0xa2, + 0x230: 0x26, 0x231: 0x26, 0x232: 0x26, 0x233: 0x26, 0x234: 0x26, 0x235: 0x26, 0x236: 0x26, 0x237: 0x26, + 0x238: 0x26, 0x239: 0x26, 0x23a: 0x26, 0x23b: 0x26, 0x23c: 0x26, 0x23d: 0x26, 0x23e: 0x26, 0x23f: 0x26, + // Block 0x9, offset 0x240 + 0x240: 0x26, 0x241: 0x26, 0x242: 0x26, 0x243: 0x26, 0x244: 0x26, 0x245: 0x26, 0x246: 0x26, 0x247: 0x26, + 0x248: 0x26, 0x249: 0x26, 0x24a: 0x26, 0x24b: 0x26, 0x24c: 0x26, 0x24d: 0x26, 0x24e: 0x26, 0x24f: 0x26, + 0x250: 0x26, 0x251: 0x26, 0x252: 0x26, 0x253: 0x26, 0x254: 0x26, 0x255: 0x26, 0x256: 0x26, 0x257: 0x26, + 0x258: 0x26, 0x259: 0x26, 0x25a: 0x26, 0x25b: 0x26, 0x25c: 0x26, 0x25d: 0x26, 0x25e: 0x26, 0x25f: 0x26, + 0x260: 0x26, 0x261: 0x26, 0x262: 0x26, 0x263: 0x26, 0x264: 0x26, 0x265: 0x26, 0x266: 0x26, 0x267: 0x26, + 0x268: 0x26, 0x269: 0x26, 0x26a: 0x26, 0x26b: 0x26, 0x26c: 0x26, 0x26d: 0x26, 0x26e: 0x26, 0x26f: 0x26, + 0x270: 0x26, 0x271: 0x26, 0x272: 0x26, 0x273: 0x26, 0x274: 0x26, 0x275: 0x26, 0x276: 0x26, 0x277: 0x26, + 0x278: 0x26, 0x279: 0x26, 0x27a: 0x26, 0x27b: 0x26, 0x27c: 0x26, 0x27d: 0x26, 0x27e: 0x26, 0x27f: 0x26, + // Block 0xa, offset 0x280 + 0x280: 0x26, 0x281: 0x26, 0x282: 0x26, 0x283: 0x26, 0x284: 0x26, 0x285: 0x26, 0x286: 0x26, 0x287: 0x26, + 0x288: 0x26, 0x289: 0x26, 0x28a: 0x26, 0x28b: 0x26, 0x28c: 0x26, 0x28d: 0x26, 0x28e: 0x26, 0x28f: 0x26, + 0x290: 0x26, 0x291: 0x26, 0x292: 0x26, 0x293: 0x26, 0x294: 0x26, 0x295: 0x26, 0x296: 0x26, 0x297: 0x26, + 0x298: 0x26, 0x299: 0x26, 0x29a: 0x26, 0x29b: 0x26, 0x29c: 0x26, 0x29d: 0x26, 0x29e: 0xa3, 0x29f: 0xa4, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x12, 0x2ed: 0xa5, 0x2ee: 0xa6, 0x2ef: 0xa7, + 0x2f0: 0x26, 0x2f1: 0x26, 0x2f2: 0x26, 0x2f3: 0x26, 0x2f4: 0xa8, 0x2f5: 0xa9, 0x2f6: 0xaa, 0x2f7: 0xab, + 0x2f8: 0xac, 0x2f9: 0xad, 0x2fa: 0x26, 0x2fb: 0xae, 0x2fc: 0xaf, 0x2fd: 0xb0, 0x2fe: 0xb1, 0x2ff: 0xb2, + // Block 0xc, offset 0x300 + 0x300: 0xb3, 0x301: 0xb4, 0x302: 0x26, 0x303: 0xb5, 0x305: 0xb6, 0x307: 0xb7, + 0x30a: 0xb8, 0x30b: 0xb9, 0x30c: 0xba, 0x30d: 0xbb, 0x30e: 0xbc, 0x30f: 0xbd, + 0x310: 0xbe, 0x311: 0xbf, 0x312: 0xc0, 0x313: 0xc1, 0x314: 0xc2, 0x315: 0xc3, 0x316: 0x13, + 0x318: 0x26, 0x319: 0x26, 0x31a: 0x26, 0x31b: 0x26, 0x31c: 0xc4, 0x31d: 0xc5, 0x31e: 0xc6, + 0x320: 0xc7, 0x321: 0xc8, 0x322: 0xc9, 0x323: 0xca, 0x324: 0xcb, 0x326: 0xcc, + 0x328: 0xcd, 0x329: 0xce, 0x32a: 0xcf, 0x32b: 0xd0, 0x32c: 0x60, 0x32d: 0xd1, 0x32e: 0xd2, + 0x330: 0x26, 0x331: 0xd3, 0x332: 0xd4, 0x333: 0xd5, 0x334: 0xd6, + 0x33a: 0xd7, 0x33b: 0xd8, 0x33c: 0xd9, 0x33d: 0xda, 0x33e: 0xdb, 0x33f: 0xdc, + // Block 0xd, offset 0x340 + 0x340: 0xdd, 0x341: 0xde, 0x342: 0xdf, 0x343: 0xe0, 0x344: 0xe1, 0x345: 0xe2, 0x346: 0xe3, 0x347: 0xe4, + 0x348: 0xe5, 0x349: 0xe6, 0x34a: 0xe7, 0x34b: 0xe8, 0x34c: 0xe9, 0x34d: 0xea, + 0x350: 0xeb, 0x351: 0xec, 0x352: 0xed, 0x353: 0xee, 0x356: 0xef, 0x357: 0xf0, + 0x358: 0xf1, 0x359: 0xf2, 0x35a: 0xf3, 0x35b: 0xf4, 0x35c: 0xf5, + 0x360: 0xf6, 0x362: 0xf7, 0x363: 0xf8, 0x364: 0xf9, 0x365: 0xfa, 0x366: 0xfb, 0x367: 0xfc, + 0x368: 0xfd, 0x369: 0xfe, 0x36a: 0xff, 0x36b: 0x100, + 0x370: 0x101, 0x371: 0x102, 0x372: 0x103, 0x374: 0x104, 0x375: 0x105, 0x376: 0x106, + 0x37b: 0x107, 0x37c: 0x108, 0x37d: 0x109, 0x37e: 0x10a, + // Block 0xe, offset 0x380 + 0x380: 0x26, 0x381: 0x26, 0x382: 0x26, 0x383: 0x26, 0x384: 0x26, 0x385: 0x26, 0x386: 0x26, 0x387: 0x26, + 0x388: 0x26, 0x389: 0x26, 0x38a: 0x26, 0x38b: 0x26, 0x38c: 0x26, 0x38d: 0x26, 0x38e: 0x10b, + 0x390: 0x26, 0x391: 0x10c, 0x392: 0x26, 0x393: 0x26, 0x394: 0x26, 0x395: 0x10d, + 0x3be: 0xa9, 0x3bf: 0x10e, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x26, 0x3c1: 0x26, 0x3c2: 0x26, 0x3c3: 0x26, 0x3c4: 0x26, 0x3c5: 0x26, 0x3c6: 0x26, 0x3c7: 0x26, + 0x3c8: 0x26, 0x3c9: 0x26, 0x3ca: 0x26, 0x3cb: 0x26, 0x3cc: 0x26, 0x3cd: 0x26, 0x3ce: 0x26, 0x3cf: 0x26, + 0x3d0: 0x10f, 0x3d1: 0x110, + // Block 0x10, offset 0x400 + 0x410: 0x26, 0x411: 0x26, 0x412: 0x26, 0x413: 0x26, 0x414: 0x26, 0x415: 0x26, 0x416: 0x26, 0x417: 0x26, + 0x418: 0x26, 0x419: 0x111, + // Block 0x11, offset 0x440 + 0x460: 0x26, 0x461: 0x26, 0x462: 0x26, 0x463: 0x26, 0x464: 0x26, 0x465: 0x26, 0x466: 0x26, 0x467: 0x26, + 0x468: 0x100, 0x469: 0x112, 0x46a: 0x113, 0x46b: 0x114, 0x46c: 0x115, 0x46d: 0x116, 0x46e: 0x117, + 0x479: 0x118, 0x47c: 0x26, 0x47d: 0x119, 0x47e: 0x11a, 0x47f: 0x11b, + // Block 0x12, offset 0x480 + 0x4bf: 0x11c, + // Block 0x13, offset 0x4c0 + 0x4f0: 0x26, 0x4f1: 0x11d, 0x4f2: 0x11e, + // Block 0x14, offset 0x500 + 0x53c: 0x11f, 0x53d: 0x120, + // Block 0x15, offset 0x540 + 0x545: 0x121, 0x546: 0x122, + 0x549: 0x123, + 0x550: 0x124, 0x551: 0x125, 0x552: 0x126, 0x553: 0x127, 0x554: 0x128, 0x555: 0x129, 0x556: 0x12a, 0x557: 0x12b, + 0x558: 0x12c, 0x559: 0x12d, 0x55a: 0x12e, 0x55b: 0x12f, 0x55c: 0x130, 0x55d: 0x131, 0x55e: 0x132, 0x55f: 0x133, + 0x568: 0x134, 0x569: 0x135, 0x56a: 0x136, + 0x57c: 0x137, + // Block 0x16, offset 0x580 + 0x580: 0x138, 0x581: 0x139, 0x582: 0x13a, 0x584: 0x13b, 0x585: 0x13c, + 0x58a: 0x13d, 0x58b: 0x13e, + 0x593: 0x13f, + 0x59f: 0x140, + 0x5a0: 0x26, 0x5a1: 0x26, 0x5a2: 0x26, 0x5a3: 0x141, 0x5a4: 0x14, 0x5a5: 0x142, + 0x5b8: 0x143, 0x5b9: 0x15, 0x5ba: 0x144, + // Block 0x17, offset 0x5c0 + 0x5c4: 0x145, 0x5c5: 0x146, 0x5c6: 0x147, + 0x5cf: 0x148, + 0x5ef: 0x149, + // Block 0x18, offset 0x600 + 0x610: 0x0a, 0x611: 0x0b, 0x612: 0x0c, 0x613: 0x0d, 0x614: 0x0e, 0x616: 0x0f, + 0x61a: 0x10, 0x61b: 0x11, 0x61c: 0x12, 0x61d: 0x13, 0x61e: 0x14, 0x61f: 0x15, + // Block 0x19, offset 0x640 + 0x640: 0x14a, 0x641: 0x14b, 0x644: 0x14b, 0x645: 0x14b, 0x646: 0x14b, 0x647: 0x14c, + // Block 0x1a, offset 0x680 + 0x6a0: 0x17, +} + +// sparseOffsets: 312 entries, 624 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x34, 0x37, 0x3b, 0x3e, 0x42, 0x4c, 0x4e, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xaf, 0xb7, 0xbd, 0xcb, 0xd6, 0xe3, 0xee, 0xfa, 0x104, 0x110, 0x11b, 0x127, 0x133, 0x13b, 0x145, 0x150, 0x15b, 0x167, 0x16d, 0x178, 0x17e, 0x186, 0x189, 0x18e, 0x192, 0x196, 0x19d, 0x1a6, 0x1ae, 0x1af, 0x1b8, 0x1bf, 0x1c7, 0x1cd, 0x1d2, 0x1d6, 0x1d9, 0x1db, 0x1de, 0x1e3, 0x1e4, 0x1e6, 0x1e8, 0x1ea, 0x1f1, 0x1f6, 0x1fa, 0x203, 0x206, 0x209, 0x20f, 0x210, 0x21b, 0x21c, 0x21d, 0x222, 0x22f, 0x238, 0x23e, 0x246, 0x24f, 0x258, 0x261, 0x266, 0x269, 0x274, 0x282, 0x284, 0x28b, 0x28f, 0x29b, 0x29c, 0x2a7, 0x2af, 0x2b7, 0x2bd, 0x2be, 0x2cc, 0x2d1, 0x2d4, 0x2d9, 0x2dd, 0x2e3, 0x2e8, 0x2eb, 0x2f0, 0x2f5, 0x2f6, 0x2fc, 0x2fe, 0x2ff, 0x301, 0x303, 0x306, 0x307, 0x309, 0x30c, 0x312, 0x316, 0x318, 0x31d, 0x324, 0x334, 0x33e, 0x33f, 0x348, 0x34c, 0x351, 0x359, 0x35f, 0x365, 0x36f, 0x374, 0x37d, 0x383, 0x38c, 0x390, 0x398, 0x39a, 0x39c, 0x39f, 0x3a1, 0x3a3, 0x3a4, 0x3a5, 0x3a7, 0x3a9, 0x3af, 0x3b4, 0x3b6, 0x3bd, 0x3c0, 0x3c2, 0x3c8, 0x3cd, 0x3cf, 0x3d0, 0x3d1, 0x3d2, 0x3d4, 0x3d6, 0x3d8, 0x3db, 0x3dd, 0x3e0, 0x3e8, 0x3eb, 0x3ef, 0x3f7, 0x3f9, 0x409, 0x40a, 0x40c, 0x411, 0x417, 0x419, 0x41a, 0x41c, 0x41e, 0x420, 0x42d, 0x42e, 0x42f, 0x433, 0x435, 0x436, 0x437, 0x438, 0x439, 0x43c, 0x43f, 0x440, 0x443, 0x44a, 0x450, 0x452, 0x456, 0x45e, 0x464, 0x468, 0x46f, 0x473, 0x477, 0x480, 0x48a, 0x48c, 0x492, 0x498, 0x4a2, 0x4ac, 0x4ae, 0x4b7, 0x4bd, 0x4c3, 0x4c9, 0x4cc, 0x4d2, 0x4d5, 0x4de, 0x4df, 0x4e6, 0x4ea, 0x4eb, 0x4ee, 0x4f8, 0x4fb, 0x4fd, 0x504, 0x50c, 0x512, 0x519, 0x51a, 0x520, 0x523, 0x52b, 0x532, 0x53c, 0x544, 0x547, 0x54c, 0x550, 0x551, 0x552, 0x553, 0x554, 0x555, 0x557, 0x55a, 0x55b, 0x55e, 0x55f, 0x562, 0x564, 0x568, 0x569, 0x56b, 0x56e, 0x570, 0x573, 0x576, 0x578, 0x57d, 0x57f, 0x580, 0x585, 0x589, 0x58a, 0x58d, 0x591, 0x59c, 0x5a0, 0x5a8, 0x5ad, 0x5b1, 0x5b4, 0x5b8, 0x5bb, 0x5be, 0x5c3, 0x5c7, 0x5cb, 0x5cf, 0x5d3, 0x5d5, 0x5d7, 0x5da, 0x5de, 0x5e4, 0x5e5, 0x5e6, 0x5e9, 0x5eb, 0x5ed, 0x5f0, 0x5f5, 0x5f9, 0x5fb, 0x601, 0x60a, 0x60f, 0x610, 0x613, 0x614, 0x615, 0x616, 0x618, 0x619, 0x61a} + +// sparseValues: 1562 entries, 6248 bytes +var sparseValues = [1562]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xbf}, + // Block 0x6, offset 0x34 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x37 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3b + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3e + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x42 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4c + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4e + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0054, lo: 0x9f, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x18, offset 0xaf + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0004, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0024, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0024, lo: 0x9c, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x19, offset 0xb7 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1a, offset 0xbd + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1b, offset 0xcb + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1c, offset 0xd6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1d, offset 0xe3 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1e, offset 0xee + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x1f, offset 0xfa + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x20, offset 0x104 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x21, offset 0x110 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x22, offset 0x11b + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x23, offset 0x127 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x24, offset 0x133 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x26, offset 0x145 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x27, offset 0x150 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x28, offset 0x15b + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9d, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb3}, + // Block 0x29, offset 0x167 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2a, offset 0x16d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2b, offset 0x178 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2c, offset 0x17e + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2d, offset 0x186 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2e, offset 0x189 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x2f, offset 0x18e + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x30, offset 0x192 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x31, offset 0x196 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x32, offset 0x19d + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x33, offset 0x1a6 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x34, offset 0x1ae + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x35, offset 0x1af + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x36, offset 0x1b8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x37, offset 0x1bf + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x38, offset 0x1c7 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3a, offset 0x1d2 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3b, offset 0x1d6 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1d9 + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3d, offset 0x1db + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3e, offset 0x1de + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x3f, offset 0x1e3 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x40, offset 0x1e4 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x41, offset 0x1e6 + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x42, offset 0x1e8 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x43, offset 0x1ea + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0030, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x9f, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0030, lo: 0xb4, hi: 0xb4}, + // Block 0x44, offset 0x1f1 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x45, offset 0x1f6 + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x46, offset 0x1fa + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x47, offset 0x203 + {value: 0x0014, lo: 0x8b, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x48, offset 0x206 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x49, offset 0x209 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4a, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4b, offset 0x210 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4c, offset 0x21b + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4d, offset 0x21c + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4e, offset 0x21d + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x4f, offset 0x222 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x50, offset 0x22f + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x238 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0024, lo: 0x81, hi: 0x82}, + {value: 0x0034, lo: 0x83, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8e}, + // Block 0x52, offset 0x23e + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x53, offset 0x246 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x54, offset 0x24f + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x55, offset 0x258 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x56, offset 0x261 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x57, offset 0x266 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x58, offset 0x269 + {value: 0x31ea, lo: 0x80, hi: 0x80}, + {value: 0x326a, lo: 0x81, hi: 0x81}, + {value: 0x32ea, lo: 0x82, hi: 0x82}, + {value: 0x336a, lo: 0x83, hi: 0x83}, + {value: 0x33ea, lo: 0x84, hi: 0x84}, + {value: 0x346a, lo: 0x85, hi: 0x85}, + {value: 0x34ea, lo: 0x86, hi: 0x86}, + {value: 0x356a, lo: 0x87, hi: 0x87}, + {value: 0x35ea, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x59, offset 0x274 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xba}, + // Block 0x5a, offset 0x282 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5b, offset 0x284 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5c, offset 0x28b + {value: 0x0012, lo: 0x80, hi: 0x8d}, + {value: 0x8f52, lo: 0x8e, hi: 0x8e}, + {value: 0x0012, lo: 0x8f, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5d, offset 0x28f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5e, offset 0x29b + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x5f, offset 0x29c + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x369a, lo: 0x96, hi: 0x96}, + {value: 0x374a, lo: 0x97, hi: 0x97}, + {value: 0x37fa, lo: 0x98, hi: 0x98}, + {value: 0x38aa, lo: 0x99, hi: 0x99}, + {value: 0x395a, lo: 0x9a, hi: 0x9a}, + {value: 0x3a0a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3abb, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x60, offset 0x2a7 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x61, offset 0x2af + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x62, offset 0x2b7 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2bd + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x64, offset 0x2be + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x65, offset 0x2cc + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa452, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x66, offset 0x2d1 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x67, offset 0x2d4 + {value: 0xa753, lo: 0xb6, hi: 0xb7}, + {value: 0xaa53, lo: 0xb8, hi: 0xb9}, + {value: 0xad53, lo: 0xba, hi: 0xbb}, + {value: 0xaa53, lo: 0xbc, hi: 0xbd}, + {value: 0xa753, lo: 0xbe, hi: 0xbf}, + // Block 0x68, offset 0x2d9 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xb053, lo: 0xa0, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x69, offset 0x2dd + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6a, offset 0x2e3 + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e8 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6c, offset 0x2eb + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6d, offset 0x2f0 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6e, offset 0x2f5 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x6f, offset 0x2f6 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x70, offset 0x2fc + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x71, offset 0x2fe + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x72, offset 0x2ff + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x73, offset 0x301 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x74, offset 0x303 + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x75, offset 0x306 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x76, offset 0x307 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x77, offset 0x309 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x78, offset 0x30c + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x79, offset 0x312 + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7a, offset 0x316 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7b, offset 0x318 + {value: 0x0004, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7c, offset 0x31d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7d, offset 0x324 + {value: 0x0117, lo: 0x80, hi: 0x83}, + {value: 0x6553, lo: 0x84, hi: 0x84}, + {value: 0x908b, lo: 0x85, hi: 0x85}, + {value: 0x8f53, lo: 0x86, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0117, lo: 0x90, hi: 0x91}, + {value: 0x0012, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x95, hi: 0x95}, + {value: 0x0117, lo: 0x96, hi: 0x99}, + {value: 0x0015, lo: 0xb2, hi: 0xb4}, + {value: 0x0316, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7e, offset 0x334 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + // Block 0x7f, offset 0x33e + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x80, offset 0x33f + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x81, offset 0x348 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x82, offset 0x34c + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x83, offset 0x351 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x84, offset 0x359 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x85, offset 0x35f + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x86, offset 0x365 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x87, offset 0x36f + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x88, offset 0x374 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x89, offset 0x37d + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8a, offset 0x383 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xb352, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa8}, + {value: 0x0015, lo: 0xa9, hi: 0xa9}, + {value: 0x0004, lo: 0xaa, hi: 0xab}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x38c + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x390 + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8d, offset 0x398 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x39a + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x8f, offset 0x39c + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x90, offset 0x39f + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x91, offset 0x3a1 + {value: 0x0004, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x92, offset 0x3a3 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x93, offset 0x3a4 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x94, offset 0x3a5 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x95, offset 0x3a7 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x96, offset 0x3a9 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x97, offset 0x3af + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x98, offset 0x3b4 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x3b6 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3bd + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9b, offset 0x3c0 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9c, offset 0x3c2 + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9d, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9e, offset 0x3cd + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0x9f, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa0, offset 0x3d0 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa1, offset 0x3d1 + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa2, offset 0x3d2 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa3, offset 0x3d4 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa4, offset 0x3d6 + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa5, offset 0x3d8 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa6, offset 0x3db + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa7, offset 0x3dd + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa8, offset 0x3e0 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb653, lo: 0x98, hi: 0x9f}, + {value: 0xb953, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xa9, offset 0x3e8 + {value: 0xb652, lo: 0x80, hi: 0x87}, + {value: 0xb952, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xaa, offset 0x3eb + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb953, lo: 0xb0, hi: 0xb7}, + {value: 0xb653, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3ef + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb952, lo: 0x98, hi: 0x9f}, + {value: 0xb652, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xac, offset 0x3f7 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xad, offset 0x3f9 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0xbc53, lo: 0xb0, hi: 0xb0}, + {value: 0xbf53, lo: 0xb1, hi: 0xb1}, + {value: 0xc253, lo: 0xb2, hi: 0xb2}, + {value: 0xbf53, lo: 0xb3, hi: 0xb3}, + {value: 0xc553, lo: 0xb4, hi: 0xb4}, + {value: 0xbf53, lo: 0xb5, hi: 0xb5}, + {value: 0xc253, lo: 0xb6, hi: 0xb6}, + {value: 0xbf53, lo: 0xb7, hi: 0xb7}, + {value: 0xbc53, lo: 0xb8, hi: 0xb8}, + {value: 0xc853, lo: 0xb9, hi: 0xb9}, + {value: 0xcb53, lo: 0xba, hi: 0xba}, + {value: 0xce53, lo: 0xbc, hi: 0xbc}, + {value: 0xc853, lo: 0xbd, hi: 0xbd}, + {value: 0xcb53, lo: 0xbe, hi: 0xbe}, + {value: 0xc853, lo: 0xbf, hi: 0xbf}, + // Block 0xae, offset 0x409 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xaf, offset 0x40a + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb0, offset 0x40c + {value: 0x0015, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0015, lo: 0x83, hi: 0x85}, + {value: 0x0015, lo: 0x87, hi: 0xb0}, + {value: 0x0015, lo: 0xb2, hi: 0xba}, + // Block 0xb1, offset 0x411 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb2, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb3, offset 0x419 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb4, offset 0x41a + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb5, offset 0x41c + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb6, offset 0x41e + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb7, offset 0x420 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb8, offset 0x42d + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb9, offset 0x42e + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xba, offset 0x42f + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbb, offset 0x433 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbc, offset 0x435 + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbd, offset 0x436 + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbe, offset 0x437 + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x438 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x439 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc1, offset 0x43c + {value: 0x0010, lo: 0x80, hi: 0xa9}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + // Block 0xc2, offset 0x43f + {value: 0x0034, lo: 0xbd, hi: 0xbf}, + // Block 0xc3, offset 0x440 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc4, offset 0x443 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc5, offset 0x44a + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x82}, + {value: 0x0034, lo: 0x83, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc6, offset 0x450 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xc7, offset 0x452 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc8, offset 0x456 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc9, offset 0x45e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xca, offset 0x464 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcb, offset 0x468 + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xcc, offset 0x46f + {value: 0x0010, lo: 0x84, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xcd, offset 0x473 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xce, offset 0x477 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xcf, offset 0x480 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xd0, offset 0x48a + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + // Block 0xd1, offset 0x48c + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xd2, offset 0x492 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd3, offset 0x498 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xd4, offset 0x4a2 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xd5, offset 0x4ac + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd6, offset 0x4ae + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + // Block 0xd7, offset 0x4b7 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd8, offset 0x4bd + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd9, offset 0x4c3 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xda, offset 0x4c9 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xdb, offset 0x4cc + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xdc, offset 0x4d2 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xdd, offset 0x4d5 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + // Block 0xde, offset 0x4de + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xdf, offset 0x4df + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xe0, offset 0x4e6 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xe1, offset 0x4ea + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xe2, offset 0x4eb + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xe3, offset 0x4ee + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8c, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + {value: 0x0030, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xe4, offset 0x4f8 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0034, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xe5, offset 0x4fb + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe6, offset 0x4fd + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0014, lo: 0x94, hi: 0x97}, + {value: 0x0014, lo: 0x9a, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0x9f}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + // Block 0xe7, offset 0x504 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xe8, offset 0x50c + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xe9, offset 0x512 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xea, offset 0x519 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xeb, offset 0x51a + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xec, offset 0x520 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xed, offset 0x523 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xee, offset 0x52b + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xef, offset 0x532 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xf0, offset 0x53c + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xf1, offset 0x544 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xf2, offset 0x547 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xf3, offset 0x54c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0030, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xf4, offset 0x550 + {value: 0x0010, lo: 0xb0, hi: 0xb0}, + // Block 0xf5, offset 0x551 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xf6, offset 0x552 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xf7, offset 0x553 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xf8, offset 0x554 + {value: 0x0010, lo: 0x80, hi: 0xb0}, + // Block 0xf9, offset 0x555 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xbf}, + // Block 0xfa, offset 0x557 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x95}, + // Block 0xfb, offset 0x55a + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xfc, offset 0x55b + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xfd, offset 0x55e + {value: 0x0010, lo: 0x80, hi: 0xbe}, + // Block 0xfe, offset 0x55f + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xff, offset 0x562 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0x100, offset 0x564 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x101, offset 0x568 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0x102, offset 0x569 + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0x103, offset 0x56b + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x104, offset 0x56e + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0x105, offset 0x570 + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa3, hi: 0xa4}, + {value: 0x0030, lo: 0xb0, hi: 0xb1}, + // Block 0x106, offset 0x573 + {value: 0x0004, lo: 0xb0, hi: 0xb3}, + {value: 0x0004, lo: 0xb5, hi: 0xbb}, + {value: 0x0004, lo: 0xbd, hi: 0xbe}, + // Block 0x107, offset 0x576 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0x108, offset 0x578 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0x109, offset 0x57d + {value: 0x0014, lo: 0x80, hi: 0xad}, + {value: 0x0014, lo: 0xb0, hi: 0xbf}, + // Block 0x10a, offset 0x57f + {value: 0x0014, lo: 0x80, hi: 0x86}, + // Block 0x10b, offset 0x580 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0x10c, offset 0x585 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0x10d, offset 0x589 + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0x10e, offset 0x58a + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0x10f, offset 0x58d + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x110, offset 0x591 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0x111, offset 0x59c + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x112, offset 0x5a0 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0x113, offset 0x5a8 + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x114, offset 0x5ad + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x115, offset 0x5b1 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x116, offset 0x5b4 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x117, offset 0x5b8 + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x118, offset 0x5bb + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x119, offset 0x5be + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x11a, offset 0x5c3 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x11b, offset 0x5c7 + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x11c, offset 0x5cb + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x11d, offset 0x5cf + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x11e, offset 0x5d3 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x11f, offset 0x5d5 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x120, offset 0x5d7 + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x121, offset 0x5da + {value: 0x0012, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8a, hi: 0x8a}, + {value: 0x0012, lo: 0x8b, hi: 0x9e}, + {value: 0x0012, lo: 0xa5, hi: 0xaa}, + // Block 0x122, offset 0x5de + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + {value: 0x0015, lo: 0xb0, hi: 0xbf}, + // Block 0x123, offset 0x5e4 + {value: 0x0015, lo: 0x80, hi: 0xad}, + // Block 0x124, offset 0x5e5 + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + // Block 0x125, offset 0x5e6 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + // Block 0x126, offset 0x5e9 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + // Block 0x127, offset 0x5eb + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xae}, + // Block 0x128, offset 0x5ed + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0024, lo: 0xac, hi: 0xaf}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x129, offset 0x5f0 + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x12a, offset 0x5f5 + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xab}, + {value: 0x0010, lo: 0xad, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xbe}, + // Block 0x12b, offset 0x5f9 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x12c, offset 0x5fb + {value: 0xd152, lo: 0x80, hi: 0x81}, + {value: 0xd452, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x12d, offset 0x601 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x12e, offset 0x60a + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x12f, offset 0x60f + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x130, offset 0x610 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x131, offset 0x613 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x132, offset 0x614 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x133, offset 0x615 + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x134, offset 0x616 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x135, offset 0x618 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x136, offset 0x619 + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 16093 bytes (15KiB); checksum: EE91C452 diff --git a/vendor/golang.org/x/text/cases/tables9.0.0.go b/vendor/golang.org/x/text/cases/tables9.0.0.go index 636d5d14..3aeb7be6 100644 --- a/vendor/golang.org/x/text/cases/tables9.0.0.go +++ b/vendor/golang.org/x/text/cases/tables9.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build !go1.10 -// +build !go1.10 package cases diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go index 32af9de5..a09ed198 100644 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -790,226 +790,226 @@ const ( var coreTags = []language.CompactCoreInfo{ // 773 elements // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, } // Size: 3116 bytes const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" -// Total table size 3147 bytes (3KiB); checksum: 6772C83C +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go index fb6b5837..14167e74 100644 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const NumLanguages = 8752 +const NumLanguages = 8798 -const NumScripts = 258 +const NumScripts = 261 -const NumRegions = 357 +const NumRegions = 358 type FromTo struct { From uint16 @@ -263,7 +263,7 @@ var langNoIndex = [2197]uint8{ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, @@ -278,7 +278,7 @@ var langNoIndex = [2197]uint8{ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, @@ -289,11 +289,11 @@ var langNoIndex = [2197]uint8{ // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, @@ -303,20 +303,20 @@ var langNoIndex = [2197]uint8{ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, @@ -337,7 +337,7 @@ var langNoIndex = [2197]uint8{ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F @@ -359,13 +359,13 @@ var langNoIndex = [2197]uint8{ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, // Entry 300 - 33F 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, @@ -392,14 +392,14 @@ var langNoIndex = [2197]uint8{ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, @@ -424,12 +424,12 @@ var langNoIndex = [2197]uint8{ // Entry 480 - 4BF 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, // Entry 4C0 - 4FF 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, @@ -441,7 +441,7 @@ var langNoIndex = [2197]uint8{ 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, @@ -449,7 +449,7 @@ var langNoIndex = [2197]uint8{ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -464,13 +464,13 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, @@ -491,20 +491,20 @@ var langNoIndex = [2197]uint8{ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -513,7 +513,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, @@ -522,7 +522,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, @@ -530,12 +530,12 @@ var langNoIndex = [2197]uint8{ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF @@ -545,11 +545,11 @@ var langNoIndex = [2197]uint8{ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, @@ -557,11 +557,11 @@ var langNoIndex = [2197]uint8{ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, @@ -583,8 +583,8 @@ var altLangIndex = [6]uint16{ } // AliasMap maps langIDs to their suggested replacements. -// Size: 716 bytes, 179 elements -var AliasMap = [179]FromTo{ +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ 0: {From: 0x82, To: 0x88}, 1: {From: 0x187, To: 0x1ae}, 2: {From: 0x1f3, To: 0x1e1}, @@ -599,223 +599,239 @@ var AliasMap = [179]FromTo{ 11: {From: 0x4a2, To: 0x21}, 12: {From: 0x53e, To: 0x544}, 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8a8, To: 0x8b7}, - 29: {From: 0x8c3, To: 0xee3}, - 30: {From: 0x8fa, To: 0x1dc}, - 31: {From: 0x9ef, To: 0x331}, - 32: {From: 0xa36, To: 0x2c5}, - 33: {From: 0xa3d, To: 0xbf}, - 34: {From: 0xabe, To: 0x3322}, - 35: {From: 0xb38, To: 0x529}, - 36: {From: 0xb75, To: 0x265a}, - 37: {From: 0xb7e, To: 0xbc3}, - 38: {From: 0xb9b, To: 0x44e}, - 39: {From: 0xbbc, To: 0x4229}, - 40: {From: 0xbbf, To: 0x529}, - 41: {From: 0xbfe, To: 0x2da7}, - 42: {From: 0xc2e, To: 0x3181}, - 43: {From: 0xcb9, To: 0xf3}, - 44: {From: 0xd08, To: 0xfa}, - 45: {From: 0xdc8, To: 0x11a}, - 46: {From: 0xdd7, To: 0x32d}, - 47: {From: 0xdf8, To: 0xdfb}, - 48: {From: 0xdfe, To: 0x531}, - 49: {From: 0xe01, To: 0xdf3}, - 50: {From: 0xedf, To: 0x205a}, - 51: {From: 0xee9, To: 0x222e}, - 52: {From: 0xeee, To: 0x2e9a}, - 53: {From: 0xf39, To: 0x367}, - 54: {From: 0x10d0, To: 0x140}, - 55: {From: 0x1104, To: 0x2d0}, - 56: {From: 0x11a0, To: 0x1ec}, - 57: {From: 0x1279, To: 0x21}, - 58: {From: 0x1424, To: 0x15e}, - 59: {From: 0x1470, To: 0x14e}, - 60: {From: 0x151f, To: 0xd9b}, - 61: {From: 0x1523, To: 0x390}, - 62: {From: 0x1532, To: 0x19f}, - 63: {From: 0x1580, To: 0x210}, - 64: {From: 0x1583, To: 0x10d}, - 65: {From: 0x15a3, To: 0x3caf}, - 66: {From: 0x1630, To: 0x222e}, - 67: {From: 0x166a, To: 0x19b}, - 68: {From: 0x16c8, To: 0x136}, - 69: {From: 0x1700, To: 0x29f8}, - 70: {From: 0x1718, To: 0x194}, - 71: {From: 0x1727, To: 0xf3f}, - 72: {From: 0x177a, To: 0x178}, - 73: {From: 0x1809, To: 0x17b6}, - 74: {From: 0x1816, To: 0x18f3}, - 75: {From: 0x188a, To: 0x436}, - 76: {From: 0x1979, To: 0x1d01}, - 77: {From: 0x1a74, To: 0x2bb0}, - 78: {From: 0x1a8a, To: 0x1f8}, - 79: {From: 0x1b5a, To: 0x1fa}, - 80: {From: 0x1b86, To: 0x1515}, - 81: {From: 0x1d64, To: 0x2c9b}, - 82: {From: 0x2038, To: 0x37b1}, - 83: {From: 0x203d, To: 0x20dd}, - 84: {From: 0x205a, To: 0x30b}, - 85: {From: 0x20e3, To: 0x274}, - 86: {From: 0x20ee, To: 0x263}, - 87: {From: 0x20f2, To: 0x22d}, - 88: {From: 0x20f9, To: 0x256}, - 89: {From: 0x210f, To: 0x21eb}, - 90: {From: 0x2135, To: 0x27d}, - 91: {From: 0x2160, To: 0x913}, - 92: {From: 0x2199, To: 0x121}, - 93: {From: 0x21ce, To: 0x1561}, - 94: {From: 0x21e6, To: 0x504}, - 95: {From: 0x21f4, To: 0x49f}, - 96: {From: 0x21fb, To: 0x269}, - 97: {From: 0x222d, To: 0x121}, - 98: {From: 0x2237, To: 0x121}, - 99: {From: 0x2262, To: 0x92a}, - 100: {From: 0x2316, To: 0x3226}, - 101: {From: 0x236a, To: 0x2835}, - 102: {From: 0x2382, To: 0x3365}, - 103: {From: 0x2472, To: 0x2c7}, - 104: {From: 0x24e4, To: 0x2ff}, - 105: {From: 0x24f0, To: 0x2fa}, - 106: {From: 0x24fa, To: 0x31f}, - 107: {From: 0x2550, To: 0xb5b}, - 108: {From: 0x25a9, To: 0xe2}, - 109: {From: 0x263e, To: 0x2d0}, - 110: {From: 0x26c9, To: 0x26b4}, - 111: {From: 0x26f9, To: 0x3c8}, - 112: {From: 0x2727, To: 0x3caf}, - 113: {From: 0x2755, To: 0x6a4}, - 114: {From: 0x2765, To: 0x26b4}, - 115: {From: 0x2789, To: 0x4358}, - 116: {From: 0x27c9, To: 0x2001}, - 117: {From: 0x28ea, To: 0x27b1}, - 118: {From: 0x28ef, To: 0x2837}, - 119: {From: 0x2914, To: 0x351}, - 120: {From: 0x2986, To: 0x2da7}, - 121: {From: 0x29f0, To: 0x96b}, - 122: {From: 0x2b1a, To: 0x38d}, - 123: {From: 0x2bfc, To: 0x395}, - 124: {From: 0x2c3f, To: 0x3caf}, - 125: {From: 0x2ce1, To: 0x2201}, - 126: {From: 0x2cfc, To: 0x3be}, - 127: {From: 0x2d13, To: 0x597}, - 128: {From: 0x2d47, To: 0x148}, - 129: {From: 0x2d48, To: 0x148}, - 130: {From: 0x2dff, To: 0x2f1}, - 131: {From: 0x2e08, To: 0x19cc}, - 132: {From: 0x2e1a, To: 0x2d95}, - 133: {From: 0x2e21, To: 0x292}, - 134: {From: 0x2e54, To: 0x7d}, - 135: {From: 0x2e65, To: 0x2282}, - 136: {From: 0x2ea0, To: 0x2e9b}, - 137: {From: 0x2eef, To: 0x2ed7}, - 138: {From: 0x3193, To: 0x3c4}, - 139: {From: 0x3366, To: 0x338e}, - 140: {From: 0x342a, To: 0x3dc}, - 141: {From: 0x34ee, To: 0x18d0}, - 142: {From: 0x35c8, To: 0x2c9b}, - 143: {From: 0x35e6, To: 0x412}, - 144: {From: 0x3658, To: 0x246}, - 145: {From: 0x3676, To: 0x3f4}, - 146: {From: 0x36fd, To: 0x445}, - 147: {From: 0x37c0, To: 0x121}, - 148: {From: 0x3816, To: 0x38f2}, - 149: {From: 0x382a, To: 0x2b48}, - 150: {From: 0x382b, To: 0x2c9b}, - 151: {From: 0x382f, To: 0xa9}, - 152: {From: 0x3832, To: 0x3228}, - 153: {From: 0x386c, To: 0x39a6}, - 154: {From: 0x3892, To: 0x3fc0}, - 155: {From: 0x38a5, To: 0x39d7}, - 156: {From: 0x38b4, To: 0x1fa4}, - 157: {From: 0x38b5, To: 0x2e9a}, - 158: {From: 0x395c, To: 0x47e}, - 159: {From: 0x3b4e, To: 0xd91}, - 160: {From: 0x3b78, To: 0x137}, - 161: {From: 0x3c99, To: 0x4bc}, - 162: {From: 0x3fbd, To: 0x100}, - 163: {From: 0x4208, To: 0xa91}, - 164: {From: 0x42be, To: 0x573}, - 165: {From: 0x42f9, To: 0x3f60}, - 166: {From: 0x4378, To: 0x25a}, - 167: {From: 0x43b8, To: 0xe6c}, - 168: {From: 0x43cd, To: 0x10f}, - 169: {From: 0x44af, To: 0x3322}, - 170: {From: 0x44e3, To: 0x512}, - 171: {From: 0x45ca, To: 0x2409}, - 172: {From: 0x45dd, To: 0x26dc}, - 173: {From: 0x4610, To: 0x48ae}, - 174: {From: 0x46ae, To: 0x46a0}, - 175: {From: 0x473e, To: 0x4745}, - 176: {From: 0x4817, To: 0x3503}, - 177: {From: 0x4916, To: 0x31f}, - 178: {From: 0x49a7, To: 0x523}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, } -// Size: 179 bytes, 179 elements -var AliasTypes = [179]AliasType{ +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, - 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, - 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, // Entry 40 - 7F - 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, - 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, - 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, // Entry 80 - BF - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, - 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, - 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, - 0, 1, 1, + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, } const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1040 bytes +const script tag.Index = "" + // Size: 1052 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + - "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + - "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + - "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + - "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + - "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + - "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + - "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. @@ -824,7 +840,7 @@ var suppressScript = [1330]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -833,7 +849,7 @@ var suppressScript = [1330]uint8{ // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -846,53 +862,53 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, // Entry 1C0 - 1FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, // Entry 200 - 23F 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -903,9 +919,9 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -913,93 +929,93 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 280 - 2BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 500 - 53F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1007,7 +1023,7 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, } @@ -1016,16 +1032,16 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -1034,8 +1050,8 @@ const ( const isoRegionOffset = 32 // regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1048,45 +1064,45 @@ var regionTypes = [358]uint8{ // Entry 40 - 7F 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. @@ -1094,27 +1110,27 @@ var regionTypes = [358]uint8{ // - [A-Z}{2}: the first letter of the 2-letter code plus these two // letters form the 3-letter ISO code. // - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes +const regionISO tag.Index = "" + // Size: 1312 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. @@ -1124,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, } // Size: 80 bytes, 20 elements var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1168,45 +1184,45 @@ var m49 = [358]int16{ // Entry 40 - 7F 535, 76, 44, 64, 104, 74, 72, 112, 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits @@ -1227,65 +1243,65 @@ var m49Index = [9]int16{ var fromM49 = [333]uint16{ // Entry 0 - 3F 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, } -// Size: 2014 bytes +// Size: 2128 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, "1901": 0x2, "1959acad": 0x3, - "1994": 0x61, + "1994": 0x67, "1996": 0x4, "abl1943": 0x5, "akuapem": 0x6, - "alalc97": 0x63, + "alalc97": 0x69, "aluku": 0x7, "ao1990": 0x8, "aranes": 0x9, @@ -1299,94 +1315,100 @@ var variantIndex = map[string]uint8{ "barla": 0x11, "basiceng": 0x12, "bauddha": 0x13, - "biscayan": 0x14, - "biske": 0x5c, - "bohoric": 0x15, - "boont": 0x16, - "bornholm": 0x17, - "cisaup": 0x18, - "colb1945": 0x19, - "cornu": 0x1a, - "creiss": 0x1b, - "dajnko": 0x1c, - "ekavsk": 0x1d, - "emodeng": 0x1e, - "fonipa": 0x64, - "fonkirsh": 0x65, - "fonnapa": 0x66, - "fonupa": 0x67, - "fonxsamp": 0x68, - "gascon": 0x1f, - "grclass": 0x20, - "grital": 0x21, - "grmistr": 0x22, - "hepburn": 0x23, - "heploc": 0x62, - "hognorsk": 0x24, - "hsistemo": 0x25, - "ijekavsk": 0x26, - "itihasa": 0x27, - "ivanchov": 0x28, - "jauer": 0x29, - "jyutping": 0x2a, - "kkcor": 0x2b, - "kociewie": 0x2c, - "kscor": 0x2d, - "laukika": 0x2e, - "lemosin": 0x2f, - "lengadoc": 0x30, - "lipaw": 0x5d, - "luna1918": 0x31, - "metelko": 0x32, - "monoton": 0x33, - "ndyuka": 0x34, - "nedis": 0x35, - "newfound": 0x36, - "nicard": 0x37, - "njiva": 0x5e, - "nulik": 0x38, - "osojs": 0x5f, - "oxendict": 0x39, - "pahawh2": 0x3a, - "pahawh3": 0x3b, - "pahawh4": 0x3c, - "pamaka": 0x3d, - "peano": 0x3e, - "petr1708": 0x3f, - "pinyin": 0x40, - "polyton": 0x41, - "provenc": 0x42, - "puter": 0x43, - "rigik": 0x44, - "rozaj": 0x45, - "rumgr": 0x46, - "scotland": 0x47, - "scouse": 0x48, - "simple": 0x69, - "solba": 0x60, - "sotav": 0x49, - "spanglis": 0x4a, - "surmiran": 0x4b, - "sursilv": 0x4c, - "sutsilv": 0x4d, - "tarask": 0x4e, - "tongyong": 0x4f, - "tunumiit": 0x50, - "uccor": 0x51, - "ucrcor": 0x52, - "ulster": 0x53, - "unifon": 0x54, - "vaidika": 0x55, - "valencia": 0x56, - "vallader": 0x57, - "vecdruka": 0x58, - "vivaraup": 0x59, - "wadegile": 0x5a, - "xsistemo": 0x5b, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, } // variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 99 +const variantNumSpecialized = 105 // nRegionGroups is the number of region groups. const nRegionGroups = 33 @@ -1398,151 +1420,151 @@ type likelyLangRegion struct { // likelyScript is a lookup table, indexed by scriptID, for the most likely // languages and regions given a script. -// Size: 1040 bytes, 260 elements -var likelyScript = [260]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, 22: {lang: 0xdb, region: 0x35}, 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, + 58: {lang: 0x1cb, region: 0xe8}, 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 133: {lang: 0x3b, region: 0x11c}, - 134: {lang: 0xfd, region: 0xc4}, - 137: {lang: 0x27d, region: 0x106}, - 138: {lang: 0x2c9, region: 0x53}, - 139: {lang: 0x39f, region: 0x9c}, - 140: {lang: 0x39f, region: 0x53}, - 142: {lang: 0x3ad, region: 0xb0}, - 144: {lang: 0x1c6, region: 0x53}, - 145: {lang: 0x4fd, region: 0x9c}, - 198: {lang: 0x3cb, region: 0x95}, - 201: {lang: 0x372, region: 0x10c}, - 202: {lang: 0x420, region: 0x97}, - 204: {lang: 0x4ff, region: 0x15e}, - 205: {lang: 0x3f0, region: 0x99}, - 206: {lang: 0x45, region: 0x135}, - 207: {lang: 0x139, region: 0x7b}, - 208: {lang: 0x3e9, region: 0x99}, - 210: {lang: 0x3e9, region: 0x99}, - 211: {lang: 0x3fa, region: 0x99}, - 212: {lang: 0x40c, region: 0xb3}, - 215: {lang: 0x433, region: 0x99}, - 216: {lang: 0xef, region: 0xc5}, - 217: {lang: 0x43e, region: 0x95}, - 218: {lang: 0x44d, region: 0x35}, - 219: {lang: 0x44e, region: 0x9b}, - 223: {lang: 0x45a, region: 0xe7}, - 224: {lang: 0x11a, region: 0x99}, - 225: {lang: 0x45e, region: 0x53}, - 226: {lang: 0x232, region: 0x53}, - 227: {lang: 0x450, region: 0x99}, - 228: {lang: 0x4a5, region: 0x53}, - 229: {lang: 0x9f, region: 0x13e}, - 230: {lang: 0x461, region: 0x99}, - 232: {lang: 0x528, region: 0xba}, - 233: {lang: 0x153, region: 0xe7}, - 234: {lang: 0x128, region: 0xcd}, - 235: {lang: 0x46b, region: 0x123}, - 236: {lang: 0xa9, region: 0x53}, - 237: {lang: 0x2ce, region: 0x99}, - 240: {lang: 0x4ad, region: 0x11c}, - 241: {lang: 0x4be, region: 0xb4}, - 244: {lang: 0x1ce, region: 0x99}, - 247: {lang: 0x3a9, region: 0x9c}, - 248: {lang: 0x22, region: 0x9b}, - 250: {lang: 0x1ea, region: 0x53}, - 251: {lang: 0xef, region: 0xc5}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, } type likelyScriptRegion struct { @@ -1557,1423 +1579,1423 @@ type likelyScriptRegion struct { // of the list in likelyLangList. // Size: 7980 bytes, 1330 elements var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf8, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xce, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xe3, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe5, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xec, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd8, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, 245: {region: 0x49, script: 0x17, flags: 0x0}, 246: {region: 0x49, script: 0x17, flags: 0x0}, 247: {region: 0x49, script: 0x17, flags: 0x0}, 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xea, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xec, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe6, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x90, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xfa, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xeb, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xe2, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xeb, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xeb, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe6, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc9, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf7, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8e, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xcd, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe8, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xca, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xeb, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd7, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xe3, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xe1, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe6, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xeb, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xec, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xeb, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xe4, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe6, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x91, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. // Size: 582 bytes, 97 elements var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x85, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xcf, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, 20: {region: 0x24, script: 0x5, flags: 0x4}, 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x8b, flags: 0x0}, - 48: {region: 0x53, script: 0x8c, flags: 0x2}, - 49: {region: 0xba, script: 0xe8, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xd3, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, 71: {region: 0x24, script: 0x5, flags: 0x4}, 72: {region: 0x53, script: 0x20, flags: 0x4}, 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, 75: {region: 0x53, script: 0x3b, flags: 0x4}, 76: {region: 0x53, script: 0x3b, flags: 0x2}, 77: {region: 0x53, script: 0x3b, flags: 0x0}, 78: {region: 0x2f, script: 0x3c, flags: 0x4}, 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, } type likelyLangScript struct { @@ -2987,306 +3009,306 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 2148 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, 35: {lang: 0x3a, script: 0x5, flags: 0x0}, 36: {lang: 0x0, script: 0x2, flags: 0x1}, 39: {lang: 0x2, script: 0x2, flags: 0x1}, 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, 51: {lang: 0x6, script: 0x2, flags: 0x1}, 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, 56: {lang: 0x7e, script: 0x20, flags: 0x0}, 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, 71: {lang: 0x71, script: 0x20, flags: 0x0}, 73: {lang: 0x512, script: 0x3e, flags: 0x2}, 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xea, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. // Size: 558 bytes, 93 elements var likelyRegionList = [93]likelyLangScript{ 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, 9: {lang: 0x351, script: 0x22, flags: 0x0}, 10: {lang: 0x529, script: 0x3b, flags: 0x0}, 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, 20: {lang: 0x26a, script: 0x5, flags: 0x2}, 21: {lang: 0x512, script: 0x3e, flags: 0x2}, 22: {lang: 0x210, script: 0x2e, flags: 0x0}, 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, 25: {lang: 0x136, script: 0x34, flags: 0x0}, 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, 28: {lang: 0x31f, script: 0x5, flags: 0x0}, 29: {lang: 0x1be, script: 0x22, flags: 0x0}, 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, 49: {lang: 0x30b, script: 0x20, flags: 0x0}, 50: {lang: 0x242, script: 0x5, flags: 0x0}, 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, 57: {lang: 0x88, script: 0x22, flags: 0x0}, 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 62: {lang: 0x7e, script: 0x20, flags: 0x0}, 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, 76: {lang: 0x467, script: 0x20, flags: 0x0}, 77: {lang: 0x148, script: 0x5, flags: 0x0}, 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, 81: {lang: 0x58, script: 0x5, flags: 0x0}, 82: {lang: 0x219, script: 0x20, flags: 0x0}, 83: {lang: 0x81, script: 0x34, flags: 0x0}, 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, 92: {lang: 0x446, script: 0x5, flags: 0x0}, } @@ -3298,38 +3320,38 @@ type likelyTag struct { // Size: 198 bytes, 33 elements var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, } // Size: 264 bytes, 33 elements @@ -3350,8 +3372,8 @@ var regionContainment = [33]uint64{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -3364,45 +3386,45 @@ var regionInclusion = [358]uint8{ // Entry 40 - 7F 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -3462,11 +3484,11 @@ type parentRel struct { // Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, } -// Total table size 30244 bytes (29KiB); checksum: B6B15F30 +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index ee45f494..1153baf2 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -434,7 +434,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. for i, lm := range language.AliasMap { - // If deprecated codes match and there is no fiddling with the script or + // If deprecated codes match and there is no fiddling with the script // or region, we consider it an exact match. conf := Exact if language.AliasTypes[i] != language.Macro { diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 34a732b6..a6573dcb 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -23,31 +23,31 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) -var regionToGroups = []uint8{ // 358 elements +var regionToGroups = []uint8{ // 359 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements // Entry 40 - 7F 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, + 0: [3]uint16{0x139, 0x0, 0x7c}, 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, } // Size: 42 bytes type mutualIntelligibility struct { @@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, } // Size: 232 bytes @@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, } // Size: 114 bytes -// Total table size 1472 bytes (1KiB); checksum: F86C669 +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go index f5a07882..1af161c7 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build go1.10 && !go1.13 -// +build go1.10,!go1.13 package norm diff --git a/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go index cb7239c4..eb73ecc3 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build go1.13 && !go1.14 -// +build go1.13,!go1.14 package norm diff --git a/vendor/golang.org/x/text/unicode/norm/tables12.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables12.0.0.go index 11b27330..276cb8d8 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables12.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables12.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build go1.14 && !go1.16 -// +build go1.14,!go1.16 package norm diff --git a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go index 9115ef25..0cceffd7 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 package norm diff --git a/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go new file mode 100644 index 00000000..b0819e42 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go @@ -0,0 +1,7907 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 + +package norm + +import "sync" + +const ( + // Version is the Unicode edition from which the tables are derived. + Version = "15.0.0" + + // MaxTransformChunkSize indicates the maximum number of bytes that Transform + // may need to write atomically for any Form. Making a destination buffer at + // least this size ensures that Transform can always make progress and that + // the user does not need to grow the buffer on an ErrShortDst. + MaxTransformChunkSize = 35 + maxNonStarters*4 +) + +var ccc = [56]uint8{ + 0, 1, 6, 7, 8, 9, 10, 11, + 12, 13, 14, 15, 16, 17, 18, 19, + 20, 21, 22, 23, 24, 25, 26, 27, + 28, 29, 30, 31, 32, 33, 34, 35, + 36, 84, 91, 103, 107, 118, 122, 129, + 130, 132, 202, 214, 216, 218, 220, 222, + 224, 226, 228, 230, 232, 233, 234, 240, +} + +const ( + firstMulti = 0x199A + firstCCC = 0x2DD5 + endMulti = 0x30A1 + firstLeadingCCC = 0x4AEF + firstCCCZeroExcept = 0x4BB9 + firstStarterWithNLead = 0x4BE0 + lastDecomp = 0x4BE2 + maxDecomp = 0x8000 +) + +// decomps: 19426 bytes +var decomps = [...]byte{ + // Bytes 0 - 3f + 0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41, + 0x23, 0x41, 0x24, 0x41, 0x25, 0x41, 0x26, 0x41, + 0x27, 0x41, 0x28, 0x41, 0x29, 0x41, 0x2A, 0x41, + 0x2B, 0x41, 0x2C, 0x41, 0x2D, 0x41, 0x2E, 0x41, + 0x2F, 0x41, 0x30, 0x41, 0x31, 0x41, 0x32, 0x41, + 0x33, 0x41, 0x34, 0x41, 0x35, 0x41, 0x36, 0x41, + 0x37, 0x41, 0x38, 0x41, 0x39, 0x41, 0x3A, 0x41, + 0x3B, 0x41, 0x3C, 0x41, 0x3D, 0x41, 0x3E, 0x41, + // Bytes 40 - 7f + 0x3F, 0x41, 0x40, 0x41, 0x41, 0x41, 0x42, 0x41, + 0x43, 0x41, 0x44, 0x41, 0x45, 0x41, 0x46, 0x41, + 0x47, 0x41, 0x48, 0x41, 0x49, 0x41, 0x4A, 0x41, + 0x4B, 0x41, 0x4C, 0x41, 0x4D, 0x41, 0x4E, 0x41, + 0x4F, 0x41, 0x50, 0x41, 0x51, 0x41, 0x52, 0x41, + 0x53, 0x41, 0x54, 0x41, 0x55, 0x41, 0x56, 0x41, + 0x57, 0x41, 0x58, 0x41, 0x59, 0x41, 0x5A, 0x41, + 0x5B, 0x41, 0x5C, 0x41, 0x5D, 0x41, 0x5E, 0x41, + // Bytes 80 - bf + 0x5F, 0x41, 0x60, 0x41, 0x61, 0x41, 0x62, 0x41, + 0x63, 0x41, 0x64, 0x41, 0x65, 0x41, 0x66, 0x41, + 0x67, 0x41, 0x68, 0x41, 0x69, 0x41, 0x6A, 0x41, + 0x6B, 0x41, 0x6C, 0x41, 0x6D, 0x41, 0x6E, 0x41, + 0x6F, 0x41, 0x70, 0x41, 0x71, 0x41, 0x72, 0x41, + 0x73, 0x41, 0x74, 0x41, 0x75, 0x41, 0x76, 0x41, + 0x77, 0x41, 0x78, 0x41, 0x79, 0x41, 0x7A, 0x41, + 0x7B, 0x41, 0x7C, 0x41, 0x7D, 0x41, 0x7E, 0x42, + // Bytes c0 - ff + 0xC2, 0xA2, 0x42, 0xC2, 0xA3, 0x42, 0xC2, 0xA5, + 0x42, 0xC2, 0xA6, 0x42, 0xC2, 0xAC, 0x42, 0xC2, + 0xB7, 0x42, 0xC3, 0x86, 0x42, 0xC3, 0xA6, 0x42, + 0xC3, 0xB0, 0x42, 0xC3, 0xB8, 0x42, 0xC4, 0xA6, + 0x42, 0xC4, 0xA7, 0x42, 0xC4, 0xB1, 0x42, 0xC5, + 0x8B, 0x42, 0xC5, 0x93, 0x42, 0xC6, 0x8E, 0x42, + 0xC6, 0x90, 0x42, 0xC6, 0xAB, 0x42, 0xC7, 0x80, + 0x42, 0xC7, 0x81, 0x42, 0xC7, 0x82, 0x42, 0xC8, + // Bytes 100 - 13f + 0xA2, 0x42, 0xC8, 0xB7, 0x42, 0xC9, 0x90, 0x42, + 0xC9, 0x91, 0x42, 0xC9, 0x92, 0x42, 0xC9, 0x93, + 0x42, 0xC9, 0x94, 0x42, 0xC9, 0x95, 0x42, 0xC9, + 0x96, 0x42, 0xC9, 0x97, 0x42, 0xC9, 0x98, 0x42, + 0xC9, 0x99, 0x42, 0xC9, 0x9B, 0x42, 0xC9, 0x9C, + 0x42, 0xC9, 0x9E, 0x42, 0xC9, 0x9F, 0x42, 0xC9, + 0xA0, 0x42, 0xC9, 0xA1, 0x42, 0xC9, 0xA2, 0x42, + 0xC9, 0xA3, 0x42, 0xC9, 0xA4, 0x42, 0xC9, 0xA5, + // Bytes 140 - 17f + 0x42, 0xC9, 0xA6, 0x42, 0xC9, 0xA7, 0x42, 0xC9, + 0xA8, 0x42, 0xC9, 0xA9, 0x42, 0xC9, 0xAA, 0x42, + 0xC9, 0xAB, 0x42, 0xC9, 0xAC, 0x42, 0xC9, 0xAD, + 0x42, 0xC9, 0xAE, 0x42, 0xC9, 0xAF, 0x42, 0xC9, + 0xB0, 0x42, 0xC9, 0xB1, 0x42, 0xC9, 0xB2, 0x42, + 0xC9, 0xB3, 0x42, 0xC9, 0xB4, 0x42, 0xC9, 0xB5, + 0x42, 0xC9, 0xB6, 0x42, 0xC9, 0xB7, 0x42, 0xC9, + 0xB8, 0x42, 0xC9, 0xB9, 0x42, 0xC9, 0xBA, 0x42, + // Bytes 180 - 1bf + 0xC9, 0xBB, 0x42, 0xC9, 0xBD, 0x42, 0xC9, 0xBE, + 0x42, 0xCA, 0x80, 0x42, 0xCA, 0x81, 0x42, 0xCA, + 0x82, 0x42, 0xCA, 0x83, 0x42, 0xCA, 0x84, 0x42, + 0xCA, 0x88, 0x42, 0xCA, 0x89, 0x42, 0xCA, 0x8A, + 0x42, 0xCA, 0x8B, 0x42, 0xCA, 0x8C, 0x42, 0xCA, + 0x8D, 0x42, 0xCA, 0x8E, 0x42, 0xCA, 0x8F, 0x42, + 0xCA, 0x90, 0x42, 0xCA, 0x91, 0x42, 0xCA, 0x92, + 0x42, 0xCA, 0x95, 0x42, 0xCA, 0x98, 0x42, 0xCA, + // Bytes 1c0 - 1ff + 0x99, 0x42, 0xCA, 0x9B, 0x42, 0xCA, 0x9C, 0x42, + 0xCA, 0x9D, 0x42, 0xCA, 0x9F, 0x42, 0xCA, 0xA1, + 0x42, 0xCA, 0xA2, 0x42, 0xCA, 0xA3, 0x42, 0xCA, + 0xA4, 0x42, 0xCA, 0xA5, 0x42, 0xCA, 0xA6, 0x42, + 0xCA, 0xA7, 0x42, 0xCA, 0xA8, 0x42, 0xCA, 0xA9, + 0x42, 0xCA, 0xAA, 0x42, 0xCA, 0xAB, 0x42, 0xCA, + 0xB9, 0x42, 0xCB, 0x90, 0x42, 0xCB, 0x91, 0x42, + 0xCE, 0x91, 0x42, 0xCE, 0x92, 0x42, 0xCE, 0x93, + // Bytes 200 - 23f + 0x42, 0xCE, 0x94, 0x42, 0xCE, 0x95, 0x42, 0xCE, + 0x96, 0x42, 0xCE, 0x97, 0x42, 0xCE, 0x98, 0x42, + 0xCE, 0x99, 0x42, 0xCE, 0x9A, 0x42, 0xCE, 0x9B, + 0x42, 0xCE, 0x9C, 0x42, 0xCE, 0x9D, 0x42, 0xCE, + 0x9E, 0x42, 0xCE, 0x9F, 0x42, 0xCE, 0xA0, 0x42, + 0xCE, 0xA1, 0x42, 0xCE, 0xA3, 0x42, 0xCE, 0xA4, + 0x42, 0xCE, 0xA5, 0x42, 0xCE, 0xA6, 0x42, 0xCE, + 0xA7, 0x42, 0xCE, 0xA8, 0x42, 0xCE, 0xA9, 0x42, + // Bytes 240 - 27f + 0xCE, 0xB1, 0x42, 0xCE, 0xB2, 0x42, 0xCE, 0xB3, + 0x42, 0xCE, 0xB4, 0x42, 0xCE, 0xB5, 0x42, 0xCE, + 0xB6, 0x42, 0xCE, 0xB7, 0x42, 0xCE, 0xB8, 0x42, + 0xCE, 0xB9, 0x42, 0xCE, 0xBA, 0x42, 0xCE, 0xBB, + 0x42, 0xCE, 0xBC, 0x42, 0xCE, 0xBD, 0x42, 0xCE, + 0xBE, 0x42, 0xCE, 0xBF, 0x42, 0xCF, 0x80, 0x42, + 0xCF, 0x81, 0x42, 0xCF, 0x82, 0x42, 0xCF, 0x83, + 0x42, 0xCF, 0x84, 0x42, 0xCF, 0x85, 0x42, 0xCF, + // Bytes 280 - 2bf + 0x86, 0x42, 0xCF, 0x87, 0x42, 0xCF, 0x88, 0x42, + 0xCF, 0x89, 0x42, 0xCF, 0x9C, 0x42, 0xCF, 0x9D, + 0x42, 0xD0, 0xB0, 0x42, 0xD0, 0xB1, 0x42, 0xD0, + 0xB2, 0x42, 0xD0, 0xB3, 0x42, 0xD0, 0xB4, 0x42, + 0xD0, 0xB5, 0x42, 0xD0, 0xB6, 0x42, 0xD0, 0xB7, + 0x42, 0xD0, 0xB8, 0x42, 0xD0, 0xBA, 0x42, 0xD0, + 0xBB, 0x42, 0xD0, 0xBC, 0x42, 0xD0, 0xBD, 0x42, + 0xD0, 0xBE, 0x42, 0xD0, 0xBF, 0x42, 0xD1, 0x80, + // Bytes 2c0 - 2ff + 0x42, 0xD1, 0x81, 0x42, 0xD1, 0x82, 0x42, 0xD1, + 0x83, 0x42, 0xD1, 0x84, 0x42, 0xD1, 0x85, 0x42, + 0xD1, 0x86, 0x42, 0xD1, 0x87, 0x42, 0xD1, 0x88, + 0x42, 0xD1, 0x8A, 0x42, 0xD1, 0x8B, 0x42, 0xD1, + 0x8C, 0x42, 0xD1, 0x8D, 0x42, 0xD1, 0x8E, 0x42, + 0xD1, 0x95, 0x42, 0xD1, 0x96, 0x42, 0xD1, 0x98, + 0x42, 0xD1, 0x9F, 0x42, 0xD2, 0x91, 0x42, 0xD2, + 0xAB, 0x42, 0xD2, 0xAF, 0x42, 0xD2, 0xB1, 0x42, + // Bytes 300 - 33f + 0xD3, 0x8F, 0x42, 0xD3, 0x99, 0x42, 0xD3, 0xA9, + 0x42, 0xD7, 0x90, 0x42, 0xD7, 0x91, 0x42, 0xD7, + 0x92, 0x42, 0xD7, 0x93, 0x42, 0xD7, 0x94, 0x42, + 0xD7, 0x9B, 0x42, 0xD7, 0x9C, 0x42, 0xD7, 0x9D, + 0x42, 0xD7, 0xA2, 0x42, 0xD7, 0xA8, 0x42, 0xD7, + 0xAA, 0x42, 0xD8, 0xA1, 0x42, 0xD8, 0xA7, 0x42, + 0xD8, 0xA8, 0x42, 0xD8, 0xA9, 0x42, 0xD8, 0xAA, + 0x42, 0xD8, 0xAB, 0x42, 0xD8, 0xAC, 0x42, 0xD8, + // Bytes 340 - 37f + 0xAD, 0x42, 0xD8, 0xAE, 0x42, 0xD8, 0xAF, 0x42, + 0xD8, 0xB0, 0x42, 0xD8, 0xB1, 0x42, 0xD8, 0xB2, + 0x42, 0xD8, 0xB3, 0x42, 0xD8, 0xB4, 0x42, 0xD8, + 0xB5, 0x42, 0xD8, 0xB6, 0x42, 0xD8, 0xB7, 0x42, + 0xD8, 0xB8, 0x42, 0xD8, 0xB9, 0x42, 0xD8, 0xBA, + 0x42, 0xD9, 0x81, 0x42, 0xD9, 0x82, 0x42, 0xD9, + 0x83, 0x42, 0xD9, 0x84, 0x42, 0xD9, 0x85, 0x42, + 0xD9, 0x86, 0x42, 0xD9, 0x87, 0x42, 0xD9, 0x88, + // Bytes 380 - 3bf + 0x42, 0xD9, 0x89, 0x42, 0xD9, 0x8A, 0x42, 0xD9, + 0xAE, 0x42, 0xD9, 0xAF, 0x42, 0xD9, 0xB1, 0x42, + 0xD9, 0xB9, 0x42, 0xD9, 0xBA, 0x42, 0xD9, 0xBB, + 0x42, 0xD9, 0xBE, 0x42, 0xD9, 0xBF, 0x42, 0xDA, + 0x80, 0x42, 0xDA, 0x83, 0x42, 0xDA, 0x84, 0x42, + 0xDA, 0x86, 0x42, 0xDA, 0x87, 0x42, 0xDA, 0x88, + 0x42, 0xDA, 0x8C, 0x42, 0xDA, 0x8D, 0x42, 0xDA, + 0x8E, 0x42, 0xDA, 0x91, 0x42, 0xDA, 0x98, 0x42, + // Bytes 3c0 - 3ff + 0xDA, 0xA1, 0x42, 0xDA, 0xA4, 0x42, 0xDA, 0xA6, + 0x42, 0xDA, 0xA9, 0x42, 0xDA, 0xAD, 0x42, 0xDA, + 0xAF, 0x42, 0xDA, 0xB1, 0x42, 0xDA, 0xB3, 0x42, + 0xDA, 0xBA, 0x42, 0xDA, 0xBB, 0x42, 0xDA, 0xBE, + 0x42, 0xDB, 0x81, 0x42, 0xDB, 0x85, 0x42, 0xDB, + 0x86, 0x42, 0xDB, 0x87, 0x42, 0xDB, 0x88, 0x42, + 0xDB, 0x89, 0x42, 0xDB, 0x8B, 0x42, 0xDB, 0x8C, + 0x42, 0xDB, 0x90, 0x42, 0xDB, 0x92, 0x43, 0xE0, + // Bytes 400 - 43f + 0xBC, 0x8B, 0x43, 0xE1, 0x83, 0x9C, 0x43, 0xE1, + 0x84, 0x80, 0x43, 0xE1, 0x84, 0x81, 0x43, 0xE1, + 0x84, 0x82, 0x43, 0xE1, 0x84, 0x83, 0x43, 0xE1, + 0x84, 0x84, 0x43, 0xE1, 0x84, 0x85, 0x43, 0xE1, + 0x84, 0x86, 0x43, 0xE1, 0x84, 0x87, 0x43, 0xE1, + 0x84, 0x88, 0x43, 0xE1, 0x84, 0x89, 0x43, 0xE1, + 0x84, 0x8A, 0x43, 0xE1, 0x84, 0x8B, 0x43, 0xE1, + 0x84, 0x8C, 0x43, 0xE1, 0x84, 0x8D, 0x43, 0xE1, + // Bytes 440 - 47f + 0x84, 0x8E, 0x43, 0xE1, 0x84, 0x8F, 0x43, 0xE1, + 0x84, 0x90, 0x43, 0xE1, 0x84, 0x91, 0x43, 0xE1, + 0x84, 0x92, 0x43, 0xE1, 0x84, 0x94, 0x43, 0xE1, + 0x84, 0x95, 0x43, 0xE1, 0x84, 0x9A, 0x43, 0xE1, + 0x84, 0x9C, 0x43, 0xE1, 0x84, 0x9D, 0x43, 0xE1, + 0x84, 0x9E, 0x43, 0xE1, 0x84, 0xA0, 0x43, 0xE1, + 0x84, 0xA1, 0x43, 0xE1, 0x84, 0xA2, 0x43, 0xE1, + 0x84, 0xA3, 0x43, 0xE1, 0x84, 0xA7, 0x43, 0xE1, + // Bytes 480 - 4bf + 0x84, 0xA9, 0x43, 0xE1, 0x84, 0xAB, 0x43, 0xE1, + 0x84, 0xAC, 0x43, 0xE1, 0x84, 0xAD, 0x43, 0xE1, + 0x84, 0xAE, 0x43, 0xE1, 0x84, 0xAF, 0x43, 0xE1, + 0x84, 0xB2, 0x43, 0xE1, 0x84, 0xB6, 0x43, 0xE1, + 0x85, 0x80, 0x43, 0xE1, 0x85, 0x87, 0x43, 0xE1, + 0x85, 0x8C, 0x43, 0xE1, 0x85, 0x97, 0x43, 0xE1, + 0x85, 0x98, 0x43, 0xE1, 0x85, 0x99, 0x43, 0xE1, + 0x85, 0xA0, 0x43, 0xE1, 0x86, 0x84, 0x43, 0xE1, + // Bytes 4c0 - 4ff + 0x86, 0x85, 0x43, 0xE1, 0x86, 0x88, 0x43, 0xE1, + 0x86, 0x91, 0x43, 0xE1, 0x86, 0x92, 0x43, 0xE1, + 0x86, 0x94, 0x43, 0xE1, 0x86, 0x9E, 0x43, 0xE1, + 0x86, 0xA1, 0x43, 0xE1, 0x87, 0x87, 0x43, 0xE1, + 0x87, 0x88, 0x43, 0xE1, 0x87, 0x8C, 0x43, 0xE1, + 0x87, 0x8E, 0x43, 0xE1, 0x87, 0x93, 0x43, 0xE1, + 0x87, 0x97, 0x43, 0xE1, 0x87, 0x99, 0x43, 0xE1, + 0x87, 0x9D, 0x43, 0xE1, 0x87, 0x9F, 0x43, 0xE1, + // Bytes 500 - 53f + 0x87, 0xB1, 0x43, 0xE1, 0x87, 0xB2, 0x43, 0xE1, + 0xB4, 0x82, 0x43, 0xE1, 0xB4, 0x96, 0x43, 0xE1, + 0xB4, 0x97, 0x43, 0xE1, 0xB4, 0x9C, 0x43, 0xE1, + 0xB4, 0x9D, 0x43, 0xE1, 0xB4, 0xA5, 0x43, 0xE1, + 0xB5, 0xBB, 0x43, 0xE1, 0xB6, 0x85, 0x43, 0xE1, + 0xB6, 0x91, 0x43, 0xE2, 0x80, 0x82, 0x43, 0xE2, + 0x80, 0x83, 0x43, 0xE2, 0x80, 0x90, 0x43, 0xE2, + 0x80, 0x93, 0x43, 0xE2, 0x80, 0x94, 0x43, 0xE2, + // Bytes 540 - 57f + 0x82, 0xA9, 0x43, 0xE2, 0x86, 0x90, 0x43, 0xE2, + 0x86, 0x91, 0x43, 0xE2, 0x86, 0x92, 0x43, 0xE2, + 0x86, 0x93, 0x43, 0xE2, 0x88, 0x82, 0x43, 0xE2, + 0x88, 0x87, 0x43, 0xE2, 0x88, 0x91, 0x43, 0xE2, + 0x88, 0x92, 0x43, 0xE2, 0x94, 0x82, 0x43, 0xE2, + 0x96, 0xA0, 0x43, 0xE2, 0x97, 0x8B, 0x43, 0xE2, + 0xA6, 0x85, 0x43, 0xE2, 0xA6, 0x86, 0x43, 0xE2, + 0xB1, 0xB1, 0x43, 0xE2, 0xB5, 0xA1, 0x43, 0xE3, + // Bytes 580 - 5bf + 0x80, 0x81, 0x43, 0xE3, 0x80, 0x82, 0x43, 0xE3, + 0x80, 0x88, 0x43, 0xE3, 0x80, 0x89, 0x43, 0xE3, + 0x80, 0x8A, 0x43, 0xE3, 0x80, 0x8B, 0x43, 0xE3, + 0x80, 0x8C, 0x43, 0xE3, 0x80, 0x8D, 0x43, 0xE3, + 0x80, 0x8E, 0x43, 0xE3, 0x80, 0x8F, 0x43, 0xE3, + 0x80, 0x90, 0x43, 0xE3, 0x80, 0x91, 0x43, 0xE3, + 0x80, 0x92, 0x43, 0xE3, 0x80, 0x94, 0x43, 0xE3, + 0x80, 0x95, 0x43, 0xE3, 0x80, 0x96, 0x43, 0xE3, + // Bytes 5c0 - 5ff + 0x80, 0x97, 0x43, 0xE3, 0x82, 0xA1, 0x43, 0xE3, + 0x82, 0xA2, 0x43, 0xE3, 0x82, 0xA3, 0x43, 0xE3, + 0x82, 0xA4, 0x43, 0xE3, 0x82, 0xA5, 0x43, 0xE3, + 0x82, 0xA6, 0x43, 0xE3, 0x82, 0xA7, 0x43, 0xE3, + 0x82, 0xA8, 0x43, 0xE3, 0x82, 0xA9, 0x43, 0xE3, + 0x82, 0xAA, 0x43, 0xE3, 0x82, 0xAB, 0x43, 0xE3, + 0x82, 0xAD, 0x43, 0xE3, 0x82, 0xAF, 0x43, 0xE3, + 0x82, 0xB1, 0x43, 0xE3, 0x82, 0xB3, 0x43, 0xE3, + // Bytes 600 - 63f + 0x82, 0xB5, 0x43, 0xE3, 0x82, 0xB7, 0x43, 0xE3, + 0x82, 0xB9, 0x43, 0xE3, 0x82, 0xBB, 0x43, 0xE3, + 0x82, 0xBD, 0x43, 0xE3, 0x82, 0xBF, 0x43, 0xE3, + 0x83, 0x81, 0x43, 0xE3, 0x83, 0x83, 0x43, 0xE3, + 0x83, 0x84, 0x43, 0xE3, 0x83, 0x86, 0x43, 0xE3, + 0x83, 0x88, 0x43, 0xE3, 0x83, 0x8A, 0x43, 0xE3, + 0x83, 0x8B, 0x43, 0xE3, 0x83, 0x8C, 0x43, 0xE3, + 0x83, 0x8D, 0x43, 0xE3, 0x83, 0x8E, 0x43, 0xE3, + // Bytes 640 - 67f + 0x83, 0x8F, 0x43, 0xE3, 0x83, 0x92, 0x43, 0xE3, + 0x83, 0x95, 0x43, 0xE3, 0x83, 0x98, 0x43, 0xE3, + 0x83, 0x9B, 0x43, 0xE3, 0x83, 0x9E, 0x43, 0xE3, + 0x83, 0x9F, 0x43, 0xE3, 0x83, 0xA0, 0x43, 0xE3, + 0x83, 0xA1, 0x43, 0xE3, 0x83, 0xA2, 0x43, 0xE3, + 0x83, 0xA3, 0x43, 0xE3, 0x83, 0xA4, 0x43, 0xE3, + 0x83, 0xA5, 0x43, 0xE3, 0x83, 0xA6, 0x43, 0xE3, + 0x83, 0xA7, 0x43, 0xE3, 0x83, 0xA8, 0x43, 0xE3, + // Bytes 680 - 6bf + 0x83, 0xA9, 0x43, 0xE3, 0x83, 0xAA, 0x43, 0xE3, + 0x83, 0xAB, 0x43, 0xE3, 0x83, 0xAC, 0x43, 0xE3, + 0x83, 0xAD, 0x43, 0xE3, 0x83, 0xAF, 0x43, 0xE3, + 0x83, 0xB0, 0x43, 0xE3, 0x83, 0xB1, 0x43, 0xE3, + 0x83, 0xB2, 0x43, 0xE3, 0x83, 0xB3, 0x43, 0xE3, + 0x83, 0xBB, 0x43, 0xE3, 0x83, 0xBC, 0x43, 0xE3, + 0x92, 0x9E, 0x43, 0xE3, 0x92, 0xB9, 0x43, 0xE3, + 0x92, 0xBB, 0x43, 0xE3, 0x93, 0x9F, 0x43, 0xE3, + // Bytes 6c0 - 6ff + 0x94, 0x95, 0x43, 0xE3, 0x9B, 0xAE, 0x43, 0xE3, + 0x9B, 0xBC, 0x43, 0xE3, 0x9E, 0x81, 0x43, 0xE3, + 0xA0, 0xAF, 0x43, 0xE3, 0xA1, 0xA2, 0x43, 0xE3, + 0xA1, 0xBC, 0x43, 0xE3, 0xA3, 0x87, 0x43, 0xE3, + 0xA3, 0xA3, 0x43, 0xE3, 0xA4, 0x9C, 0x43, 0xE3, + 0xA4, 0xBA, 0x43, 0xE3, 0xA8, 0xAE, 0x43, 0xE3, + 0xA9, 0xAC, 0x43, 0xE3, 0xAB, 0xA4, 0x43, 0xE3, + 0xAC, 0x88, 0x43, 0xE3, 0xAC, 0x99, 0x43, 0xE3, + // Bytes 700 - 73f + 0xAD, 0x89, 0x43, 0xE3, 0xAE, 0x9D, 0x43, 0xE3, + 0xB0, 0x98, 0x43, 0xE3, 0xB1, 0x8E, 0x43, 0xE3, + 0xB4, 0xB3, 0x43, 0xE3, 0xB6, 0x96, 0x43, 0xE3, + 0xBA, 0xAC, 0x43, 0xE3, 0xBA, 0xB8, 0x43, 0xE3, + 0xBC, 0x9B, 0x43, 0xE3, 0xBF, 0xBC, 0x43, 0xE4, + 0x80, 0x88, 0x43, 0xE4, 0x80, 0x98, 0x43, 0xE4, + 0x80, 0xB9, 0x43, 0xE4, 0x81, 0x86, 0x43, 0xE4, + 0x82, 0x96, 0x43, 0xE4, 0x83, 0xA3, 0x43, 0xE4, + // Bytes 740 - 77f + 0x84, 0xAF, 0x43, 0xE4, 0x88, 0x82, 0x43, 0xE4, + 0x88, 0xA7, 0x43, 0xE4, 0x8A, 0xA0, 0x43, 0xE4, + 0x8C, 0x81, 0x43, 0xE4, 0x8C, 0xB4, 0x43, 0xE4, + 0x8D, 0x99, 0x43, 0xE4, 0x8F, 0x95, 0x43, 0xE4, + 0x8F, 0x99, 0x43, 0xE4, 0x90, 0x8B, 0x43, 0xE4, + 0x91, 0xAB, 0x43, 0xE4, 0x94, 0xAB, 0x43, 0xE4, + 0x95, 0x9D, 0x43, 0xE4, 0x95, 0xA1, 0x43, 0xE4, + 0x95, 0xAB, 0x43, 0xE4, 0x97, 0x97, 0x43, 0xE4, + // Bytes 780 - 7bf + 0x97, 0xB9, 0x43, 0xE4, 0x98, 0xB5, 0x43, 0xE4, + 0x9A, 0xBE, 0x43, 0xE4, 0x9B, 0x87, 0x43, 0xE4, + 0xA6, 0x95, 0x43, 0xE4, 0xA7, 0xA6, 0x43, 0xE4, + 0xA9, 0xAE, 0x43, 0xE4, 0xA9, 0xB6, 0x43, 0xE4, + 0xAA, 0xB2, 0x43, 0xE4, 0xAC, 0xB3, 0x43, 0xE4, + 0xAF, 0x8E, 0x43, 0xE4, 0xB3, 0x8E, 0x43, 0xE4, + 0xB3, 0xAD, 0x43, 0xE4, 0xB3, 0xB8, 0x43, 0xE4, + 0xB5, 0x96, 0x43, 0xE4, 0xB8, 0x80, 0x43, 0xE4, + // Bytes 7c0 - 7ff + 0xB8, 0x81, 0x43, 0xE4, 0xB8, 0x83, 0x43, 0xE4, + 0xB8, 0x89, 0x43, 0xE4, 0xB8, 0x8A, 0x43, 0xE4, + 0xB8, 0x8B, 0x43, 0xE4, 0xB8, 0x8D, 0x43, 0xE4, + 0xB8, 0x99, 0x43, 0xE4, 0xB8, 0xA6, 0x43, 0xE4, + 0xB8, 0xA8, 0x43, 0xE4, 0xB8, 0xAD, 0x43, 0xE4, + 0xB8, 0xB2, 0x43, 0xE4, 0xB8, 0xB6, 0x43, 0xE4, + 0xB8, 0xB8, 0x43, 0xE4, 0xB8, 0xB9, 0x43, 0xE4, + 0xB8, 0xBD, 0x43, 0xE4, 0xB8, 0xBF, 0x43, 0xE4, + // Bytes 800 - 83f + 0xB9, 0x81, 0x43, 0xE4, 0xB9, 0x99, 0x43, 0xE4, + 0xB9, 0x9D, 0x43, 0xE4, 0xBA, 0x82, 0x43, 0xE4, + 0xBA, 0x85, 0x43, 0xE4, 0xBA, 0x86, 0x43, 0xE4, + 0xBA, 0x8C, 0x43, 0xE4, 0xBA, 0x94, 0x43, 0xE4, + 0xBA, 0xA0, 0x43, 0xE4, 0xBA, 0xA4, 0x43, 0xE4, + 0xBA, 0xAE, 0x43, 0xE4, 0xBA, 0xBA, 0x43, 0xE4, + 0xBB, 0x80, 0x43, 0xE4, 0xBB, 0x8C, 0x43, 0xE4, + 0xBB, 0xA4, 0x43, 0xE4, 0xBC, 0x81, 0x43, 0xE4, + // Bytes 840 - 87f + 0xBC, 0x91, 0x43, 0xE4, 0xBD, 0xA0, 0x43, 0xE4, + 0xBE, 0x80, 0x43, 0xE4, 0xBE, 0x86, 0x43, 0xE4, + 0xBE, 0x8B, 0x43, 0xE4, 0xBE, 0xAE, 0x43, 0xE4, + 0xBE, 0xBB, 0x43, 0xE4, 0xBE, 0xBF, 0x43, 0xE5, + 0x80, 0x82, 0x43, 0xE5, 0x80, 0xAB, 0x43, 0xE5, + 0x81, 0xBA, 0x43, 0xE5, 0x82, 0x99, 0x43, 0xE5, + 0x83, 0x8F, 0x43, 0xE5, 0x83, 0x9A, 0x43, 0xE5, + 0x83, 0xA7, 0x43, 0xE5, 0x84, 0xAA, 0x43, 0xE5, + // Bytes 880 - 8bf + 0x84, 0xBF, 0x43, 0xE5, 0x85, 0x80, 0x43, 0xE5, + 0x85, 0x85, 0x43, 0xE5, 0x85, 0x8D, 0x43, 0xE5, + 0x85, 0x94, 0x43, 0xE5, 0x85, 0xA4, 0x43, 0xE5, + 0x85, 0xA5, 0x43, 0xE5, 0x85, 0xA7, 0x43, 0xE5, + 0x85, 0xA8, 0x43, 0xE5, 0x85, 0xA9, 0x43, 0xE5, + 0x85, 0xAB, 0x43, 0xE5, 0x85, 0xAD, 0x43, 0xE5, + 0x85, 0xB7, 0x43, 0xE5, 0x86, 0x80, 0x43, 0xE5, + 0x86, 0x82, 0x43, 0xE5, 0x86, 0x8D, 0x43, 0xE5, + // Bytes 8c0 - 8ff + 0x86, 0x92, 0x43, 0xE5, 0x86, 0x95, 0x43, 0xE5, + 0x86, 0x96, 0x43, 0xE5, 0x86, 0x97, 0x43, 0xE5, + 0x86, 0x99, 0x43, 0xE5, 0x86, 0xA4, 0x43, 0xE5, + 0x86, 0xAB, 0x43, 0xE5, 0x86, 0xAC, 0x43, 0xE5, + 0x86, 0xB5, 0x43, 0xE5, 0x86, 0xB7, 0x43, 0xE5, + 0x87, 0x89, 0x43, 0xE5, 0x87, 0x8C, 0x43, 0xE5, + 0x87, 0x9C, 0x43, 0xE5, 0x87, 0x9E, 0x43, 0xE5, + 0x87, 0xA0, 0x43, 0xE5, 0x87, 0xB5, 0x43, 0xE5, + // Bytes 900 - 93f + 0x88, 0x80, 0x43, 0xE5, 0x88, 0x83, 0x43, 0xE5, + 0x88, 0x87, 0x43, 0xE5, 0x88, 0x97, 0x43, 0xE5, + 0x88, 0x9D, 0x43, 0xE5, 0x88, 0xA9, 0x43, 0xE5, + 0x88, 0xBA, 0x43, 0xE5, 0x88, 0xBB, 0x43, 0xE5, + 0x89, 0x86, 0x43, 0xE5, 0x89, 0x8D, 0x43, 0xE5, + 0x89, 0xB2, 0x43, 0xE5, 0x89, 0xB7, 0x43, 0xE5, + 0x8A, 0x89, 0x43, 0xE5, 0x8A, 0x9B, 0x43, 0xE5, + 0x8A, 0xA3, 0x43, 0xE5, 0x8A, 0xB3, 0x43, 0xE5, + // Bytes 940 - 97f + 0x8A, 0xB4, 0x43, 0xE5, 0x8B, 0x87, 0x43, 0xE5, + 0x8B, 0x89, 0x43, 0xE5, 0x8B, 0x92, 0x43, 0xE5, + 0x8B, 0x9E, 0x43, 0xE5, 0x8B, 0xA4, 0x43, 0xE5, + 0x8B, 0xB5, 0x43, 0xE5, 0x8B, 0xB9, 0x43, 0xE5, + 0x8B, 0xBA, 0x43, 0xE5, 0x8C, 0x85, 0x43, 0xE5, + 0x8C, 0x86, 0x43, 0xE5, 0x8C, 0x95, 0x43, 0xE5, + 0x8C, 0x97, 0x43, 0xE5, 0x8C, 0x9A, 0x43, 0xE5, + 0x8C, 0xB8, 0x43, 0xE5, 0x8C, 0xBB, 0x43, 0xE5, + // Bytes 980 - 9bf + 0x8C, 0xBF, 0x43, 0xE5, 0x8D, 0x81, 0x43, 0xE5, + 0x8D, 0x84, 0x43, 0xE5, 0x8D, 0x85, 0x43, 0xE5, + 0x8D, 0x89, 0x43, 0xE5, 0x8D, 0x91, 0x43, 0xE5, + 0x8D, 0x94, 0x43, 0xE5, 0x8D, 0x9A, 0x43, 0xE5, + 0x8D, 0x9C, 0x43, 0xE5, 0x8D, 0xA9, 0x43, 0xE5, + 0x8D, 0xB0, 0x43, 0xE5, 0x8D, 0xB3, 0x43, 0xE5, + 0x8D, 0xB5, 0x43, 0xE5, 0x8D, 0xBD, 0x43, 0xE5, + 0x8D, 0xBF, 0x43, 0xE5, 0x8E, 0x82, 0x43, 0xE5, + // Bytes 9c0 - 9ff + 0x8E, 0xB6, 0x43, 0xE5, 0x8F, 0x83, 0x43, 0xE5, + 0x8F, 0x88, 0x43, 0xE5, 0x8F, 0x8A, 0x43, 0xE5, + 0x8F, 0x8C, 0x43, 0xE5, 0x8F, 0x9F, 0x43, 0xE5, + 0x8F, 0xA3, 0x43, 0xE5, 0x8F, 0xA5, 0x43, 0xE5, + 0x8F, 0xAB, 0x43, 0xE5, 0x8F, 0xAF, 0x43, 0xE5, + 0x8F, 0xB1, 0x43, 0xE5, 0x8F, 0xB3, 0x43, 0xE5, + 0x90, 0x86, 0x43, 0xE5, 0x90, 0x88, 0x43, 0xE5, + 0x90, 0x8D, 0x43, 0xE5, 0x90, 0x8F, 0x43, 0xE5, + // Bytes a00 - a3f + 0x90, 0x9D, 0x43, 0xE5, 0x90, 0xB8, 0x43, 0xE5, + 0x90, 0xB9, 0x43, 0xE5, 0x91, 0x82, 0x43, 0xE5, + 0x91, 0x88, 0x43, 0xE5, 0x91, 0xA8, 0x43, 0xE5, + 0x92, 0x9E, 0x43, 0xE5, 0x92, 0xA2, 0x43, 0xE5, + 0x92, 0xBD, 0x43, 0xE5, 0x93, 0xB6, 0x43, 0xE5, + 0x94, 0x90, 0x43, 0xE5, 0x95, 0x8F, 0x43, 0xE5, + 0x95, 0x93, 0x43, 0xE5, 0x95, 0x95, 0x43, 0xE5, + 0x95, 0xA3, 0x43, 0xE5, 0x96, 0x84, 0x43, 0xE5, + // Bytes a40 - a7f + 0x96, 0x87, 0x43, 0xE5, 0x96, 0x99, 0x43, 0xE5, + 0x96, 0x9D, 0x43, 0xE5, 0x96, 0xAB, 0x43, 0xE5, + 0x96, 0xB3, 0x43, 0xE5, 0x96, 0xB6, 0x43, 0xE5, + 0x97, 0x80, 0x43, 0xE5, 0x97, 0x82, 0x43, 0xE5, + 0x97, 0xA2, 0x43, 0xE5, 0x98, 0x86, 0x43, 0xE5, + 0x99, 0x91, 0x43, 0xE5, 0x99, 0xA8, 0x43, 0xE5, + 0x99, 0xB4, 0x43, 0xE5, 0x9B, 0x97, 0x43, 0xE5, + 0x9B, 0x9B, 0x43, 0xE5, 0x9B, 0xB9, 0x43, 0xE5, + // Bytes a80 - abf + 0x9C, 0x96, 0x43, 0xE5, 0x9C, 0x97, 0x43, 0xE5, + 0x9C, 0x9F, 0x43, 0xE5, 0x9C, 0xB0, 0x43, 0xE5, + 0x9E, 0x8B, 0x43, 0xE5, 0x9F, 0x8E, 0x43, 0xE5, + 0x9F, 0xB4, 0x43, 0xE5, 0xA0, 0x8D, 0x43, 0xE5, + 0xA0, 0xB1, 0x43, 0xE5, 0xA0, 0xB2, 0x43, 0xE5, + 0xA1, 0x80, 0x43, 0xE5, 0xA1, 0x9A, 0x43, 0xE5, + 0xA1, 0x9E, 0x43, 0xE5, 0xA2, 0xA8, 0x43, 0xE5, + 0xA2, 0xAC, 0x43, 0xE5, 0xA2, 0xB3, 0x43, 0xE5, + // Bytes ac0 - aff + 0xA3, 0x98, 0x43, 0xE5, 0xA3, 0x9F, 0x43, 0xE5, + 0xA3, 0xAB, 0x43, 0xE5, 0xA3, 0xAE, 0x43, 0xE5, + 0xA3, 0xB0, 0x43, 0xE5, 0xA3, 0xB2, 0x43, 0xE5, + 0xA3, 0xB7, 0x43, 0xE5, 0xA4, 0x82, 0x43, 0xE5, + 0xA4, 0x86, 0x43, 0xE5, 0xA4, 0x8A, 0x43, 0xE5, + 0xA4, 0x95, 0x43, 0xE5, 0xA4, 0x9A, 0x43, 0xE5, + 0xA4, 0x9C, 0x43, 0xE5, 0xA4, 0xA2, 0x43, 0xE5, + 0xA4, 0xA7, 0x43, 0xE5, 0xA4, 0xA9, 0x43, 0xE5, + // Bytes b00 - b3f + 0xA5, 0x84, 0x43, 0xE5, 0xA5, 0x88, 0x43, 0xE5, + 0xA5, 0x91, 0x43, 0xE5, 0xA5, 0x94, 0x43, 0xE5, + 0xA5, 0xA2, 0x43, 0xE5, 0xA5, 0xB3, 0x43, 0xE5, + 0xA7, 0x98, 0x43, 0xE5, 0xA7, 0xAC, 0x43, 0xE5, + 0xA8, 0x9B, 0x43, 0xE5, 0xA8, 0xA7, 0x43, 0xE5, + 0xA9, 0xA2, 0x43, 0xE5, 0xA9, 0xA6, 0x43, 0xE5, + 0xAA, 0xB5, 0x43, 0xE5, 0xAC, 0x88, 0x43, 0xE5, + 0xAC, 0xA8, 0x43, 0xE5, 0xAC, 0xBE, 0x43, 0xE5, + // Bytes b40 - b7f + 0xAD, 0x90, 0x43, 0xE5, 0xAD, 0x97, 0x43, 0xE5, + 0xAD, 0xA6, 0x43, 0xE5, 0xAE, 0x80, 0x43, 0xE5, + 0xAE, 0x85, 0x43, 0xE5, 0xAE, 0x97, 0x43, 0xE5, + 0xAF, 0x83, 0x43, 0xE5, 0xAF, 0x98, 0x43, 0xE5, + 0xAF, 0xA7, 0x43, 0xE5, 0xAF, 0xAE, 0x43, 0xE5, + 0xAF, 0xB3, 0x43, 0xE5, 0xAF, 0xB8, 0x43, 0xE5, + 0xAF, 0xBF, 0x43, 0xE5, 0xB0, 0x86, 0x43, 0xE5, + 0xB0, 0x8F, 0x43, 0xE5, 0xB0, 0xA2, 0x43, 0xE5, + // Bytes b80 - bbf + 0xB0, 0xB8, 0x43, 0xE5, 0xB0, 0xBF, 0x43, 0xE5, + 0xB1, 0xA0, 0x43, 0xE5, 0xB1, 0xA2, 0x43, 0xE5, + 0xB1, 0xA4, 0x43, 0xE5, 0xB1, 0xA5, 0x43, 0xE5, + 0xB1, 0xAE, 0x43, 0xE5, 0xB1, 0xB1, 0x43, 0xE5, + 0xB2, 0x8D, 0x43, 0xE5, 0xB3, 0x80, 0x43, 0xE5, + 0xB4, 0x99, 0x43, 0xE5, 0xB5, 0x83, 0x43, 0xE5, + 0xB5, 0x90, 0x43, 0xE5, 0xB5, 0xAB, 0x43, 0xE5, + 0xB5, 0xAE, 0x43, 0xE5, 0xB5, 0xBC, 0x43, 0xE5, + // Bytes bc0 - bff + 0xB6, 0xB2, 0x43, 0xE5, 0xB6, 0xBA, 0x43, 0xE5, + 0xB7, 0x9B, 0x43, 0xE5, 0xB7, 0xA1, 0x43, 0xE5, + 0xB7, 0xA2, 0x43, 0xE5, 0xB7, 0xA5, 0x43, 0xE5, + 0xB7, 0xA6, 0x43, 0xE5, 0xB7, 0xB1, 0x43, 0xE5, + 0xB7, 0xBD, 0x43, 0xE5, 0xB7, 0xBE, 0x43, 0xE5, + 0xB8, 0xA8, 0x43, 0xE5, 0xB8, 0xBD, 0x43, 0xE5, + 0xB9, 0xA9, 0x43, 0xE5, 0xB9, 0xB2, 0x43, 0xE5, + 0xB9, 0xB4, 0x43, 0xE5, 0xB9, 0xBA, 0x43, 0xE5, + // Bytes c00 - c3f + 0xB9, 0xBC, 0x43, 0xE5, 0xB9, 0xBF, 0x43, 0xE5, + 0xBA, 0xA6, 0x43, 0xE5, 0xBA, 0xB0, 0x43, 0xE5, + 0xBA, 0xB3, 0x43, 0xE5, 0xBA, 0xB6, 0x43, 0xE5, + 0xBB, 0x89, 0x43, 0xE5, 0xBB, 0x8A, 0x43, 0xE5, + 0xBB, 0x92, 0x43, 0xE5, 0xBB, 0x93, 0x43, 0xE5, + 0xBB, 0x99, 0x43, 0xE5, 0xBB, 0xAC, 0x43, 0xE5, + 0xBB, 0xB4, 0x43, 0xE5, 0xBB, 0xBE, 0x43, 0xE5, + 0xBC, 0x84, 0x43, 0xE5, 0xBC, 0x8B, 0x43, 0xE5, + // Bytes c40 - c7f + 0xBC, 0x93, 0x43, 0xE5, 0xBC, 0xA2, 0x43, 0xE5, + 0xBD, 0x90, 0x43, 0xE5, 0xBD, 0x93, 0x43, 0xE5, + 0xBD, 0xA1, 0x43, 0xE5, 0xBD, 0xA2, 0x43, 0xE5, + 0xBD, 0xA9, 0x43, 0xE5, 0xBD, 0xAB, 0x43, 0xE5, + 0xBD, 0xB3, 0x43, 0xE5, 0xBE, 0x8B, 0x43, 0xE5, + 0xBE, 0x8C, 0x43, 0xE5, 0xBE, 0x97, 0x43, 0xE5, + 0xBE, 0x9A, 0x43, 0xE5, 0xBE, 0xA9, 0x43, 0xE5, + 0xBE, 0xAD, 0x43, 0xE5, 0xBF, 0x83, 0x43, 0xE5, + // Bytes c80 - cbf + 0xBF, 0x8D, 0x43, 0xE5, 0xBF, 0x97, 0x43, 0xE5, + 0xBF, 0xB5, 0x43, 0xE5, 0xBF, 0xB9, 0x43, 0xE6, + 0x80, 0x92, 0x43, 0xE6, 0x80, 0x9C, 0x43, 0xE6, + 0x81, 0xB5, 0x43, 0xE6, 0x82, 0x81, 0x43, 0xE6, + 0x82, 0x94, 0x43, 0xE6, 0x83, 0x87, 0x43, 0xE6, + 0x83, 0x98, 0x43, 0xE6, 0x83, 0xA1, 0x43, 0xE6, + 0x84, 0x88, 0x43, 0xE6, 0x85, 0x84, 0x43, 0xE6, + 0x85, 0x88, 0x43, 0xE6, 0x85, 0x8C, 0x43, 0xE6, + // Bytes cc0 - cff + 0x85, 0x8E, 0x43, 0xE6, 0x85, 0xA0, 0x43, 0xE6, + 0x85, 0xA8, 0x43, 0xE6, 0x85, 0xBA, 0x43, 0xE6, + 0x86, 0x8E, 0x43, 0xE6, 0x86, 0x90, 0x43, 0xE6, + 0x86, 0xA4, 0x43, 0xE6, 0x86, 0xAF, 0x43, 0xE6, + 0x86, 0xB2, 0x43, 0xE6, 0x87, 0x9E, 0x43, 0xE6, + 0x87, 0xB2, 0x43, 0xE6, 0x87, 0xB6, 0x43, 0xE6, + 0x88, 0x80, 0x43, 0xE6, 0x88, 0x88, 0x43, 0xE6, + 0x88, 0x90, 0x43, 0xE6, 0x88, 0x9B, 0x43, 0xE6, + // Bytes d00 - d3f + 0x88, 0xAE, 0x43, 0xE6, 0x88, 0xB4, 0x43, 0xE6, + 0x88, 0xB6, 0x43, 0xE6, 0x89, 0x8B, 0x43, 0xE6, + 0x89, 0x93, 0x43, 0xE6, 0x89, 0x9D, 0x43, 0xE6, + 0x8A, 0x95, 0x43, 0xE6, 0x8A, 0xB1, 0x43, 0xE6, + 0x8B, 0x89, 0x43, 0xE6, 0x8B, 0x8F, 0x43, 0xE6, + 0x8B, 0x93, 0x43, 0xE6, 0x8B, 0x94, 0x43, 0xE6, + 0x8B, 0xBC, 0x43, 0xE6, 0x8B, 0xBE, 0x43, 0xE6, + 0x8C, 0x87, 0x43, 0xE6, 0x8C, 0xBD, 0x43, 0xE6, + // Bytes d40 - d7f + 0x8D, 0x90, 0x43, 0xE6, 0x8D, 0x95, 0x43, 0xE6, + 0x8D, 0xA8, 0x43, 0xE6, 0x8D, 0xBB, 0x43, 0xE6, + 0x8E, 0x83, 0x43, 0xE6, 0x8E, 0xA0, 0x43, 0xE6, + 0x8E, 0xA9, 0x43, 0xE6, 0x8F, 0x84, 0x43, 0xE6, + 0x8F, 0x85, 0x43, 0xE6, 0x8F, 0xA4, 0x43, 0xE6, + 0x90, 0x9C, 0x43, 0xE6, 0x90, 0xA2, 0x43, 0xE6, + 0x91, 0x92, 0x43, 0xE6, 0x91, 0xA9, 0x43, 0xE6, + 0x91, 0xB7, 0x43, 0xE6, 0x91, 0xBE, 0x43, 0xE6, + // Bytes d80 - dbf + 0x92, 0x9A, 0x43, 0xE6, 0x92, 0x9D, 0x43, 0xE6, + 0x93, 0x84, 0x43, 0xE6, 0x94, 0xAF, 0x43, 0xE6, + 0x94, 0xB4, 0x43, 0xE6, 0x95, 0x8F, 0x43, 0xE6, + 0x95, 0x96, 0x43, 0xE6, 0x95, 0xAC, 0x43, 0xE6, + 0x95, 0xB8, 0x43, 0xE6, 0x96, 0x87, 0x43, 0xE6, + 0x96, 0x97, 0x43, 0xE6, 0x96, 0x99, 0x43, 0xE6, + 0x96, 0xA4, 0x43, 0xE6, 0x96, 0xB0, 0x43, 0xE6, + 0x96, 0xB9, 0x43, 0xE6, 0x97, 0x85, 0x43, 0xE6, + // Bytes dc0 - dff + 0x97, 0xA0, 0x43, 0xE6, 0x97, 0xA2, 0x43, 0xE6, + 0x97, 0xA3, 0x43, 0xE6, 0x97, 0xA5, 0x43, 0xE6, + 0x98, 0x93, 0x43, 0xE6, 0x98, 0xA0, 0x43, 0xE6, + 0x99, 0x89, 0x43, 0xE6, 0x99, 0xB4, 0x43, 0xE6, + 0x9A, 0x88, 0x43, 0xE6, 0x9A, 0x91, 0x43, 0xE6, + 0x9A, 0x9C, 0x43, 0xE6, 0x9A, 0xB4, 0x43, 0xE6, + 0x9B, 0x86, 0x43, 0xE6, 0x9B, 0xB0, 0x43, 0xE6, + 0x9B, 0xB4, 0x43, 0xE6, 0x9B, 0xB8, 0x43, 0xE6, + // Bytes e00 - e3f + 0x9C, 0x80, 0x43, 0xE6, 0x9C, 0x88, 0x43, 0xE6, + 0x9C, 0x89, 0x43, 0xE6, 0x9C, 0x97, 0x43, 0xE6, + 0x9C, 0x9B, 0x43, 0xE6, 0x9C, 0xA1, 0x43, 0xE6, + 0x9C, 0xA8, 0x43, 0xE6, 0x9D, 0x8E, 0x43, 0xE6, + 0x9D, 0x93, 0x43, 0xE6, 0x9D, 0x96, 0x43, 0xE6, + 0x9D, 0x9E, 0x43, 0xE6, 0x9D, 0xBB, 0x43, 0xE6, + 0x9E, 0x85, 0x43, 0xE6, 0x9E, 0x97, 0x43, 0xE6, + 0x9F, 0xB3, 0x43, 0xE6, 0x9F, 0xBA, 0x43, 0xE6, + // Bytes e40 - e7f + 0xA0, 0x97, 0x43, 0xE6, 0xA0, 0x9F, 0x43, 0xE6, + 0xA0, 0xAA, 0x43, 0xE6, 0xA1, 0x92, 0x43, 0xE6, + 0xA2, 0x81, 0x43, 0xE6, 0xA2, 0x85, 0x43, 0xE6, + 0xA2, 0x8E, 0x43, 0xE6, 0xA2, 0xA8, 0x43, 0xE6, + 0xA4, 0x94, 0x43, 0xE6, 0xA5, 0x82, 0x43, 0xE6, + 0xA6, 0xA3, 0x43, 0xE6, 0xA7, 0xAA, 0x43, 0xE6, + 0xA8, 0x82, 0x43, 0xE6, 0xA8, 0x93, 0x43, 0xE6, + 0xAA, 0xA8, 0x43, 0xE6, 0xAB, 0x93, 0x43, 0xE6, + // Bytes e80 - ebf + 0xAB, 0x9B, 0x43, 0xE6, 0xAC, 0x84, 0x43, 0xE6, + 0xAC, 0xA0, 0x43, 0xE6, 0xAC, 0xA1, 0x43, 0xE6, + 0xAD, 0x94, 0x43, 0xE6, 0xAD, 0xA2, 0x43, 0xE6, + 0xAD, 0xA3, 0x43, 0xE6, 0xAD, 0xB2, 0x43, 0xE6, + 0xAD, 0xB7, 0x43, 0xE6, 0xAD, 0xB9, 0x43, 0xE6, + 0xAE, 0x9F, 0x43, 0xE6, 0xAE, 0xAE, 0x43, 0xE6, + 0xAE, 0xB3, 0x43, 0xE6, 0xAE, 0xBA, 0x43, 0xE6, + 0xAE, 0xBB, 0x43, 0xE6, 0xAF, 0x8B, 0x43, 0xE6, + // Bytes ec0 - eff + 0xAF, 0x8D, 0x43, 0xE6, 0xAF, 0x94, 0x43, 0xE6, + 0xAF, 0x9B, 0x43, 0xE6, 0xB0, 0x8F, 0x43, 0xE6, + 0xB0, 0x94, 0x43, 0xE6, 0xB0, 0xB4, 0x43, 0xE6, + 0xB1, 0x8E, 0x43, 0xE6, 0xB1, 0xA7, 0x43, 0xE6, + 0xB2, 0x88, 0x43, 0xE6, 0xB2, 0xBF, 0x43, 0xE6, + 0xB3, 0x8C, 0x43, 0xE6, 0xB3, 0x8D, 0x43, 0xE6, + 0xB3, 0xA5, 0x43, 0xE6, 0xB3, 0xA8, 0x43, 0xE6, + 0xB4, 0x96, 0x43, 0xE6, 0xB4, 0x9B, 0x43, 0xE6, + // Bytes f00 - f3f + 0xB4, 0x9E, 0x43, 0xE6, 0xB4, 0xB4, 0x43, 0xE6, + 0xB4, 0xBE, 0x43, 0xE6, 0xB5, 0x81, 0x43, 0xE6, + 0xB5, 0xA9, 0x43, 0xE6, 0xB5, 0xAA, 0x43, 0xE6, + 0xB5, 0xB7, 0x43, 0xE6, 0xB5, 0xB8, 0x43, 0xE6, + 0xB6, 0x85, 0x43, 0xE6, 0xB7, 0x8B, 0x43, 0xE6, + 0xB7, 0x9A, 0x43, 0xE6, 0xB7, 0xAA, 0x43, 0xE6, + 0xB7, 0xB9, 0x43, 0xE6, 0xB8, 0x9A, 0x43, 0xE6, + 0xB8, 0xAF, 0x43, 0xE6, 0xB9, 0xAE, 0x43, 0xE6, + // Bytes f40 - f7f + 0xBA, 0x80, 0x43, 0xE6, 0xBA, 0x9C, 0x43, 0xE6, + 0xBA, 0xBA, 0x43, 0xE6, 0xBB, 0x87, 0x43, 0xE6, + 0xBB, 0x8B, 0x43, 0xE6, 0xBB, 0x91, 0x43, 0xE6, + 0xBB, 0x9B, 0x43, 0xE6, 0xBC, 0x8F, 0x43, 0xE6, + 0xBC, 0x94, 0x43, 0xE6, 0xBC, 0xA2, 0x43, 0xE6, + 0xBC, 0xA3, 0x43, 0xE6, 0xBD, 0xAE, 0x43, 0xE6, + 0xBF, 0x86, 0x43, 0xE6, 0xBF, 0xAB, 0x43, 0xE6, + 0xBF, 0xBE, 0x43, 0xE7, 0x80, 0x9B, 0x43, 0xE7, + // Bytes f80 - fbf + 0x80, 0x9E, 0x43, 0xE7, 0x80, 0xB9, 0x43, 0xE7, + 0x81, 0x8A, 0x43, 0xE7, 0x81, 0xAB, 0x43, 0xE7, + 0x81, 0xB0, 0x43, 0xE7, 0x81, 0xB7, 0x43, 0xE7, + 0x81, 0xBD, 0x43, 0xE7, 0x82, 0x99, 0x43, 0xE7, + 0x82, 0xAD, 0x43, 0xE7, 0x83, 0x88, 0x43, 0xE7, + 0x83, 0x99, 0x43, 0xE7, 0x84, 0xA1, 0x43, 0xE7, + 0x85, 0x85, 0x43, 0xE7, 0x85, 0x89, 0x43, 0xE7, + 0x85, 0xAE, 0x43, 0xE7, 0x86, 0x9C, 0x43, 0xE7, + // Bytes fc0 - fff + 0x87, 0x8E, 0x43, 0xE7, 0x87, 0x90, 0x43, 0xE7, + 0x88, 0x90, 0x43, 0xE7, 0x88, 0x9B, 0x43, 0xE7, + 0x88, 0xA8, 0x43, 0xE7, 0x88, 0xAA, 0x43, 0xE7, + 0x88, 0xAB, 0x43, 0xE7, 0x88, 0xB5, 0x43, 0xE7, + 0x88, 0xB6, 0x43, 0xE7, 0x88, 0xBB, 0x43, 0xE7, + 0x88, 0xBF, 0x43, 0xE7, 0x89, 0x87, 0x43, 0xE7, + 0x89, 0x90, 0x43, 0xE7, 0x89, 0x99, 0x43, 0xE7, + 0x89, 0x9B, 0x43, 0xE7, 0x89, 0xA2, 0x43, 0xE7, + // Bytes 1000 - 103f + 0x89, 0xB9, 0x43, 0xE7, 0x8A, 0x80, 0x43, 0xE7, + 0x8A, 0x95, 0x43, 0xE7, 0x8A, 0xAC, 0x43, 0xE7, + 0x8A, 0xAF, 0x43, 0xE7, 0x8B, 0x80, 0x43, 0xE7, + 0x8B, 0xBC, 0x43, 0xE7, 0x8C, 0xAA, 0x43, 0xE7, + 0x8D, 0xB5, 0x43, 0xE7, 0x8D, 0xBA, 0x43, 0xE7, + 0x8E, 0x84, 0x43, 0xE7, 0x8E, 0x87, 0x43, 0xE7, + 0x8E, 0x89, 0x43, 0xE7, 0x8E, 0x8B, 0x43, 0xE7, + 0x8E, 0xA5, 0x43, 0xE7, 0x8E, 0xB2, 0x43, 0xE7, + // Bytes 1040 - 107f + 0x8F, 0x9E, 0x43, 0xE7, 0x90, 0x86, 0x43, 0xE7, + 0x90, 0x89, 0x43, 0xE7, 0x90, 0xA2, 0x43, 0xE7, + 0x91, 0x87, 0x43, 0xE7, 0x91, 0x9C, 0x43, 0xE7, + 0x91, 0xA9, 0x43, 0xE7, 0x91, 0xB1, 0x43, 0xE7, + 0x92, 0x85, 0x43, 0xE7, 0x92, 0x89, 0x43, 0xE7, + 0x92, 0x98, 0x43, 0xE7, 0x93, 0x8A, 0x43, 0xE7, + 0x93, 0x9C, 0x43, 0xE7, 0x93, 0xA6, 0x43, 0xE7, + 0x94, 0x86, 0x43, 0xE7, 0x94, 0x98, 0x43, 0xE7, + // Bytes 1080 - 10bf + 0x94, 0x9F, 0x43, 0xE7, 0x94, 0xA4, 0x43, 0xE7, + 0x94, 0xA8, 0x43, 0xE7, 0x94, 0xB0, 0x43, 0xE7, + 0x94, 0xB2, 0x43, 0xE7, 0x94, 0xB3, 0x43, 0xE7, + 0x94, 0xB7, 0x43, 0xE7, 0x94, 0xBB, 0x43, 0xE7, + 0x94, 0xBE, 0x43, 0xE7, 0x95, 0x99, 0x43, 0xE7, + 0x95, 0xA5, 0x43, 0xE7, 0x95, 0xB0, 0x43, 0xE7, + 0x96, 0x8B, 0x43, 0xE7, 0x96, 0x92, 0x43, 0xE7, + 0x97, 0xA2, 0x43, 0xE7, 0x98, 0x90, 0x43, 0xE7, + // Bytes 10c0 - 10ff + 0x98, 0x9D, 0x43, 0xE7, 0x98, 0x9F, 0x43, 0xE7, + 0x99, 0x82, 0x43, 0xE7, 0x99, 0xA9, 0x43, 0xE7, + 0x99, 0xB6, 0x43, 0xE7, 0x99, 0xBD, 0x43, 0xE7, + 0x9A, 0xAE, 0x43, 0xE7, 0x9A, 0xBF, 0x43, 0xE7, + 0x9B, 0x8A, 0x43, 0xE7, 0x9B, 0x9B, 0x43, 0xE7, + 0x9B, 0xA3, 0x43, 0xE7, 0x9B, 0xA7, 0x43, 0xE7, + 0x9B, 0xAE, 0x43, 0xE7, 0x9B, 0xB4, 0x43, 0xE7, + 0x9C, 0x81, 0x43, 0xE7, 0x9C, 0x9E, 0x43, 0xE7, + // Bytes 1100 - 113f + 0x9C, 0x9F, 0x43, 0xE7, 0x9D, 0x80, 0x43, 0xE7, + 0x9D, 0x8A, 0x43, 0xE7, 0x9E, 0x8B, 0x43, 0xE7, + 0x9E, 0xA7, 0x43, 0xE7, 0x9F, 0x9B, 0x43, 0xE7, + 0x9F, 0xA2, 0x43, 0xE7, 0x9F, 0xB3, 0x43, 0xE7, + 0xA1, 0x8E, 0x43, 0xE7, 0xA1, 0xAB, 0x43, 0xE7, + 0xA2, 0x8C, 0x43, 0xE7, 0xA2, 0x91, 0x43, 0xE7, + 0xA3, 0x8A, 0x43, 0xE7, 0xA3, 0x8C, 0x43, 0xE7, + 0xA3, 0xBB, 0x43, 0xE7, 0xA4, 0xAA, 0x43, 0xE7, + // Bytes 1140 - 117f + 0xA4, 0xBA, 0x43, 0xE7, 0xA4, 0xBC, 0x43, 0xE7, + 0xA4, 0xBE, 0x43, 0xE7, 0xA5, 0x88, 0x43, 0xE7, + 0xA5, 0x89, 0x43, 0xE7, 0xA5, 0x90, 0x43, 0xE7, + 0xA5, 0x96, 0x43, 0xE7, 0xA5, 0x9D, 0x43, 0xE7, + 0xA5, 0x9E, 0x43, 0xE7, 0xA5, 0xA5, 0x43, 0xE7, + 0xA5, 0xBF, 0x43, 0xE7, 0xA6, 0x81, 0x43, 0xE7, + 0xA6, 0x8D, 0x43, 0xE7, 0xA6, 0x8E, 0x43, 0xE7, + 0xA6, 0x8F, 0x43, 0xE7, 0xA6, 0xAE, 0x43, 0xE7, + // Bytes 1180 - 11bf + 0xA6, 0xB8, 0x43, 0xE7, 0xA6, 0xBE, 0x43, 0xE7, + 0xA7, 0x8A, 0x43, 0xE7, 0xA7, 0x98, 0x43, 0xE7, + 0xA7, 0xAB, 0x43, 0xE7, 0xA8, 0x9C, 0x43, 0xE7, + 0xA9, 0x80, 0x43, 0xE7, 0xA9, 0x8A, 0x43, 0xE7, + 0xA9, 0x8F, 0x43, 0xE7, 0xA9, 0xB4, 0x43, 0xE7, + 0xA9, 0xBA, 0x43, 0xE7, 0xAA, 0x81, 0x43, 0xE7, + 0xAA, 0xB1, 0x43, 0xE7, 0xAB, 0x8B, 0x43, 0xE7, + 0xAB, 0xAE, 0x43, 0xE7, 0xAB, 0xB9, 0x43, 0xE7, + // Bytes 11c0 - 11ff + 0xAC, 0xA0, 0x43, 0xE7, 0xAE, 0x8F, 0x43, 0xE7, + 0xAF, 0x80, 0x43, 0xE7, 0xAF, 0x86, 0x43, 0xE7, + 0xAF, 0x89, 0x43, 0xE7, 0xB0, 0xBE, 0x43, 0xE7, + 0xB1, 0xA0, 0x43, 0xE7, 0xB1, 0xB3, 0x43, 0xE7, + 0xB1, 0xBB, 0x43, 0xE7, 0xB2, 0x92, 0x43, 0xE7, + 0xB2, 0xBE, 0x43, 0xE7, 0xB3, 0x92, 0x43, 0xE7, + 0xB3, 0x96, 0x43, 0xE7, 0xB3, 0xA3, 0x43, 0xE7, + 0xB3, 0xA7, 0x43, 0xE7, 0xB3, 0xA8, 0x43, 0xE7, + // Bytes 1200 - 123f + 0xB3, 0xB8, 0x43, 0xE7, 0xB4, 0x80, 0x43, 0xE7, + 0xB4, 0x90, 0x43, 0xE7, 0xB4, 0xA2, 0x43, 0xE7, + 0xB4, 0xAF, 0x43, 0xE7, 0xB5, 0x82, 0x43, 0xE7, + 0xB5, 0x9B, 0x43, 0xE7, 0xB5, 0xA3, 0x43, 0xE7, + 0xB6, 0xA0, 0x43, 0xE7, 0xB6, 0xBE, 0x43, 0xE7, + 0xB7, 0x87, 0x43, 0xE7, 0xB7, 0xB4, 0x43, 0xE7, + 0xB8, 0x82, 0x43, 0xE7, 0xB8, 0x89, 0x43, 0xE7, + 0xB8, 0xB7, 0x43, 0xE7, 0xB9, 0x81, 0x43, 0xE7, + // Bytes 1240 - 127f + 0xB9, 0x85, 0x43, 0xE7, 0xBC, 0xB6, 0x43, 0xE7, + 0xBC, 0xBE, 0x43, 0xE7, 0xBD, 0x91, 0x43, 0xE7, + 0xBD, 0xB2, 0x43, 0xE7, 0xBD, 0xB9, 0x43, 0xE7, + 0xBD, 0xBA, 0x43, 0xE7, 0xBE, 0x85, 0x43, 0xE7, + 0xBE, 0x8A, 0x43, 0xE7, 0xBE, 0x95, 0x43, 0xE7, + 0xBE, 0x9A, 0x43, 0xE7, 0xBE, 0xBD, 0x43, 0xE7, + 0xBF, 0xBA, 0x43, 0xE8, 0x80, 0x81, 0x43, 0xE8, + 0x80, 0x85, 0x43, 0xE8, 0x80, 0x8C, 0x43, 0xE8, + // Bytes 1280 - 12bf + 0x80, 0x92, 0x43, 0xE8, 0x80, 0xB3, 0x43, 0xE8, + 0x81, 0x86, 0x43, 0xE8, 0x81, 0xA0, 0x43, 0xE8, + 0x81, 0xAF, 0x43, 0xE8, 0x81, 0xB0, 0x43, 0xE8, + 0x81, 0xBE, 0x43, 0xE8, 0x81, 0xBF, 0x43, 0xE8, + 0x82, 0x89, 0x43, 0xE8, 0x82, 0x8B, 0x43, 0xE8, + 0x82, 0xAD, 0x43, 0xE8, 0x82, 0xB2, 0x43, 0xE8, + 0x84, 0x83, 0x43, 0xE8, 0x84, 0xBE, 0x43, 0xE8, + 0x87, 0x98, 0x43, 0xE8, 0x87, 0xA3, 0x43, 0xE8, + // Bytes 12c0 - 12ff + 0x87, 0xA8, 0x43, 0xE8, 0x87, 0xAA, 0x43, 0xE8, + 0x87, 0xAD, 0x43, 0xE8, 0x87, 0xB3, 0x43, 0xE8, + 0x87, 0xBC, 0x43, 0xE8, 0x88, 0x81, 0x43, 0xE8, + 0x88, 0x84, 0x43, 0xE8, 0x88, 0x8C, 0x43, 0xE8, + 0x88, 0x98, 0x43, 0xE8, 0x88, 0x9B, 0x43, 0xE8, + 0x88, 0x9F, 0x43, 0xE8, 0x89, 0xAE, 0x43, 0xE8, + 0x89, 0xAF, 0x43, 0xE8, 0x89, 0xB2, 0x43, 0xE8, + 0x89, 0xB8, 0x43, 0xE8, 0x89, 0xB9, 0x43, 0xE8, + // Bytes 1300 - 133f + 0x8A, 0x8B, 0x43, 0xE8, 0x8A, 0x91, 0x43, 0xE8, + 0x8A, 0x9D, 0x43, 0xE8, 0x8A, 0xB1, 0x43, 0xE8, + 0x8A, 0xB3, 0x43, 0xE8, 0x8A, 0xBD, 0x43, 0xE8, + 0x8B, 0xA5, 0x43, 0xE8, 0x8B, 0xA6, 0x43, 0xE8, + 0x8C, 0x9D, 0x43, 0xE8, 0x8C, 0xA3, 0x43, 0xE8, + 0x8C, 0xB6, 0x43, 0xE8, 0x8D, 0x92, 0x43, 0xE8, + 0x8D, 0x93, 0x43, 0xE8, 0x8D, 0xA3, 0x43, 0xE8, + 0x8E, 0xAD, 0x43, 0xE8, 0x8E, 0xBD, 0x43, 0xE8, + // Bytes 1340 - 137f + 0x8F, 0x89, 0x43, 0xE8, 0x8F, 0x8A, 0x43, 0xE8, + 0x8F, 0x8C, 0x43, 0xE8, 0x8F, 0x9C, 0x43, 0xE8, + 0x8F, 0xA7, 0x43, 0xE8, 0x8F, 0xAF, 0x43, 0xE8, + 0x8F, 0xB1, 0x43, 0xE8, 0x90, 0xBD, 0x43, 0xE8, + 0x91, 0x89, 0x43, 0xE8, 0x91, 0x97, 0x43, 0xE8, + 0x93, 0xAE, 0x43, 0xE8, 0x93, 0xB1, 0x43, 0xE8, + 0x93, 0xB3, 0x43, 0xE8, 0x93, 0xBC, 0x43, 0xE8, + 0x94, 0x96, 0x43, 0xE8, 0x95, 0xA4, 0x43, 0xE8, + // Bytes 1380 - 13bf + 0x97, 0x8D, 0x43, 0xE8, 0x97, 0xBA, 0x43, 0xE8, + 0x98, 0x86, 0x43, 0xE8, 0x98, 0x92, 0x43, 0xE8, + 0x98, 0xAD, 0x43, 0xE8, 0x98, 0xBF, 0x43, 0xE8, + 0x99, 0x8D, 0x43, 0xE8, 0x99, 0x90, 0x43, 0xE8, + 0x99, 0x9C, 0x43, 0xE8, 0x99, 0xA7, 0x43, 0xE8, + 0x99, 0xA9, 0x43, 0xE8, 0x99, 0xAB, 0x43, 0xE8, + 0x9A, 0x88, 0x43, 0xE8, 0x9A, 0xA9, 0x43, 0xE8, + 0x9B, 0xA2, 0x43, 0xE8, 0x9C, 0x8E, 0x43, 0xE8, + // Bytes 13c0 - 13ff + 0x9C, 0xA8, 0x43, 0xE8, 0x9D, 0xAB, 0x43, 0xE8, + 0x9D, 0xB9, 0x43, 0xE8, 0x9E, 0x86, 0x43, 0xE8, + 0x9E, 0xBA, 0x43, 0xE8, 0x9F, 0xA1, 0x43, 0xE8, + 0xA0, 0x81, 0x43, 0xE8, 0xA0, 0x9F, 0x43, 0xE8, + 0xA1, 0x80, 0x43, 0xE8, 0xA1, 0x8C, 0x43, 0xE8, + 0xA1, 0xA0, 0x43, 0xE8, 0xA1, 0xA3, 0x43, 0xE8, + 0xA3, 0x82, 0x43, 0xE8, 0xA3, 0x8F, 0x43, 0xE8, + 0xA3, 0x97, 0x43, 0xE8, 0xA3, 0x9E, 0x43, 0xE8, + // Bytes 1400 - 143f + 0xA3, 0xA1, 0x43, 0xE8, 0xA3, 0xB8, 0x43, 0xE8, + 0xA3, 0xBA, 0x43, 0xE8, 0xA4, 0x90, 0x43, 0xE8, + 0xA5, 0x81, 0x43, 0xE8, 0xA5, 0xA4, 0x43, 0xE8, + 0xA5, 0xBE, 0x43, 0xE8, 0xA6, 0x86, 0x43, 0xE8, + 0xA6, 0x8B, 0x43, 0xE8, 0xA6, 0x96, 0x43, 0xE8, + 0xA7, 0x92, 0x43, 0xE8, 0xA7, 0xA3, 0x43, 0xE8, + 0xA8, 0x80, 0x43, 0xE8, 0xAA, 0xA0, 0x43, 0xE8, + 0xAA, 0xAA, 0x43, 0xE8, 0xAA, 0xBF, 0x43, 0xE8, + // Bytes 1440 - 147f + 0xAB, 0x8B, 0x43, 0xE8, 0xAB, 0x92, 0x43, 0xE8, + 0xAB, 0x96, 0x43, 0xE8, 0xAB, 0xAD, 0x43, 0xE8, + 0xAB, 0xB8, 0x43, 0xE8, 0xAB, 0xBE, 0x43, 0xE8, + 0xAC, 0x81, 0x43, 0xE8, 0xAC, 0xB9, 0x43, 0xE8, + 0xAD, 0x98, 0x43, 0xE8, 0xAE, 0x80, 0x43, 0xE8, + 0xAE, 0x8A, 0x43, 0xE8, 0xB0, 0xB7, 0x43, 0xE8, + 0xB1, 0x86, 0x43, 0xE8, 0xB1, 0x88, 0x43, 0xE8, + 0xB1, 0x95, 0x43, 0xE8, 0xB1, 0xB8, 0x43, 0xE8, + // Bytes 1480 - 14bf + 0xB2, 0x9D, 0x43, 0xE8, 0xB2, 0xA1, 0x43, 0xE8, + 0xB2, 0xA9, 0x43, 0xE8, 0xB2, 0xAB, 0x43, 0xE8, + 0xB3, 0x81, 0x43, 0xE8, 0xB3, 0x82, 0x43, 0xE8, + 0xB3, 0x87, 0x43, 0xE8, 0xB3, 0x88, 0x43, 0xE8, + 0xB3, 0x93, 0x43, 0xE8, 0xB4, 0x88, 0x43, 0xE8, + 0xB4, 0x9B, 0x43, 0xE8, 0xB5, 0xA4, 0x43, 0xE8, + 0xB5, 0xB0, 0x43, 0xE8, 0xB5, 0xB7, 0x43, 0xE8, + 0xB6, 0xB3, 0x43, 0xE8, 0xB6, 0xBC, 0x43, 0xE8, + // Bytes 14c0 - 14ff + 0xB7, 0x8B, 0x43, 0xE8, 0xB7, 0xAF, 0x43, 0xE8, + 0xB7, 0xB0, 0x43, 0xE8, 0xBA, 0xAB, 0x43, 0xE8, + 0xBB, 0x8A, 0x43, 0xE8, 0xBB, 0x94, 0x43, 0xE8, + 0xBC, 0xA6, 0x43, 0xE8, 0xBC, 0xAA, 0x43, 0xE8, + 0xBC, 0xB8, 0x43, 0xE8, 0xBC, 0xBB, 0x43, 0xE8, + 0xBD, 0xA2, 0x43, 0xE8, 0xBE, 0x9B, 0x43, 0xE8, + 0xBE, 0x9E, 0x43, 0xE8, 0xBE, 0xB0, 0x43, 0xE8, + 0xBE, 0xB5, 0x43, 0xE8, 0xBE, 0xB6, 0x43, 0xE9, + // Bytes 1500 - 153f + 0x80, 0xA3, 0x43, 0xE9, 0x80, 0xB8, 0x43, 0xE9, + 0x81, 0x8A, 0x43, 0xE9, 0x81, 0xA9, 0x43, 0xE9, + 0x81, 0xB2, 0x43, 0xE9, 0x81, 0xBC, 0x43, 0xE9, + 0x82, 0x8F, 0x43, 0xE9, 0x82, 0x91, 0x43, 0xE9, + 0x82, 0x94, 0x43, 0xE9, 0x83, 0x8E, 0x43, 0xE9, + 0x83, 0x9E, 0x43, 0xE9, 0x83, 0xB1, 0x43, 0xE9, + 0x83, 0xBD, 0x43, 0xE9, 0x84, 0x91, 0x43, 0xE9, + 0x84, 0x9B, 0x43, 0xE9, 0x85, 0x89, 0x43, 0xE9, + // Bytes 1540 - 157f + 0x85, 0x8D, 0x43, 0xE9, 0x85, 0xAA, 0x43, 0xE9, + 0x86, 0x99, 0x43, 0xE9, 0x86, 0xB4, 0x43, 0xE9, + 0x87, 0x86, 0x43, 0xE9, 0x87, 0x8C, 0x43, 0xE9, + 0x87, 0x8F, 0x43, 0xE9, 0x87, 0x91, 0x43, 0xE9, + 0x88, 0xB4, 0x43, 0xE9, 0x88, 0xB8, 0x43, 0xE9, + 0x89, 0xB6, 0x43, 0xE9, 0x89, 0xBC, 0x43, 0xE9, + 0x8B, 0x97, 0x43, 0xE9, 0x8B, 0x98, 0x43, 0xE9, + 0x8C, 0x84, 0x43, 0xE9, 0x8D, 0x8A, 0x43, 0xE9, + // Bytes 1580 - 15bf + 0x8F, 0xB9, 0x43, 0xE9, 0x90, 0x95, 0x43, 0xE9, + 0x95, 0xB7, 0x43, 0xE9, 0x96, 0x80, 0x43, 0xE9, + 0x96, 0x8B, 0x43, 0xE9, 0x96, 0xAD, 0x43, 0xE9, + 0x96, 0xB7, 0x43, 0xE9, 0x98, 0x9C, 0x43, 0xE9, + 0x98, 0xAE, 0x43, 0xE9, 0x99, 0x8B, 0x43, 0xE9, + 0x99, 0x8D, 0x43, 0xE9, 0x99, 0xB5, 0x43, 0xE9, + 0x99, 0xB8, 0x43, 0xE9, 0x99, 0xBC, 0x43, 0xE9, + 0x9A, 0x86, 0x43, 0xE9, 0x9A, 0xA3, 0x43, 0xE9, + // Bytes 15c0 - 15ff + 0x9A, 0xB6, 0x43, 0xE9, 0x9A, 0xB7, 0x43, 0xE9, + 0x9A, 0xB8, 0x43, 0xE9, 0x9A, 0xB9, 0x43, 0xE9, + 0x9B, 0x83, 0x43, 0xE9, 0x9B, 0xA2, 0x43, 0xE9, + 0x9B, 0xA3, 0x43, 0xE9, 0x9B, 0xA8, 0x43, 0xE9, + 0x9B, 0xB6, 0x43, 0xE9, 0x9B, 0xB7, 0x43, 0xE9, + 0x9C, 0xA3, 0x43, 0xE9, 0x9C, 0xB2, 0x43, 0xE9, + 0x9D, 0x88, 0x43, 0xE9, 0x9D, 0x91, 0x43, 0xE9, + 0x9D, 0x96, 0x43, 0xE9, 0x9D, 0x9E, 0x43, 0xE9, + // Bytes 1600 - 163f + 0x9D, 0xA2, 0x43, 0xE9, 0x9D, 0xA9, 0x43, 0xE9, + 0x9F, 0x8B, 0x43, 0xE9, 0x9F, 0x9B, 0x43, 0xE9, + 0x9F, 0xA0, 0x43, 0xE9, 0x9F, 0xAD, 0x43, 0xE9, + 0x9F, 0xB3, 0x43, 0xE9, 0x9F, 0xBF, 0x43, 0xE9, + 0xA0, 0x81, 0x43, 0xE9, 0xA0, 0x85, 0x43, 0xE9, + 0xA0, 0x8B, 0x43, 0xE9, 0xA0, 0x98, 0x43, 0xE9, + 0xA0, 0xA9, 0x43, 0xE9, 0xA0, 0xBB, 0x43, 0xE9, + 0xA1, 0x9E, 0x43, 0xE9, 0xA2, 0xA8, 0x43, 0xE9, + // Bytes 1640 - 167f + 0xA3, 0x9B, 0x43, 0xE9, 0xA3, 0x9F, 0x43, 0xE9, + 0xA3, 0xA2, 0x43, 0xE9, 0xA3, 0xAF, 0x43, 0xE9, + 0xA3, 0xBC, 0x43, 0xE9, 0xA4, 0xA8, 0x43, 0xE9, + 0xA4, 0xA9, 0x43, 0xE9, 0xA6, 0x96, 0x43, 0xE9, + 0xA6, 0x99, 0x43, 0xE9, 0xA6, 0xA7, 0x43, 0xE9, + 0xA6, 0xAC, 0x43, 0xE9, 0xA7, 0x82, 0x43, 0xE9, + 0xA7, 0xB1, 0x43, 0xE9, 0xA7, 0xBE, 0x43, 0xE9, + 0xA9, 0xAA, 0x43, 0xE9, 0xAA, 0xA8, 0x43, 0xE9, + // Bytes 1680 - 16bf + 0xAB, 0x98, 0x43, 0xE9, 0xAB, 0x9F, 0x43, 0xE9, + 0xAC, 0x92, 0x43, 0xE9, 0xAC, 0xA5, 0x43, 0xE9, + 0xAC, 0xAF, 0x43, 0xE9, 0xAC, 0xB2, 0x43, 0xE9, + 0xAC, 0xBC, 0x43, 0xE9, 0xAD, 0x9A, 0x43, 0xE9, + 0xAD, 0xAF, 0x43, 0xE9, 0xB1, 0x80, 0x43, 0xE9, + 0xB1, 0x97, 0x43, 0xE9, 0xB3, 0xA5, 0x43, 0xE9, + 0xB3, 0xBD, 0x43, 0xE9, 0xB5, 0xA7, 0x43, 0xE9, + 0xB6, 0xB4, 0x43, 0xE9, 0xB7, 0xBA, 0x43, 0xE9, + // Bytes 16c0 - 16ff + 0xB8, 0x9E, 0x43, 0xE9, 0xB9, 0xB5, 0x43, 0xE9, + 0xB9, 0xBF, 0x43, 0xE9, 0xBA, 0x97, 0x43, 0xE9, + 0xBA, 0x9F, 0x43, 0xE9, 0xBA, 0xA5, 0x43, 0xE9, + 0xBA, 0xBB, 0x43, 0xE9, 0xBB, 0x83, 0x43, 0xE9, + 0xBB, 0x8D, 0x43, 0xE9, 0xBB, 0x8E, 0x43, 0xE9, + 0xBB, 0x91, 0x43, 0xE9, 0xBB, 0xB9, 0x43, 0xE9, + 0xBB, 0xBD, 0x43, 0xE9, 0xBB, 0xBE, 0x43, 0xE9, + 0xBC, 0x85, 0x43, 0xE9, 0xBC, 0x8E, 0x43, 0xE9, + // Bytes 1700 - 173f + 0xBC, 0x8F, 0x43, 0xE9, 0xBC, 0x93, 0x43, 0xE9, + 0xBC, 0x96, 0x43, 0xE9, 0xBC, 0xA0, 0x43, 0xE9, + 0xBC, 0xBB, 0x43, 0xE9, 0xBD, 0x83, 0x43, 0xE9, + 0xBD, 0x8A, 0x43, 0xE9, 0xBD, 0x92, 0x43, 0xE9, + 0xBE, 0x8D, 0x43, 0xE9, 0xBE, 0x8E, 0x43, 0xE9, + 0xBE, 0x9C, 0x43, 0xE9, 0xBE, 0x9F, 0x43, 0xE9, + 0xBE, 0xA0, 0x43, 0xEA, 0x99, 0x91, 0x43, 0xEA, + 0x9A, 0x89, 0x43, 0xEA, 0x9C, 0xA7, 0x43, 0xEA, + // Bytes 1740 - 177f + 0x9D, 0xAF, 0x43, 0xEA, 0x9E, 0x8E, 0x43, 0xEA, + 0xAC, 0xB7, 0x43, 0xEA, 0xAD, 0x92, 0x43, 0xEA, + 0xAD, 0xA6, 0x43, 0xEA, 0xAD, 0xA7, 0x44, 0xF0, + 0x9D, 0xBC, 0x84, 0x44, 0xF0, 0x9D, 0xBC, 0x85, + 0x44, 0xF0, 0x9D, 0xBC, 0x86, 0x44, 0xF0, 0x9D, + 0xBC, 0x88, 0x44, 0xF0, 0x9D, 0xBC, 0x8A, 0x44, + 0xF0, 0x9D, 0xBC, 0x9E, 0x44, 0xF0, 0xA0, 0x84, + 0xA2, 0x44, 0xF0, 0xA0, 0x94, 0x9C, 0x44, 0xF0, + // Bytes 1780 - 17bf + 0xA0, 0x94, 0xA5, 0x44, 0xF0, 0xA0, 0x95, 0x8B, + 0x44, 0xF0, 0xA0, 0x98, 0xBA, 0x44, 0xF0, 0xA0, + 0xA0, 0x84, 0x44, 0xF0, 0xA0, 0xA3, 0x9E, 0x44, + 0xF0, 0xA0, 0xA8, 0xAC, 0x44, 0xF0, 0xA0, 0xAD, + 0xA3, 0x44, 0xF0, 0xA1, 0x93, 0xA4, 0x44, 0xF0, + 0xA1, 0x9A, 0xA8, 0x44, 0xF0, 0xA1, 0x9B, 0xAA, + 0x44, 0xF0, 0xA1, 0xA7, 0x88, 0x44, 0xF0, 0xA1, + 0xAC, 0x98, 0x44, 0xF0, 0xA1, 0xB4, 0x8B, 0x44, + // Bytes 17c0 - 17ff + 0xF0, 0xA1, 0xB7, 0xA4, 0x44, 0xF0, 0xA1, 0xB7, + 0xA6, 0x44, 0xF0, 0xA2, 0x86, 0x83, 0x44, 0xF0, + 0xA2, 0x86, 0x9F, 0x44, 0xF0, 0xA2, 0x8C, 0xB1, + 0x44, 0xF0, 0xA2, 0x9B, 0x94, 0x44, 0xF0, 0xA2, + 0xA1, 0x84, 0x44, 0xF0, 0xA2, 0xA1, 0x8A, 0x44, + 0xF0, 0xA2, 0xAC, 0x8C, 0x44, 0xF0, 0xA2, 0xAF, + 0xB1, 0x44, 0xF0, 0xA3, 0x80, 0x8A, 0x44, 0xF0, + 0xA3, 0x8A, 0xB8, 0x44, 0xF0, 0xA3, 0x8D, 0x9F, + // Bytes 1800 - 183f + 0x44, 0xF0, 0xA3, 0x8E, 0x93, 0x44, 0xF0, 0xA3, + 0x8E, 0x9C, 0x44, 0xF0, 0xA3, 0x8F, 0x83, 0x44, + 0xF0, 0xA3, 0x8F, 0x95, 0x44, 0xF0, 0xA3, 0x91, + 0xAD, 0x44, 0xF0, 0xA3, 0x9A, 0xA3, 0x44, 0xF0, + 0xA3, 0xA2, 0xA7, 0x44, 0xF0, 0xA3, 0xAA, 0x8D, + 0x44, 0xF0, 0xA3, 0xAB, 0xBA, 0x44, 0xF0, 0xA3, + 0xB2, 0xBC, 0x44, 0xF0, 0xA3, 0xB4, 0x9E, 0x44, + 0xF0, 0xA3, 0xBB, 0x91, 0x44, 0xF0, 0xA3, 0xBD, + // Bytes 1840 - 187f + 0x9E, 0x44, 0xF0, 0xA3, 0xBE, 0x8E, 0x44, 0xF0, + 0xA4, 0x89, 0xA3, 0x44, 0xF0, 0xA4, 0x8B, 0xAE, + 0x44, 0xF0, 0xA4, 0x8E, 0xAB, 0x44, 0xF0, 0xA4, + 0x98, 0x88, 0x44, 0xF0, 0xA4, 0x9C, 0xB5, 0x44, + 0xF0, 0xA4, 0xA0, 0x94, 0x44, 0xF0, 0xA4, 0xB0, + 0xB6, 0x44, 0xF0, 0xA4, 0xB2, 0x92, 0x44, 0xF0, + 0xA4, 0xBE, 0xA1, 0x44, 0xF0, 0xA4, 0xBE, 0xB8, + 0x44, 0xF0, 0xA5, 0x81, 0x84, 0x44, 0xF0, 0xA5, + // Bytes 1880 - 18bf + 0x83, 0xB2, 0x44, 0xF0, 0xA5, 0x83, 0xB3, 0x44, + 0xF0, 0xA5, 0x84, 0x99, 0x44, 0xF0, 0xA5, 0x84, + 0xB3, 0x44, 0xF0, 0xA5, 0x89, 0x89, 0x44, 0xF0, + 0xA5, 0x90, 0x9D, 0x44, 0xF0, 0xA5, 0x98, 0xA6, + 0x44, 0xF0, 0xA5, 0x9A, 0x9A, 0x44, 0xF0, 0xA5, + 0x9B, 0x85, 0x44, 0xF0, 0xA5, 0xA5, 0xBC, 0x44, + 0xF0, 0xA5, 0xAA, 0xA7, 0x44, 0xF0, 0xA5, 0xAE, + 0xAB, 0x44, 0xF0, 0xA5, 0xB2, 0x80, 0x44, 0xF0, + // Bytes 18c0 - 18ff + 0xA5, 0xB3, 0x90, 0x44, 0xF0, 0xA5, 0xBE, 0x86, + 0x44, 0xF0, 0xA6, 0x87, 0x9A, 0x44, 0xF0, 0xA6, + 0x88, 0xA8, 0x44, 0xF0, 0xA6, 0x89, 0x87, 0x44, + 0xF0, 0xA6, 0x8B, 0x99, 0x44, 0xF0, 0xA6, 0x8C, + 0xBE, 0x44, 0xF0, 0xA6, 0x93, 0x9A, 0x44, 0xF0, + 0xA6, 0x94, 0xA3, 0x44, 0xF0, 0xA6, 0x96, 0xA8, + 0x44, 0xF0, 0xA6, 0x9E, 0xA7, 0x44, 0xF0, 0xA6, + 0x9E, 0xB5, 0x44, 0xF0, 0xA6, 0xAC, 0xBC, 0x44, + // Bytes 1900 - 193f + 0xF0, 0xA6, 0xB0, 0xB6, 0x44, 0xF0, 0xA6, 0xB3, + 0x95, 0x44, 0xF0, 0xA6, 0xB5, 0xAB, 0x44, 0xF0, + 0xA6, 0xBC, 0xAC, 0x44, 0xF0, 0xA6, 0xBE, 0xB1, + 0x44, 0xF0, 0xA7, 0x83, 0x92, 0x44, 0xF0, 0xA7, + 0x8F, 0x8A, 0x44, 0xF0, 0xA7, 0x99, 0xA7, 0x44, + 0xF0, 0xA7, 0xA2, 0xAE, 0x44, 0xF0, 0xA7, 0xA5, + 0xA6, 0x44, 0xF0, 0xA7, 0xB2, 0xA8, 0x44, 0xF0, + 0xA7, 0xBB, 0x93, 0x44, 0xF0, 0xA7, 0xBC, 0xAF, + // Bytes 1940 - 197f + 0x44, 0xF0, 0xA8, 0x97, 0x92, 0x44, 0xF0, 0xA8, + 0x97, 0xAD, 0x44, 0xF0, 0xA8, 0x9C, 0xAE, 0x44, + 0xF0, 0xA8, 0xAF, 0xBA, 0x44, 0xF0, 0xA8, 0xB5, + 0xB7, 0x44, 0xF0, 0xA9, 0x85, 0x85, 0x44, 0xF0, + 0xA9, 0x87, 0x9F, 0x44, 0xF0, 0xA9, 0x88, 0x9A, + 0x44, 0xF0, 0xA9, 0x90, 0x8A, 0x44, 0xF0, 0xA9, + 0x92, 0x96, 0x44, 0xF0, 0xA9, 0x96, 0xB6, 0x44, + 0xF0, 0xA9, 0xAC, 0xB0, 0x44, 0xF0, 0xAA, 0x83, + // Bytes 1980 - 19bf + 0x8E, 0x44, 0xF0, 0xAA, 0x84, 0x85, 0x44, 0xF0, + 0xAA, 0x88, 0x8E, 0x44, 0xF0, 0xAA, 0x8A, 0x91, + 0x44, 0xF0, 0xAA, 0x8E, 0x92, 0x44, 0xF0, 0xAA, + 0x98, 0x80, 0x42, 0x21, 0x21, 0x42, 0x21, 0x3F, + 0x42, 0x2E, 0x2E, 0x42, 0x30, 0x2C, 0x42, 0x30, + 0x2E, 0x42, 0x31, 0x2C, 0x42, 0x31, 0x2E, 0x42, + 0x31, 0x30, 0x42, 0x31, 0x31, 0x42, 0x31, 0x32, + 0x42, 0x31, 0x33, 0x42, 0x31, 0x34, 0x42, 0x31, + // Bytes 19c0 - 19ff + 0x35, 0x42, 0x31, 0x36, 0x42, 0x31, 0x37, 0x42, + 0x31, 0x38, 0x42, 0x31, 0x39, 0x42, 0x32, 0x2C, + 0x42, 0x32, 0x2E, 0x42, 0x32, 0x30, 0x42, 0x32, + 0x31, 0x42, 0x32, 0x32, 0x42, 0x32, 0x33, 0x42, + 0x32, 0x34, 0x42, 0x32, 0x35, 0x42, 0x32, 0x36, + 0x42, 0x32, 0x37, 0x42, 0x32, 0x38, 0x42, 0x32, + 0x39, 0x42, 0x33, 0x2C, 0x42, 0x33, 0x2E, 0x42, + 0x33, 0x30, 0x42, 0x33, 0x31, 0x42, 0x33, 0x32, + // Bytes 1a00 - 1a3f + 0x42, 0x33, 0x33, 0x42, 0x33, 0x34, 0x42, 0x33, + 0x35, 0x42, 0x33, 0x36, 0x42, 0x33, 0x37, 0x42, + 0x33, 0x38, 0x42, 0x33, 0x39, 0x42, 0x34, 0x2C, + 0x42, 0x34, 0x2E, 0x42, 0x34, 0x30, 0x42, 0x34, + 0x31, 0x42, 0x34, 0x32, 0x42, 0x34, 0x33, 0x42, + 0x34, 0x34, 0x42, 0x34, 0x35, 0x42, 0x34, 0x36, + 0x42, 0x34, 0x37, 0x42, 0x34, 0x38, 0x42, 0x34, + 0x39, 0x42, 0x35, 0x2C, 0x42, 0x35, 0x2E, 0x42, + // Bytes 1a40 - 1a7f + 0x35, 0x30, 0x42, 0x36, 0x2C, 0x42, 0x36, 0x2E, + 0x42, 0x37, 0x2C, 0x42, 0x37, 0x2E, 0x42, 0x38, + 0x2C, 0x42, 0x38, 0x2E, 0x42, 0x39, 0x2C, 0x42, + 0x39, 0x2E, 0x42, 0x3D, 0x3D, 0x42, 0x3F, 0x21, + 0x42, 0x3F, 0x3F, 0x42, 0x41, 0x55, 0x42, 0x42, + 0x71, 0x42, 0x43, 0x44, 0x42, 0x44, 0x4A, 0x42, + 0x44, 0x5A, 0x42, 0x44, 0x7A, 0x42, 0x47, 0x42, + 0x42, 0x47, 0x79, 0x42, 0x48, 0x50, 0x42, 0x48, + // Bytes 1a80 - 1abf + 0x56, 0x42, 0x48, 0x67, 0x42, 0x48, 0x7A, 0x42, + 0x49, 0x49, 0x42, 0x49, 0x4A, 0x42, 0x49, 0x55, + 0x42, 0x49, 0x56, 0x42, 0x49, 0x58, 0x42, 0x4B, + 0x42, 0x42, 0x4B, 0x4B, 0x42, 0x4B, 0x4D, 0x42, + 0x4C, 0x4A, 0x42, 0x4C, 0x6A, 0x42, 0x4D, 0x42, + 0x42, 0x4D, 0x43, 0x42, 0x4D, 0x44, 0x42, 0x4D, + 0x52, 0x42, 0x4D, 0x56, 0x42, 0x4D, 0x57, 0x42, + 0x4E, 0x4A, 0x42, 0x4E, 0x6A, 0x42, 0x4E, 0x6F, + // Bytes 1ac0 - 1aff + 0x42, 0x50, 0x48, 0x42, 0x50, 0x52, 0x42, 0x50, + 0x61, 0x42, 0x52, 0x73, 0x42, 0x53, 0x44, 0x42, + 0x53, 0x4D, 0x42, 0x53, 0x53, 0x42, 0x53, 0x76, + 0x42, 0x54, 0x4D, 0x42, 0x56, 0x49, 0x42, 0x57, + 0x43, 0x42, 0x57, 0x5A, 0x42, 0x57, 0x62, 0x42, + 0x58, 0x49, 0x42, 0x63, 0x63, 0x42, 0x63, 0x64, + 0x42, 0x63, 0x6D, 0x42, 0x64, 0x42, 0x42, 0x64, + 0x61, 0x42, 0x64, 0x6C, 0x42, 0x64, 0x6D, 0x42, + // Bytes 1b00 - 1b3f + 0x64, 0x7A, 0x42, 0x65, 0x56, 0x42, 0x66, 0x66, + 0x42, 0x66, 0x69, 0x42, 0x66, 0x6C, 0x42, 0x66, + 0x6D, 0x42, 0x68, 0x61, 0x42, 0x69, 0x69, 0x42, + 0x69, 0x6A, 0x42, 0x69, 0x6E, 0x42, 0x69, 0x76, + 0x42, 0x69, 0x78, 0x42, 0x6B, 0x41, 0x42, 0x6B, + 0x56, 0x42, 0x6B, 0x57, 0x42, 0x6B, 0x67, 0x42, + 0x6B, 0x6C, 0x42, 0x6B, 0x6D, 0x42, 0x6B, 0x74, + 0x42, 0x6C, 0x6A, 0x42, 0x6C, 0x6D, 0x42, 0x6C, + // Bytes 1b40 - 1b7f + 0x6E, 0x42, 0x6C, 0x78, 0x42, 0x6D, 0x32, 0x42, + 0x6D, 0x33, 0x42, 0x6D, 0x41, 0x42, 0x6D, 0x56, + 0x42, 0x6D, 0x57, 0x42, 0x6D, 0x62, 0x42, 0x6D, + 0x67, 0x42, 0x6D, 0x6C, 0x42, 0x6D, 0x6D, 0x42, + 0x6D, 0x73, 0x42, 0x6E, 0x41, 0x42, 0x6E, 0x46, + 0x42, 0x6E, 0x56, 0x42, 0x6E, 0x57, 0x42, 0x6E, + 0x6A, 0x42, 0x6E, 0x6D, 0x42, 0x6E, 0x73, 0x42, + 0x6F, 0x56, 0x42, 0x70, 0x41, 0x42, 0x70, 0x46, + // Bytes 1b80 - 1bbf + 0x42, 0x70, 0x56, 0x42, 0x70, 0x57, 0x42, 0x70, + 0x63, 0x42, 0x70, 0x73, 0x42, 0x73, 0x72, 0x42, + 0x73, 0x74, 0x42, 0x76, 0x69, 0x42, 0x78, 0x69, + 0x43, 0x28, 0x31, 0x29, 0x43, 0x28, 0x32, 0x29, + 0x43, 0x28, 0x33, 0x29, 0x43, 0x28, 0x34, 0x29, + 0x43, 0x28, 0x35, 0x29, 0x43, 0x28, 0x36, 0x29, + 0x43, 0x28, 0x37, 0x29, 0x43, 0x28, 0x38, 0x29, + 0x43, 0x28, 0x39, 0x29, 0x43, 0x28, 0x41, 0x29, + // Bytes 1bc0 - 1bff + 0x43, 0x28, 0x42, 0x29, 0x43, 0x28, 0x43, 0x29, + 0x43, 0x28, 0x44, 0x29, 0x43, 0x28, 0x45, 0x29, + 0x43, 0x28, 0x46, 0x29, 0x43, 0x28, 0x47, 0x29, + 0x43, 0x28, 0x48, 0x29, 0x43, 0x28, 0x49, 0x29, + 0x43, 0x28, 0x4A, 0x29, 0x43, 0x28, 0x4B, 0x29, + 0x43, 0x28, 0x4C, 0x29, 0x43, 0x28, 0x4D, 0x29, + 0x43, 0x28, 0x4E, 0x29, 0x43, 0x28, 0x4F, 0x29, + 0x43, 0x28, 0x50, 0x29, 0x43, 0x28, 0x51, 0x29, + // Bytes 1c00 - 1c3f + 0x43, 0x28, 0x52, 0x29, 0x43, 0x28, 0x53, 0x29, + 0x43, 0x28, 0x54, 0x29, 0x43, 0x28, 0x55, 0x29, + 0x43, 0x28, 0x56, 0x29, 0x43, 0x28, 0x57, 0x29, + 0x43, 0x28, 0x58, 0x29, 0x43, 0x28, 0x59, 0x29, + 0x43, 0x28, 0x5A, 0x29, 0x43, 0x28, 0x61, 0x29, + 0x43, 0x28, 0x62, 0x29, 0x43, 0x28, 0x63, 0x29, + 0x43, 0x28, 0x64, 0x29, 0x43, 0x28, 0x65, 0x29, + 0x43, 0x28, 0x66, 0x29, 0x43, 0x28, 0x67, 0x29, + // Bytes 1c40 - 1c7f + 0x43, 0x28, 0x68, 0x29, 0x43, 0x28, 0x69, 0x29, + 0x43, 0x28, 0x6A, 0x29, 0x43, 0x28, 0x6B, 0x29, + 0x43, 0x28, 0x6C, 0x29, 0x43, 0x28, 0x6D, 0x29, + 0x43, 0x28, 0x6E, 0x29, 0x43, 0x28, 0x6F, 0x29, + 0x43, 0x28, 0x70, 0x29, 0x43, 0x28, 0x71, 0x29, + 0x43, 0x28, 0x72, 0x29, 0x43, 0x28, 0x73, 0x29, + 0x43, 0x28, 0x74, 0x29, 0x43, 0x28, 0x75, 0x29, + 0x43, 0x28, 0x76, 0x29, 0x43, 0x28, 0x77, 0x29, + // Bytes 1c80 - 1cbf + 0x43, 0x28, 0x78, 0x29, 0x43, 0x28, 0x79, 0x29, + 0x43, 0x28, 0x7A, 0x29, 0x43, 0x2E, 0x2E, 0x2E, + 0x43, 0x31, 0x30, 0x2E, 0x43, 0x31, 0x31, 0x2E, + 0x43, 0x31, 0x32, 0x2E, 0x43, 0x31, 0x33, 0x2E, + 0x43, 0x31, 0x34, 0x2E, 0x43, 0x31, 0x35, 0x2E, + 0x43, 0x31, 0x36, 0x2E, 0x43, 0x31, 0x37, 0x2E, + 0x43, 0x31, 0x38, 0x2E, 0x43, 0x31, 0x39, 0x2E, + 0x43, 0x32, 0x30, 0x2E, 0x43, 0x3A, 0x3A, 0x3D, + // Bytes 1cc0 - 1cff + 0x43, 0x3D, 0x3D, 0x3D, 0x43, 0x43, 0x6F, 0x2E, + 0x43, 0x46, 0x41, 0x58, 0x43, 0x47, 0x48, 0x7A, + 0x43, 0x47, 0x50, 0x61, 0x43, 0x49, 0x49, 0x49, + 0x43, 0x4C, 0x54, 0x44, 0x43, 0x4C, 0xC2, 0xB7, + 0x43, 0x4D, 0x48, 0x7A, 0x43, 0x4D, 0x50, 0x61, + 0x43, 0x4D, 0xCE, 0xA9, 0x43, 0x50, 0x50, 0x4D, + 0x43, 0x50, 0x50, 0x56, 0x43, 0x50, 0x54, 0x45, + 0x43, 0x54, 0x45, 0x4C, 0x43, 0x54, 0x48, 0x7A, + // Bytes 1d00 - 1d3f + 0x43, 0x56, 0x49, 0x49, 0x43, 0x58, 0x49, 0x49, + 0x43, 0x61, 0x2F, 0x63, 0x43, 0x61, 0x2F, 0x73, + 0x43, 0x61, 0xCA, 0xBE, 0x43, 0x62, 0x61, 0x72, + 0x43, 0x63, 0x2F, 0x6F, 0x43, 0x63, 0x2F, 0x75, + 0x43, 0x63, 0x61, 0x6C, 0x43, 0x63, 0x6D, 0x32, + 0x43, 0x63, 0x6D, 0x33, 0x43, 0x64, 0x6D, 0x32, + 0x43, 0x64, 0x6D, 0x33, 0x43, 0x65, 0x72, 0x67, + 0x43, 0x66, 0x66, 0x69, 0x43, 0x66, 0x66, 0x6C, + // Bytes 1d40 - 1d7f + 0x43, 0x67, 0x61, 0x6C, 0x43, 0x68, 0x50, 0x61, + 0x43, 0x69, 0x69, 0x69, 0x43, 0x6B, 0x48, 0x7A, + 0x43, 0x6B, 0x50, 0x61, 0x43, 0x6B, 0x6D, 0x32, + 0x43, 0x6B, 0x6D, 0x33, 0x43, 0x6B, 0xCE, 0xA9, + 0x43, 0x6C, 0x6F, 0x67, 0x43, 0x6C, 0xC2, 0xB7, + 0x43, 0x6D, 0x69, 0x6C, 0x43, 0x6D, 0x6D, 0x32, + 0x43, 0x6D, 0x6D, 0x33, 0x43, 0x6D, 0x6F, 0x6C, + 0x43, 0x72, 0x61, 0x64, 0x43, 0x76, 0x69, 0x69, + // Bytes 1d80 - 1dbf + 0x43, 0x78, 0x69, 0x69, 0x43, 0xC2, 0xB0, 0x43, + 0x43, 0xC2, 0xB0, 0x46, 0x43, 0xCA, 0xBC, 0x6E, + 0x43, 0xCE, 0xBC, 0x41, 0x43, 0xCE, 0xBC, 0x46, + 0x43, 0xCE, 0xBC, 0x56, 0x43, 0xCE, 0xBC, 0x57, + 0x43, 0xCE, 0xBC, 0x67, 0x43, 0xCE, 0xBC, 0x6C, + 0x43, 0xCE, 0xBC, 0x6D, 0x43, 0xCE, 0xBC, 0x73, + 0x44, 0x28, 0x31, 0x30, 0x29, 0x44, 0x28, 0x31, + 0x31, 0x29, 0x44, 0x28, 0x31, 0x32, 0x29, 0x44, + // Bytes 1dc0 - 1dff + 0x28, 0x31, 0x33, 0x29, 0x44, 0x28, 0x31, 0x34, + 0x29, 0x44, 0x28, 0x31, 0x35, 0x29, 0x44, 0x28, + 0x31, 0x36, 0x29, 0x44, 0x28, 0x31, 0x37, 0x29, + 0x44, 0x28, 0x31, 0x38, 0x29, 0x44, 0x28, 0x31, + 0x39, 0x29, 0x44, 0x28, 0x32, 0x30, 0x29, 0x44, + 0x30, 0xE7, 0x82, 0xB9, 0x44, 0x31, 0xE2, 0x81, + 0x84, 0x44, 0x31, 0xE6, 0x97, 0xA5, 0x44, 0x31, + 0xE6, 0x9C, 0x88, 0x44, 0x31, 0xE7, 0x82, 0xB9, + // Bytes 1e00 - 1e3f + 0x44, 0x32, 0xE6, 0x97, 0xA5, 0x44, 0x32, 0xE6, + 0x9C, 0x88, 0x44, 0x32, 0xE7, 0x82, 0xB9, 0x44, + 0x33, 0xE6, 0x97, 0xA5, 0x44, 0x33, 0xE6, 0x9C, + 0x88, 0x44, 0x33, 0xE7, 0x82, 0xB9, 0x44, 0x34, + 0xE6, 0x97, 0xA5, 0x44, 0x34, 0xE6, 0x9C, 0x88, + 0x44, 0x34, 0xE7, 0x82, 0xB9, 0x44, 0x35, 0xE6, + 0x97, 0xA5, 0x44, 0x35, 0xE6, 0x9C, 0x88, 0x44, + 0x35, 0xE7, 0x82, 0xB9, 0x44, 0x36, 0xE6, 0x97, + // Bytes 1e40 - 1e7f + 0xA5, 0x44, 0x36, 0xE6, 0x9C, 0x88, 0x44, 0x36, + 0xE7, 0x82, 0xB9, 0x44, 0x37, 0xE6, 0x97, 0xA5, + 0x44, 0x37, 0xE6, 0x9C, 0x88, 0x44, 0x37, 0xE7, + 0x82, 0xB9, 0x44, 0x38, 0xE6, 0x97, 0xA5, 0x44, + 0x38, 0xE6, 0x9C, 0x88, 0x44, 0x38, 0xE7, 0x82, + 0xB9, 0x44, 0x39, 0xE6, 0x97, 0xA5, 0x44, 0x39, + 0xE6, 0x9C, 0x88, 0x44, 0x39, 0xE7, 0x82, 0xB9, + 0x44, 0x56, 0x49, 0x49, 0x49, 0x44, 0x61, 0x2E, + // Bytes 1e80 - 1ebf + 0x6D, 0x2E, 0x44, 0x6B, 0x63, 0x61, 0x6C, 0x44, + 0x70, 0x2E, 0x6D, 0x2E, 0x44, 0x76, 0x69, 0x69, + 0x69, 0x44, 0xD5, 0xA5, 0xD6, 0x82, 0x44, 0xD5, + 0xB4, 0xD5, 0xA5, 0x44, 0xD5, 0xB4, 0xD5, 0xAB, + 0x44, 0xD5, 0xB4, 0xD5, 0xAD, 0x44, 0xD5, 0xB4, + 0xD5, 0xB6, 0x44, 0xD5, 0xBE, 0xD5, 0xB6, 0x44, + 0xD7, 0x90, 0xD7, 0x9C, 0x44, 0xD8, 0xA7, 0xD9, + 0xB4, 0x44, 0xD8, 0xA8, 0xD8, 0xAC, 0x44, 0xD8, + // Bytes 1ec0 - 1eff + 0xA8, 0xD8, 0xAD, 0x44, 0xD8, 0xA8, 0xD8, 0xAE, + 0x44, 0xD8, 0xA8, 0xD8, 0xB1, 0x44, 0xD8, 0xA8, + 0xD8, 0xB2, 0x44, 0xD8, 0xA8, 0xD9, 0x85, 0x44, + 0xD8, 0xA8, 0xD9, 0x86, 0x44, 0xD8, 0xA8, 0xD9, + 0x87, 0x44, 0xD8, 0xA8, 0xD9, 0x89, 0x44, 0xD8, + 0xA8, 0xD9, 0x8A, 0x44, 0xD8, 0xAA, 0xD8, 0xAC, + 0x44, 0xD8, 0xAA, 0xD8, 0xAD, 0x44, 0xD8, 0xAA, + 0xD8, 0xAE, 0x44, 0xD8, 0xAA, 0xD8, 0xB1, 0x44, + // Bytes 1f00 - 1f3f + 0xD8, 0xAA, 0xD8, 0xB2, 0x44, 0xD8, 0xAA, 0xD9, + 0x85, 0x44, 0xD8, 0xAA, 0xD9, 0x86, 0x44, 0xD8, + 0xAA, 0xD9, 0x87, 0x44, 0xD8, 0xAA, 0xD9, 0x89, + 0x44, 0xD8, 0xAA, 0xD9, 0x8A, 0x44, 0xD8, 0xAB, + 0xD8, 0xAC, 0x44, 0xD8, 0xAB, 0xD8, 0xB1, 0x44, + 0xD8, 0xAB, 0xD8, 0xB2, 0x44, 0xD8, 0xAB, 0xD9, + 0x85, 0x44, 0xD8, 0xAB, 0xD9, 0x86, 0x44, 0xD8, + 0xAB, 0xD9, 0x87, 0x44, 0xD8, 0xAB, 0xD9, 0x89, + // Bytes 1f40 - 1f7f + 0x44, 0xD8, 0xAB, 0xD9, 0x8A, 0x44, 0xD8, 0xAC, + 0xD8, 0xAD, 0x44, 0xD8, 0xAC, 0xD9, 0x85, 0x44, + 0xD8, 0xAC, 0xD9, 0x89, 0x44, 0xD8, 0xAC, 0xD9, + 0x8A, 0x44, 0xD8, 0xAD, 0xD8, 0xAC, 0x44, 0xD8, + 0xAD, 0xD9, 0x85, 0x44, 0xD8, 0xAD, 0xD9, 0x89, + 0x44, 0xD8, 0xAD, 0xD9, 0x8A, 0x44, 0xD8, 0xAE, + 0xD8, 0xAC, 0x44, 0xD8, 0xAE, 0xD8, 0xAD, 0x44, + 0xD8, 0xAE, 0xD9, 0x85, 0x44, 0xD8, 0xAE, 0xD9, + // Bytes 1f80 - 1fbf + 0x89, 0x44, 0xD8, 0xAE, 0xD9, 0x8A, 0x44, 0xD8, + 0xB3, 0xD8, 0xAC, 0x44, 0xD8, 0xB3, 0xD8, 0xAD, + 0x44, 0xD8, 0xB3, 0xD8, 0xAE, 0x44, 0xD8, 0xB3, + 0xD8, 0xB1, 0x44, 0xD8, 0xB3, 0xD9, 0x85, 0x44, + 0xD8, 0xB3, 0xD9, 0x87, 0x44, 0xD8, 0xB3, 0xD9, + 0x89, 0x44, 0xD8, 0xB3, 0xD9, 0x8A, 0x44, 0xD8, + 0xB4, 0xD8, 0xAC, 0x44, 0xD8, 0xB4, 0xD8, 0xAD, + 0x44, 0xD8, 0xB4, 0xD8, 0xAE, 0x44, 0xD8, 0xB4, + // Bytes 1fc0 - 1fff + 0xD8, 0xB1, 0x44, 0xD8, 0xB4, 0xD9, 0x85, 0x44, + 0xD8, 0xB4, 0xD9, 0x87, 0x44, 0xD8, 0xB4, 0xD9, + 0x89, 0x44, 0xD8, 0xB4, 0xD9, 0x8A, 0x44, 0xD8, + 0xB5, 0xD8, 0xAD, 0x44, 0xD8, 0xB5, 0xD8, 0xAE, + 0x44, 0xD8, 0xB5, 0xD8, 0xB1, 0x44, 0xD8, 0xB5, + 0xD9, 0x85, 0x44, 0xD8, 0xB5, 0xD9, 0x89, 0x44, + 0xD8, 0xB5, 0xD9, 0x8A, 0x44, 0xD8, 0xB6, 0xD8, + 0xAC, 0x44, 0xD8, 0xB6, 0xD8, 0xAD, 0x44, 0xD8, + // Bytes 2000 - 203f + 0xB6, 0xD8, 0xAE, 0x44, 0xD8, 0xB6, 0xD8, 0xB1, + 0x44, 0xD8, 0xB6, 0xD9, 0x85, 0x44, 0xD8, 0xB6, + 0xD9, 0x89, 0x44, 0xD8, 0xB6, 0xD9, 0x8A, 0x44, + 0xD8, 0xB7, 0xD8, 0xAD, 0x44, 0xD8, 0xB7, 0xD9, + 0x85, 0x44, 0xD8, 0xB7, 0xD9, 0x89, 0x44, 0xD8, + 0xB7, 0xD9, 0x8A, 0x44, 0xD8, 0xB8, 0xD9, 0x85, + 0x44, 0xD8, 0xB9, 0xD8, 0xAC, 0x44, 0xD8, 0xB9, + 0xD9, 0x85, 0x44, 0xD8, 0xB9, 0xD9, 0x89, 0x44, + // Bytes 2040 - 207f + 0xD8, 0xB9, 0xD9, 0x8A, 0x44, 0xD8, 0xBA, 0xD8, + 0xAC, 0x44, 0xD8, 0xBA, 0xD9, 0x85, 0x44, 0xD8, + 0xBA, 0xD9, 0x89, 0x44, 0xD8, 0xBA, 0xD9, 0x8A, + 0x44, 0xD9, 0x81, 0xD8, 0xAC, 0x44, 0xD9, 0x81, + 0xD8, 0xAD, 0x44, 0xD9, 0x81, 0xD8, 0xAE, 0x44, + 0xD9, 0x81, 0xD9, 0x85, 0x44, 0xD9, 0x81, 0xD9, + 0x89, 0x44, 0xD9, 0x81, 0xD9, 0x8A, 0x44, 0xD9, + 0x82, 0xD8, 0xAD, 0x44, 0xD9, 0x82, 0xD9, 0x85, + // Bytes 2080 - 20bf + 0x44, 0xD9, 0x82, 0xD9, 0x89, 0x44, 0xD9, 0x82, + 0xD9, 0x8A, 0x44, 0xD9, 0x83, 0xD8, 0xA7, 0x44, + 0xD9, 0x83, 0xD8, 0xAC, 0x44, 0xD9, 0x83, 0xD8, + 0xAD, 0x44, 0xD9, 0x83, 0xD8, 0xAE, 0x44, 0xD9, + 0x83, 0xD9, 0x84, 0x44, 0xD9, 0x83, 0xD9, 0x85, + 0x44, 0xD9, 0x83, 0xD9, 0x89, 0x44, 0xD9, 0x83, + 0xD9, 0x8A, 0x44, 0xD9, 0x84, 0xD8, 0xA7, 0x44, + 0xD9, 0x84, 0xD8, 0xAC, 0x44, 0xD9, 0x84, 0xD8, + // Bytes 20c0 - 20ff + 0xAD, 0x44, 0xD9, 0x84, 0xD8, 0xAE, 0x44, 0xD9, + 0x84, 0xD9, 0x85, 0x44, 0xD9, 0x84, 0xD9, 0x87, + 0x44, 0xD9, 0x84, 0xD9, 0x89, 0x44, 0xD9, 0x84, + 0xD9, 0x8A, 0x44, 0xD9, 0x85, 0xD8, 0xA7, 0x44, + 0xD9, 0x85, 0xD8, 0xAC, 0x44, 0xD9, 0x85, 0xD8, + 0xAD, 0x44, 0xD9, 0x85, 0xD8, 0xAE, 0x44, 0xD9, + 0x85, 0xD9, 0x85, 0x44, 0xD9, 0x85, 0xD9, 0x89, + 0x44, 0xD9, 0x85, 0xD9, 0x8A, 0x44, 0xD9, 0x86, + // Bytes 2100 - 213f + 0xD8, 0xAC, 0x44, 0xD9, 0x86, 0xD8, 0xAD, 0x44, + 0xD9, 0x86, 0xD8, 0xAE, 0x44, 0xD9, 0x86, 0xD8, + 0xB1, 0x44, 0xD9, 0x86, 0xD8, 0xB2, 0x44, 0xD9, + 0x86, 0xD9, 0x85, 0x44, 0xD9, 0x86, 0xD9, 0x86, + 0x44, 0xD9, 0x86, 0xD9, 0x87, 0x44, 0xD9, 0x86, + 0xD9, 0x89, 0x44, 0xD9, 0x86, 0xD9, 0x8A, 0x44, + 0xD9, 0x87, 0xD8, 0xAC, 0x44, 0xD9, 0x87, 0xD9, + 0x85, 0x44, 0xD9, 0x87, 0xD9, 0x89, 0x44, 0xD9, + // Bytes 2140 - 217f + 0x87, 0xD9, 0x8A, 0x44, 0xD9, 0x88, 0xD9, 0xB4, + 0x44, 0xD9, 0x8A, 0xD8, 0xAC, 0x44, 0xD9, 0x8A, + 0xD8, 0xAD, 0x44, 0xD9, 0x8A, 0xD8, 0xAE, 0x44, + 0xD9, 0x8A, 0xD8, 0xB1, 0x44, 0xD9, 0x8A, 0xD8, + 0xB2, 0x44, 0xD9, 0x8A, 0xD9, 0x85, 0x44, 0xD9, + 0x8A, 0xD9, 0x86, 0x44, 0xD9, 0x8A, 0xD9, 0x87, + 0x44, 0xD9, 0x8A, 0xD9, 0x89, 0x44, 0xD9, 0x8A, + 0xD9, 0x8A, 0x44, 0xD9, 0x8A, 0xD9, 0xB4, 0x44, + // Bytes 2180 - 21bf + 0xDB, 0x87, 0xD9, 0xB4, 0x45, 0x28, 0xE1, 0x84, + 0x80, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x82, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x83, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x85, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x86, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x87, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x89, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x8B, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x8C, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x8E, 0x29, + // Bytes 21c0 - 21ff + 0x45, 0x28, 0xE1, 0x84, 0x8F, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x90, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x91, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x92, 0x29, + 0x45, 0x28, 0xE4, 0xB8, 0x80, 0x29, 0x45, 0x28, + 0xE4, 0xB8, 0x83, 0x29, 0x45, 0x28, 0xE4, 0xB8, + 0x89, 0x29, 0x45, 0x28, 0xE4, 0xB9, 0x9D, 0x29, + 0x45, 0x28, 0xE4, 0xBA, 0x8C, 0x29, 0x45, 0x28, + 0xE4, 0xBA, 0x94, 0x29, 0x45, 0x28, 0xE4, 0xBB, + // Bytes 2200 - 223f + 0xA3, 0x29, 0x45, 0x28, 0xE4, 0xBC, 0x81, 0x29, + 0x45, 0x28, 0xE4, 0xBC, 0x91, 0x29, 0x45, 0x28, + 0xE5, 0x85, 0xAB, 0x29, 0x45, 0x28, 0xE5, 0x85, + 0xAD, 0x29, 0x45, 0x28, 0xE5, 0x8A, 0xB4, 0x29, + 0x45, 0x28, 0xE5, 0x8D, 0x81, 0x29, 0x45, 0x28, + 0xE5, 0x8D, 0x94, 0x29, 0x45, 0x28, 0xE5, 0x90, + 0x8D, 0x29, 0x45, 0x28, 0xE5, 0x91, 0xBC, 0x29, + 0x45, 0x28, 0xE5, 0x9B, 0x9B, 0x29, 0x45, 0x28, + // Bytes 2240 - 227f + 0xE5, 0x9C, 0x9F, 0x29, 0x45, 0x28, 0xE5, 0xAD, + 0xA6, 0x29, 0x45, 0x28, 0xE6, 0x97, 0xA5, 0x29, + 0x45, 0x28, 0xE6, 0x9C, 0x88, 0x29, 0x45, 0x28, + 0xE6, 0x9C, 0x89, 0x29, 0x45, 0x28, 0xE6, 0x9C, + 0xA8, 0x29, 0x45, 0x28, 0xE6, 0xA0, 0xAA, 0x29, + 0x45, 0x28, 0xE6, 0xB0, 0xB4, 0x29, 0x45, 0x28, + 0xE7, 0x81, 0xAB, 0x29, 0x45, 0x28, 0xE7, 0x89, + 0xB9, 0x29, 0x45, 0x28, 0xE7, 0x9B, 0xA3, 0x29, + // Bytes 2280 - 22bf + 0x45, 0x28, 0xE7, 0xA4, 0xBE, 0x29, 0x45, 0x28, + 0xE7, 0xA5, 0x9D, 0x29, 0x45, 0x28, 0xE7, 0xA5, + 0xAD, 0x29, 0x45, 0x28, 0xE8, 0x87, 0xAA, 0x29, + 0x45, 0x28, 0xE8, 0x87, 0xB3, 0x29, 0x45, 0x28, + 0xE8, 0xB2, 0xA1, 0x29, 0x45, 0x28, 0xE8, 0xB3, + 0x87, 0x29, 0x45, 0x28, 0xE9, 0x87, 0x91, 0x29, + 0x45, 0x30, 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x31, 0x30, 0xE6, + // Bytes 22c0 - 22ff + 0x9C, 0x88, 0x45, 0x31, 0x30, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x31, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x31, 0xE6, 0x9C, 0x88, 0x45, 0x31, 0x31, 0xE7, + 0x82, 0xB9, 0x45, 0x31, 0x32, 0xE6, 0x97, 0xA5, + 0x45, 0x31, 0x32, 0xE6, 0x9C, 0x88, 0x45, 0x31, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x31, + // Bytes 2300 - 233f + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x35, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x36, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x36, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x37, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x37, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x38, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x39, 0xE7, 0x82, 0xB9, + // Bytes 2340 - 237f + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x32, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x34, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x35, + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x36, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x37, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x38, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x39, + 0x45, 0x32, 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x30, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x31, 0xE6, + // Bytes 2380 - 23bf + 0x97, 0xA5, 0x45, 0x32, 0x31, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x32, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x36, 0xE6, 0x97, 0xA5, + 0x45, 0x32, 0x37, 0xE6, 0x97, 0xA5, 0x45, 0x32, + // Bytes 23c0 - 23ff + 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x32, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0xE2, 0x81, 0x84, 0x33, + 0x45, 0x32, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x33, 0x31, 0xE6, + 0x97, 0xA5, 0x45, 0x33, 0xE2, 0x81, 0x84, 0x34, + 0x45, 0x33, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x34, 0xE2, 0x81, + 0x84, 0x35, 0x45, 0x35, 0xE2, 0x81, 0x84, 0x36, + // Bytes 2400 - 243f + 0x45, 0x35, 0xE2, 0x81, 0x84, 0x38, 0x45, 0x37, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x41, 0xE2, 0x88, + 0x95, 0x6D, 0x45, 0x56, 0xE2, 0x88, 0x95, 0x6D, + 0x45, 0x6D, 0xE2, 0x88, 0x95, 0x73, 0x46, 0x31, + 0xE2, 0x81, 0x84, 0x31, 0x30, 0x46, 0x43, 0xE2, + 0x88, 0x95, 0x6B, 0x67, 0x46, 0x6D, 0xE2, 0x88, + 0x95, 0x73, 0x32, 0x46, 0xD8, 0xA8, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xA8, 0xD8, 0xAE, 0xD9, + // Bytes 2440 - 247f + 0x8A, 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x85, + 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x89, 0x46, + 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAA, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, 0xD8, 0xAA, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, + 0xD9, 0x89, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, 0xD9, + 0x8A, 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAC, + // Bytes 2480 - 24bf + 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAD, 0x46, + 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAE, 0x46, 0xD8, + 0xAA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAA, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD8, 0xAC, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x89, + 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + // Bytes 24c0 - 24ff + 0xD8, 0xAD, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAD, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAD, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB3, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, 0xD8, 0xAC, + 0xD9, 0x89, 0x46, 0xD8, 0xB3, 0xD8, 0xAD, 0xD8, + 0xAC, 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x89, + 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x8A, 0x46, + 0xD8, 0xB3, 0xD9, 0x85, 0xD8, 0xAC, 0x46, 0xD8, + // Bytes 2500 - 253f + 0xB3, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, + 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, + 0xAC, 0xD9, 0x8A, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, + 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, 0xD9, + 0x8A, 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD8, 0xAE, + 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xB5, 0xD8, 0xAD, 0xD8, 0xAD, 0x46, 0xD8, + 0xB5, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD8, 0xB5, + // Bytes 2540 - 257f + 0xD9, 0x84, 0xD9, 0x89, 0x46, 0xD8, 0xB5, 0xD9, + 0x84, 0xDB, 0x92, 0x46, 0xD8, 0xB5, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, + 0x89, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, 0x8A, + 0x46, 0xD8, 0xB6, 0xD8, 0xAE, 0xD9, 0x85, 0x46, + 0xD8, 0xB7, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, + 0xB7, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB7, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB9, 0xD8, + // Bytes 2580 - 25bf + 0xAC, 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, + 0xBA, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x81, + 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x81, 0xD9, + 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x82, 0xD9, 0x84, + // Bytes 25c0 - 25ff + 0xDB, 0x92, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x85, + 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + 0xD9, 0x83, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + 0x83, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x84, + 0xD8, 0xAC, 0xD8, 0xAC, 0x46, 0xD9, 0x84, 0xD8, + 0xAC, 0xD9, 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAC, + 0xD9, 0x8A, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, + // Bytes 2600 - 263f + 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x89, + 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, + 0xD9, 0x84, 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, + 0x84, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD9, 0x84, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD9, 0x85, 0xD8, 0xAC, + 0xD8, 0xAE, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, + 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, 0x8A, + // Bytes 2640 - 267f + 0x46, 0xD9, 0x85, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, + 0xD9, 0x85, 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, + 0x85, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x85, + 0xD8, 0xAE, 0xD8, 0xAC, 0x46, 0xD9, 0x85, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAE, + 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD9, 0x85, 0xD9, + 0x8A, 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD8, 0xAD, + 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x85, 0x46, + // Bytes 2680 - 26bf + 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x89, 0x46, 0xD9, + 0x86, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x86, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, 0x86, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD9, 0x86, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD9, 0x87, 0xD9, 0x85, 0xD8, 0xAC, 0x46, + 0xD9, 0x87, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + // Bytes 26c0 - 26ff + 0x8A, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, + 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, + 0x85, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x85, + 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, + 0xA7, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAC, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAD, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAE, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xD8, 0xB1, 0x46, 0xD9, 0x8A, + // Bytes 2700 - 273f + 0xD9, 0x94, 0xD8, 0xB2, 0x46, 0xD9, 0x8A, 0xD9, + 0x94, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xD9, 0x86, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, + 0x87, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x88, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x89, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x8A, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xDB, 0x86, 0x46, 0xD9, 0x8A, + 0xD9, 0x94, 0xDB, 0x87, 0x46, 0xD9, 0x8A, 0xD9, + // Bytes 2740 - 277f + 0x94, 0xDB, 0x88, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xDB, 0x90, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xDB, + 0x95, 0x46, 0xE0, 0xB9, 0x8D, 0xE0, 0xB8, 0xB2, + 0x46, 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0x99, 0x46, + 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0xA1, 0x46, 0xE0, + 0xBB, 0x8D, 0xE0, 0xBA, 0xB2, 0x46, 0xE0, 0xBD, + 0x80, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, 0xBD, 0x82, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x8C, 0xE0, + // Bytes 2780 - 27bf + 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x91, 0xE0, 0xBE, + 0xB7, 0x46, 0xE0, 0xBD, 0x96, 0xE0, 0xBE, 0xB7, + 0x46, 0xE0, 0xBD, 0x9B, 0xE0, 0xBE, 0xB7, 0x46, + 0xE0, 0xBE, 0x90, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, + 0xBE, 0x92, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, + 0x9C, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA1, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA6, 0xE0, + 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xAB, 0xE0, 0xBE, + // Bytes 27c0 - 27ff + 0xB7, 0x46, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, + 0x46, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0x46, + 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x46, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x46, 0xE3, 0x81, + 0xBB, 0xE3, 0x81, 0x8B, 0x46, 0xE3, 0x82, 0x88, + 0xE3, 0x82, 0x8A, 0x46, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x82, + 0xB3, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0x88, + // Bytes 2800 - 283f + 0x46, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xB3, 0x46, + 0xE3, 0x83, 0x8A, 0xE3, 0x83, 0x8E, 0x46, 0xE3, + 0x83, 0x9B, 0xE3, 0x83, 0xB3, 0x46, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0x46, 0xE3, 0x83, 0xAA, + 0xE3, 0x83, 0xA9, 0x46, 0xE3, 0x83, 0xAC, 0xE3, + 0x83, 0xA0, 0x46, 0xE4, 0xBB, 0xA4, 0xE5, 0x92, + 0x8C, 0x46, 0xE5, 0xA4, 0xA7, 0xE6, 0xAD, 0xA3, + 0x46, 0xE5, 0xB9, 0xB3, 0xE6, 0x88, 0x90, 0x46, + // Bytes 2840 - 287f + 0xE6, 0x98, 0x8E, 0xE6, 0xB2, 0xBB, 0x46, 0xE6, + 0x98, 0xAD, 0xE5, 0x92, 0x8C, 0x47, 0x72, 0x61, + 0x64, 0xE2, 0x88, 0x95, 0x73, 0x47, 0xE3, 0x80, + 0x94, 0x53, 0xE3, 0x80, 0x95, 0x48, 0x28, 0xE1, + 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, 0x29, + 0x48, 0x28, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, + // Bytes 2880 - 28bf + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x86, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x87, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x89, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, + 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xAE, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, 0x29, + // Bytes 28c0 - 28ff + 0x48, 0x28, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x90, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x91, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x92, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x72, 0x61, 0x64, + 0xE2, 0x88, 0x95, 0x73, 0x32, 0x48, 0xD8, 0xA7, + 0xD9, 0x83, 0xD8, 0xA8, 0xD8, 0xB1, 0x48, 0xD8, + 0xA7, 0xD9, 0x84, 0xD9, 0x84, 0xD9, 0x87, 0x48, + // Bytes 2900 - 293f + 0xD8, 0xB1, 0xD8, 0xB3, 0xD9, 0x88, 0xD9, 0x84, + 0x48, 0xD8, 0xB1, 0xDB, 0x8C, 0xD8, 0xA7, 0xD9, + 0x84, 0x48, 0xD8, 0xB5, 0xD9, 0x84, 0xD8, 0xB9, + 0xD9, 0x85, 0x48, 0xD8, 0xB9, 0xD9, 0x84, 0xD9, + 0x8A, 0xD9, 0x87, 0x48, 0xD9, 0x85, 0xD8, 0xAD, + 0xD9, 0x85, 0xD8, 0xAF, 0x48, 0xD9, 0x88, 0xD8, + 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x49, 0xE2, 0x80, + 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0x49, + // Bytes 2940 - 297f + 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0xE2, 0x80, + 0xB5, 0x49, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, + 0xE2, 0x88, 0xAB, 0x49, 0xE2, 0x88, 0xAE, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x49, 0xE3, 0x80, + 0x94, 0xE4, 0xB8, 0x89, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x80, 0x94, 0xE4, 0xBA, 0x8C, 0xE3, 0x80, + 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, 0x8B, 0x9D, + 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, + // Bytes 2980 - 29bf + 0xAE, 0x89, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, + 0x94, 0xE6, 0x89, 0x93, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x80, 0x94, 0xE6, 0x95, 0x97, 0xE3, 0x80, + 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x9C, 0xAC, + 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE7, + 0x82, 0xB9, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, + 0x94, 0xE7, 0x9B, 0x97, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + // Bytes 29c0 - 29ff + 0xAB, 0x49, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x81, 0x49, 0xE3, 0x82, 0xA6, 0xE3, + 0x82, 0xA9, 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x82, + 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB9, 0x49, + 0xE3, 0x82, 0xAA, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xA0, 0x49, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0xAA, 0x49, 0xE3, 0x82, 0xB1, 0xE3, + 0x83, 0xBC, 0xE3, 0x82, 0xB9, 0x49, 0xE3, 0x82, + // Bytes 2a00 - 2a3f + 0xB3, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x8A, 0x49, + 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, + 0x81, 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0x49, 0xE3, 0x83, 0x86, 0xE3, + 0x82, 0x99, 0xE3, 0x82, 0xB7, 0x49, 0xE3, 0x83, + 0x88, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, + 0xE3, 0x83, 0x8E, 0xE3, 0x83, 0x83, 0xE3, 0x83, + 0x88, 0x49, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0xA4, + // Bytes 2a40 - 2a7f + 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, 0x92, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, + 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xB3, 0x49, + 0xE3, 0x83, 0x95, 0xE3, 0x83, 0xA9, 0xE3, 0x83, + 0xB3, 0x49, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xBD, 0x49, 0xE3, 0x83, 0x98, 0xE3, + 0x83, 0xAB, 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, + 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, 0x49, + // Bytes 2a80 - 2abf + 0xE3, 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xB3, 0x49, 0xE3, 0x83, 0x9E, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, 0x9E, 0xE3, + 0x83, 0x83, 0xE3, 0x83, 0x8F, 0x49, 0xE3, 0x83, + 0x9E, 0xE3, 0x83, 0xAB, 0xE3, 0x82, 0xAF, 0x49, + 0xE3, 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xAB, 0x49, 0xE3, 0x83, 0xA6, 0xE3, 0x82, 0xA2, + 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x83, 0xAF, 0xE3, + // Bytes 2ac0 - 2aff + 0x83, 0x83, 0xE3, 0x83, 0x88, 0x4C, 0xE2, 0x80, + 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, + 0x80, 0xB2, 0x4C, 0xE2, 0x88, 0xAB, 0xE2, 0x88, + 0xAB, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x4C, + 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xAB, 0xE3, 0x83, + 0x95, 0xE3, 0x82, 0xA1, 0x4C, 0xE3, 0x82, 0xA8, + 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xAB, 0xE3, 0x83, + 0xBC, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, + // Bytes 2b00 - 2b3f + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, 0x4C, 0xE3, + 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x9E, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, + 0x83, 0xA9, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, + 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x83, 0xAD, 0xE3, + 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, 0xE3, 0x82, + 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x8B, 0xE3, + 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x83, + // Bytes 2b40 - 2b7f + 0xA5, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0xA9, 0xE3, 0x83, 0xA0, 0x4C, 0xE3, 0x82, 0xAF, + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x8D, 0x4C, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0xA4, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, + 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, + 0xE3, 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x8F, 0xE3, + // Bytes 2b80 - 2bbf + 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x84, + 0x4C, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, + 0x95, 0xE3, 0x82, 0xA3, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x88, 0x4C, 0xE3, 0x83, 0x98, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xBF, 0x4C, + 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0x8B, 0xE3, 0x83, 0x92, 0x4C, 0xE3, 0x83, 0x98, + // Bytes 2bc0 - 2bff + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, 0xE3, 0x82, + 0xB9, 0x4C, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x88, 0x4C, 0xE3, + 0x83, 0x9E, 0xE3, 0x82, 0xA4, 0xE3, 0x82, 0xAF, + 0xE3, 0x83, 0xAD, 0x4C, 0xE3, 0x83, 0x9F, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, + 0x4C, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, + // Bytes 2c00 - 2c3f + 0xAA, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xAB, 0x4C, 0xE3, 0x83, 0xAB, 0xE3, 0x83, + 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0x4C, + 0xE6, 0xA0, 0xAA, 0xE5, 0xBC, 0x8F, 0xE4, 0xBC, + 0x9A, 0xE7, 0xA4, 0xBE, 0x4E, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x92, 0xE1, + 0x85, 0xAE, 0x29, 0x4F, 0xD8, 0xAC, 0xD9, 0x84, + 0x20, 0xD8, 0xAC, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, + // Bytes 2c40 - 2c7f + 0x84, 0xD9, 0x87, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, + 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xA2, 0x4F, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0xE3, 0x83, 0xAF, 0xE3, 0x83, 0x83, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xB5, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x81, 0xE3, 0x83, 0xBC, + // Bytes 2c80 - 2cbf + 0xE3, 0x83, 0xA0, 0x4F, 0xE3, 0x83, 0x8F, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAC, + 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x98, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0xBF, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x9B, 0xE3, + 0x82, 0x9A, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x83, 0x9E, 0xE3, + 0x83, 0xB3, 0xE3, 0x82, 0xB7, 0xE3, 0x83, 0xA7, + // Bytes 2cc0 - 2cff + 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xA1, 0xE3, + 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x88, + 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xAB, 0xE3, + 0x83, 0xBC, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xAB, 0x51, 0x28, 0xE1, 0x84, 0x8B, + 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x8C, 0xE1, 0x85, + 0xA5, 0xE1, 0x86, 0xAB, 0x29, 0x52, 0xE3, 0x82, + 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0xE3, + // Bytes 2d00 - 2d3f + 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, + 0x52, 0xE3, 0x82, 0xAD, 0xE3, 0x83, 0xAD, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, + 0xE3, 0x83, 0xA0, 0x52, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x52, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, + 0xE3, 0x83, 0xA0, 0xE3, 0x83, 0x88, 0xE3, 0x83, + // Bytes 2d40 - 2d7f + 0xB3, 0x52, 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, + 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0xAD, 0x52, 0xE3, 0x83, 0x8F, + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x82, + 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x88, 0x52, + 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, + 0xA2, 0xE3, 0x82, 0xB9, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xAB, 0x52, 0xE3, 0x83, 0x95, 0xE3, 0x82, + // Bytes 2d80 - 2dbf + 0x99, 0xE3, 0x83, 0x83, 0xE3, 0x82, 0xB7, 0xE3, + 0x82, 0xA7, 0xE3, 0x83, 0xAB, 0x52, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0x8F, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, + 0x52, 0xE3, 0x83, 0xAC, 0xE3, 0x83, 0xB3, 0xE3, + 0x83, 0x88, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xB3, 0x61, 0xD8, 0xB5, 0xD9, 0x84, + 0xD9, 0x89, 0x20, 0xD8, 0xA7, 0xD9, 0x84, 0xD9, + // Bytes 2dc0 - 2dff + 0x84, 0xD9, 0x87, 0x20, 0xD8, 0xB9, 0xD9, 0x84, + 0xD9, 0x8A, 0xD9, 0x87, 0x20, 0xD9, 0x88, 0xD8, + 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x06, 0xE0, 0xA7, + 0x87, 0xE0, 0xA6, 0xBE, 0x01, 0x06, 0xE0, 0xA7, + 0x87, 0xE0, 0xA7, 0x97, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAC, 0xBE, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAD, 0x96, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAD, 0x97, 0x01, 0x06, 0xE0, 0xAE, + // Bytes 2e00 - 2e3f + 0x92, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF, + 0x86, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xAF, + 0x86, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF, + 0x87, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xB2, + 0xBF, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3, + 0x86, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3, + 0x86, 0xE0, 0xB3, 0x96, 0x01, 0x06, 0xE0, 0xB5, + 0x86, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB5, + // Bytes 2e40 - 2e7f + 0x86, 0xE0, 0xB5, 0x97, 0x01, 0x06, 0xE0, 0xB5, + 0x87, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB7, + 0x99, 0xE0, 0xB7, 0x9F, 0x01, 0x06, 0xE1, 0x80, + 0xA5, 0xE1, 0x80, 0xAE, 0x01, 0x06, 0xE1, 0xAC, + 0x85, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x87, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x89, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x8B, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + // Bytes 2e80 - 2ebf + 0x8D, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x91, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBA, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBC, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBE, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBF, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAD, + 0x82, 0xE1, 0xAC, 0xB5, 0x01, 0x08, 0xF0, 0x91, + 0x84, 0xB1, 0xF0, 0x91, 0x84, 0xA7, 0x01, 0x08, + // Bytes 2ec0 - 2eff + 0xF0, 0x91, 0x84, 0xB2, 0xF0, 0x91, 0x84, 0xA7, + 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, 0xF0, 0x91, + 0x8C, 0xBE, 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, + 0xF0, 0x91, 0x8D, 0x97, 0x01, 0x08, 0xF0, 0x91, + 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xB0, 0x01, 0x08, + 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xBA, + 0x01, 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, + 0x92, 0xBD, 0x01, 0x08, 0xF0, 0x91, 0x96, 0xB8, + // Bytes 2f00 - 2f3f + 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, 0xF0, 0x91, + 0x96, 0xB9, 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, + 0xF0, 0x91, 0xA4, 0xB5, 0xF0, 0x91, 0xA4, 0xB0, + 0x01, 0x09, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, + 0xE0, 0xB3, 0x95, 0x02, 0x09, 0xE0, 0xB7, 0x99, + 0xE0, 0xB7, 0x8F, 0xE0, 0xB7, 0x8A, 0x16, 0x44, + 0x44, 0x5A, 0xCC, 0x8C, 0xCD, 0x44, 0x44, 0x7A, + 0xCC, 0x8C, 0xCD, 0x44, 0x64, 0x7A, 0xCC, 0x8C, + // Bytes 2f40 - 2f7f + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x93, + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x94, + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x95, + 0xB9, 0x46, 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x86, 0xE1, 0x85, 0xA1, + // Bytes 2f80 - 2fbf + 0x01, 0x46, 0xE1, 0x84, 0x87, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x89, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xAE, + 0x01, 0x46, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x90, 0xE1, 0x85, 0xA1, + // Bytes 2fc0 - 2fff + 0x01, 0x46, 0xE1, 0x84, 0x91, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x92, 0xE1, 0x85, 0xA1, + 0x01, 0x49, 0xE3, 0x83, 0xA1, 0xE3, 0x82, 0xAB, + 0xE3, 0x82, 0x99, 0x11, 0x4C, 0xE1, 0x84, 0x8C, + 0xE1, 0x85, 0xAE, 0xE1, 0x84, 0x8B, 0xE1, 0x85, + 0xB4, 0x01, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x82, + 0x99, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x11, + 0x4C, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0xBC, 0xE3, + // Bytes 3000 - 303f + 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0x11, 0x4C, 0xE3, + 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, + 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE1, 0x84, 0x8E, + 0xE1, 0x85, 0xA1, 0xE1, 0x86, 0xB7, 0xE1, 0x84, + 0x80, 0xE1, 0x85, 0xA9, 0x01, 0x4F, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0x8B, 0xE3, 0x83, 0xB3, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE3, + 0x82, 0xB7, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xB3, + // Bytes 3040 - 307f + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, + 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0xBC, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x11, + 0x4F, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x52, 0xE3, 0x82, 0xA8, 0xE3, 0x82, 0xB9, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x88, 0xE3, 0x82, 0x99, 0x11, 0x52, 0xE3, 0x83, + // Bytes 3080 - 30bf + 0x95, 0xE3, 0x82, 0xA1, 0xE3, 0x83, 0xA9, 0xE3, + 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x86, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, + 0x01, 0x86, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8F, + 0x01, 0x03, 0x3C, 0xCC, 0xB8, 0x05, 0x03, 0x3D, + 0xCC, 0xB8, 0x05, 0x03, 0x3E, 0xCC, 0xB8, 0x05, + 0x03, 0x41, 0xCC, 0x80, 0xCD, 0x03, 0x41, 0xCC, + 0x81, 0xCD, 0x03, 0x41, 0xCC, 0x83, 0xCD, 0x03, + // Bytes 30c0 - 30ff + 0x41, 0xCC, 0x84, 0xCD, 0x03, 0x41, 0xCC, 0x89, + 0xCD, 0x03, 0x41, 0xCC, 0x8C, 0xCD, 0x03, 0x41, + 0xCC, 0x8F, 0xCD, 0x03, 0x41, 0xCC, 0x91, 0xCD, + 0x03, 0x41, 0xCC, 0xA5, 0xB9, 0x03, 0x41, 0xCC, + 0xA8, 0xA9, 0x03, 0x42, 0xCC, 0x87, 0xCD, 0x03, + 0x42, 0xCC, 0xA3, 0xB9, 0x03, 0x42, 0xCC, 0xB1, + 0xB9, 0x03, 0x43, 0xCC, 0x81, 0xCD, 0x03, 0x43, + 0xCC, 0x82, 0xCD, 0x03, 0x43, 0xCC, 0x87, 0xCD, + // Bytes 3100 - 313f + 0x03, 0x43, 0xCC, 0x8C, 0xCD, 0x03, 0x44, 0xCC, + 0x87, 0xCD, 0x03, 0x44, 0xCC, 0x8C, 0xCD, 0x03, + 0x44, 0xCC, 0xA3, 0xB9, 0x03, 0x44, 0xCC, 0xA7, + 0xA9, 0x03, 0x44, 0xCC, 0xAD, 0xB9, 0x03, 0x44, + 0xCC, 0xB1, 0xB9, 0x03, 0x45, 0xCC, 0x80, 0xCD, + 0x03, 0x45, 0xCC, 0x81, 0xCD, 0x03, 0x45, 0xCC, + 0x83, 0xCD, 0x03, 0x45, 0xCC, 0x86, 0xCD, 0x03, + 0x45, 0xCC, 0x87, 0xCD, 0x03, 0x45, 0xCC, 0x88, + // Bytes 3140 - 317f + 0xCD, 0x03, 0x45, 0xCC, 0x89, 0xCD, 0x03, 0x45, + 0xCC, 0x8C, 0xCD, 0x03, 0x45, 0xCC, 0x8F, 0xCD, + 0x03, 0x45, 0xCC, 0x91, 0xCD, 0x03, 0x45, 0xCC, + 0xA8, 0xA9, 0x03, 0x45, 0xCC, 0xAD, 0xB9, 0x03, + 0x45, 0xCC, 0xB0, 0xB9, 0x03, 0x46, 0xCC, 0x87, + 0xCD, 0x03, 0x47, 0xCC, 0x81, 0xCD, 0x03, 0x47, + 0xCC, 0x82, 0xCD, 0x03, 0x47, 0xCC, 0x84, 0xCD, + 0x03, 0x47, 0xCC, 0x86, 0xCD, 0x03, 0x47, 0xCC, + // Bytes 3180 - 31bf + 0x87, 0xCD, 0x03, 0x47, 0xCC, 0x8C, 0xCD, 0x03, + 0x47, 0xCC, 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0x82, + 0xCD, 0x03, 0x48, 0xCC, 0x87, 0xCD, 0x03, 0x48, + 0xCC, 0x88, 0xCD, 0x03, 0x48, 0xCC, 0x8C, 0xCD, + 0x03, 0x48, 0xCC, 0xA3, 0xB9, 0x03, 0x48, 0xCC, + 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0xAE, 0xB9, 0x03, + 0x49, 0xCC, 0x80, 0xCD, 0x03, 0x49, 0xCC, 0x81, + 0xCD, 0x03, 0x49, 0xCC, 0x82, 0xCD, 0x03, 0x49, + // Bytes 31c0 - 31ff + 0xCC, 0x83, 0xCD, 0x03, 0x49, 0xCC, 0x84, 0xCD, + 0x03, 0x49, 0xCC, 0x86, 0xCD, 0x03, 0x49, 0xCC, + 0x87, 0xCD, 0x03, 0x49, 0xCC, 0x89, 0xCD, 0x03, + 0x49, 0xCC, 0x8C, 0xCD, 0x03, 0x49, 0xCC, 0x8F, + 0xCD, 0x03, 0x49, 0xCC, 0x91, 0xCD, 0x03, 0x49, + 0xCC, 0xA3, 0xB9, 0x03, 0x49, 0xCC, 0xA8, 0xA9, + 0x03, 0x49, 0xCC, 0xB0, 0xB9, 0x03, 0x4A, 0xCC, + 0x82, 0xCD, 0x03, 0x4B, 0xCC, 0x81, 0xCD, 0x03, + // Bytes 3200 - 323f + 0x4B, 0xCC, 0x8C, 0xCD, 0x03, 0x4B, 0xCC, 0xA3, + 0xB9, 0x03, 0x4B, 0xCC, 0xA7, 0xA9, 0x03, 0x4B, + 0xCC, 0xB1, 0xB9, 0x03, 0x4C, 0xCC, 0x81, 0xCD, + 0x03, 0x4C, 0xCC, 0x8C, 0xCD, 0x03, 0x4C, 0xCC, + 0xA7, 0xA9, 0x03, 0x4C, 0xCC, 0xAD, 0xB9, 0x03, + 0x4C, 0xCC, 0xB1, 0xB9, 0x03, 0x4D, 0xCC, 0x81, + 0xCD, 0x03, 0x4D, 0xCC, 0x87, 0xCD, 0x03, 0x4D, + 0xCC, 0xA3, 0xB9, 0x03, 0x4E, 0xCC, 0x80, 0xCD, + // Bytes 3240 - 327f + 0x03, 0x4E, 0xCC, 0x81, 0xCD, 0x03, 0x4E, 0xCC, + 0x83, 0xCD, 0x03, 0x4E, 0xCC, 0x87, 0xCD, 0x03, + 0x4E, 0xCC, 0x8C, 0xCD, 0x03, 0x4E, 0xCC, 0xA3, + 0xB9, 0x03, 0x4E, 0xCC, 0xA7, 0xA9, 0x03, 0x4E, + 0xCC, 0xAD, 0xB9, 0x03, 0x4E, 0xCC, 0xB1, 0xB9, + 0x03, 0x4F, 0xCC, 0x80, 0xCD, 0x03, 0x4F, 0xCC, + 0x81, 0xCD, 0x03, 0x4F, 0xCC, 0x86, 0xCD, 0x03, + 0x4F, 0xCC, 0x89, 0xCD, 0x03, 0x4F, 0xCC, 0x8B, + // Bytes 3280 - 32bf + 0xCD, 0x03, 0x4F, 0xCC, 0x8C, 0xCD, 0x03, 0x4F, + 0xCC, 0x8F, 0xCD, 0x03, 0x4F, 0xCC, 0x91, 0xCD, + 0x03, 0x50, 0xCC, 0x81, 0xCD, 0x03, 0x50, 0xCC, + 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x81, 0xCD, 0x03, + 0x52, 0xCC, 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x8C, + 0xCD, 0x03, 0x52, 0xCC, 0x8F, 0xCD, 0x03, 0x52, + 0xCC, 0x91, 0xCD, 0x03, 0x52, 0xCC, 0xA7, 0xA9, + 0x03, 0x52, 0xCC, 0xB1, 0xB9, 0x03, 0x53, 0xCC, + // Bytes 32c0 - 32ff + 0x82, 0xCD, 0x03, 0x53, 0xCC, 0x87, 0xCD, 0x03, + 0x53, 0xCC, 0xA6, 0xB9, 0x03, 0x53, 0xCC, 0xA7, + 0xA9, 0x03, 0x54, 0xCC, 0x87, 0xCD, 0x03, 0x54, + 0xCC, 0x8C, 0xCD, 0x03, 0x54, 0xCC, 0xA3, 0xB9, + 0x03, 0x54, 0xCC, 0xA6, 0xB9, 0x03, 0x54, 0xCC, + 0xA7, 0xA9, 0x03, 0x54, 0xCC, 0xAD, 0xB9, 0x03, + 0x54, 0xCC, 0xB1, 0xB9, 0x03, 0x55, 0xCC, 0x80, + 0xCD, 0x03, 0x55, 0xCC, 0x81, 0xCD, 0x03, 0x55, + // Bytes 3300 - 333f + 0xCC, 0x82, 0xCD, 0x03, 0x55, 0xCC, 0x86, 0xCD, + 0x03, 0x55, 0xCC, 0x89, 0xCD, 0x03, 0x55, 0xCC, + 0x8A, 0xCD, 0x03, 0x55, 0xCC, 0x8B, 0xCD, 0x03, + 0x55, 0xCC, 0x8C, 0xCD, 0x03, 0x55, 0xCC, 0x8F, + 0xCD, 0x03, 0x55, 0xCC, 0x91, 0xCD, 0x03, 0x55, + 0xCC, 0xA3, 0xB9, 0x03, 0x55, 0xCC, 0xA4, 0xB9, + 0x03, 0x55, 0xCC, 0xA8, 0xA9, 0x03, 0x55, 0xCC, + 0xAD, 0xB9, 0x03, 0x55, 0xCC, 0xB0, 0xB9, 0x03, + // Bytes 3340 - 337f + 0x56, 0xCC, 0x83, 0xCD, 0x03, 0x56, 0xCC, 0xA3, + 0xB9, 0x03, 0x57, 0xCC, 0x80, 0xCD, 0x03, 0x57, + 0xCC, 0x81, 0xCD, 0x03, 0x57, 0xCC, 0x82, 0xCD, + 0x03, 0x57, 0xCC, 0x87, 0xCD, 0x03, 0x57, 0xCC, + 0x88, 0xCD, 0x03, 0x57, 0xCC, 0xA3, 0xB9, 0x03, + 0x58, 0xCC, 0x87, 0xCD, 0x03, 0x58, 0xCC, 0x88, + 0xCD, 0x03, 0x59, 0xCC, 0x80, 0xCD, 0x03, 0x59, + 0xCC, 0x81, 0xCD, 0x03, 0x59, 0xCC, 0x82, 0xCD, + // Bytes 3380 - 33bf + 0x03, 0x59, 0xCC, 0x83, 0xCD, 0x03, 0x59, 0xCC, + 0x84, 0xCD, 0x03, 0x59, 0xCC, 0x87, 0xCD, 0x03, + 0x59, 0xCC, 0x88, 0xCD, 0x03, 0x59, 0xCC, 0x89, + 0xCD, 0x03, 0x59, 0xCC, 0xA3, 0xB9, 0x03, 0x5A, + 0xCC, 0x81, 0xCD, 0x03, 0x5A, 0xCC, 0x82, 0xCD, + 0x03, 0x5A, 0xCC, 0x87, 0xCD, 0x03, 0x5A, 0xCC, + 0x8C, 0xCD, 0x03, 0x5A, 0xCC, 0xA3, 0xB9, 0x03, + 0x5A, 0xCC, 0xB1, 0xB9, 0x03, 0x61, 0xCC, 0x80, + // Bytes 33c0 - 33ff + 0xCD, 0x03, 0x61, 0xCC, 0x81, 0xCD, 0x03, 0x61, + 0xCC, 0x83, 0xCD, 0x03, 0x61, 0xCC, 0x84, 0xCD, + 0x03, 0x61, 0xCC, 0x89, 0xCD, 0x03, 0x61, 0xCC, + 0x8C, 0xCD, 0x03, 0x61, 0xCC, 0x8F, 0xCD, 0x03, + 0x61, 0xCC, 0x91, 0xCD, 0x03, 0x61, 0xCC, 0xA5, + 0xB9, 0x03, 0x61, 0xCC, 0xA8, 0xA9, 0x03, 0x62, + 0xCC, 0x87, 0xCD, 0x03, 0x62, 0xCC, 0xA3, 0xB9, + 0x03, 0x62, 0xCC, 0xB1, 0xB9, 0x03, 0x63, 0xCC, + // Bytes 3400 - 343f + 0x81, 0xCD, 0x03, 0x63, 0xCC, 0x82, 0xCD, 0x03, + 0x63, 0xCC, 0x87, 0xCD, 0x03, 0x63, 0xCC, 0x8C, + 0xCD, 0x03, 0x64, 0xCC, 0x87, 0xCD, 0x03, 0x64, + 0xCC, 0x8C, 0xCD, 0x03, 0x64, 0xCC, 0xA3, 0xB9, + 0x03, 0x64, 0xCC, 0xA7, 0xA9, 0x03, 0x64, 0xCC, + 0xAD, 0xB9, 0x03, 0x64, 0xCC, 0xB1, 0xB9, 0x03, + 0x65, 0xCC, 0x80, 0xCD, 0x03, 0x65, 0xCC, 0x81, + 0xCD, 0x03, 0x65, 0xCC, 0x83, 0xCD, 0x03, 0x65, + // Bytes 3440 - 347f + 0xCC, 0x86, 0xCD, 0x03, 0x65, 0xCC, 0x87, 0xCD, + 0x03, 0x65, 0xCC, 0x88, 0xCD, 0x03, 0x65, 0xCC, + 0x89, 0xCD, 0x03, 0x65, 0xCC, 0x8C, 0xCD, 0x03, + 0x65, 0xCC, 0x8F, 0xCD, 0x03, 0x65, 0xCC, 0x91, + 0xCD, 0x03, 0x65, 0xCC, 0xA8, 0xA9, 0x03, 0x65, + 0xCC, 0xAD, 0xB9, 0x03, 0x65, 0xCC, 0xB0, 0xB9, + 0x03, 0x66, 0xCC, 0x87, 0xCD, 0x03, 0x67, 0xCC, + 0x81, 0xCD, 0x03, 0x67, 0xCC, 0x82, 0xCD, 0x03, + // Bytes 3480 - 34bf + 0x67, 0xCC, 0x84, 0xCD, 0x03, 0x67, 0xCC, 0x86, + 0xCD, 0x03, 0x67, 0xCC, 0x87, 0xCD, 0x03, 0x67, + 0xCC, 0x8C, 0xCD, 0x03, 0x67, 0xCC, 0xA7, 0xA9, + 0x03, 0x68, 0xCC, 0x82, 0xCD, 0x03, 0x68, 0xCC, + 0x87, 0xCD, 0x03, 0x68, 0xCC, 0x88, 0xCD, 0x03, + 0x68, 0xCC, 0x8C, 0xCD, 0x03, 0x68, 0xCC, 0xA3, + 0xB9, 0x03, 0x68, 0xCC, 0xA7, 0xA9, 0x03, 0x68, + 0xCC, 0xAE, 0xB9, 0x03, 0x68, 0xCC, 0xB1, 0xB9, + // Bytes 34c0 - 34ff + 0x03, 0x69, 0xCC, 0x80, 0xCD, 0x03, 0x69, 0xCC, + 0x81, 0xCD, 0x03, 0x69, 0xCC, 0x82, 0xCD, 0x03, + 0x69, 0xCC, 0x83, 0xCD, 0x03, 0x69, 0xCC, 0x84, + 0xCD, 0x03, 0x69, 0xCC, 0x86, 0xCD, 0x03, 0x69, + 0xCC, 0x89, 0xCD, 0x03, 0x69, 0xCC, 0x8C, 0xCD, + 0x03, 0x69, 0xCC, 0x8F, 0xCD, 0x03, 0x69, 0xCC, + 0x91, 0xCD, 0x03, 0x69, 0xCC, 0xA3, 0xB9, 0x03, + 0x69, 0xCC, 0xA8, 0xA9, 0x03, 0x69, 0xCC, 0xB0, + // Bytes 3500 - 353f + 0xB9, 0x03, 0x6A, 0xCC, 0x82, 0xCD, 0x03, 0x6A, + 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, 0x81, 0xCD, + 0x03, 0x6B, 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, + 0xA3, 0xB9, 0x03, 0x6B, 0xCC, 0xA7, 0xA9, 0x03, + 0x6B, 0xCC, 0xB1, 0xB9, 0x03, 0x6C, 0xCC, 0x81, + 0xCD, 0x03, 0x6C, 0xCC, 0x8C, 0xCD, 0x03, 0x6C, + 0xCC, 0xA7, 0xA9, 0x03, 0x6C, 0xCC, 0xAD, 0xB9, + 0x03, 0x6C, 0xCC, 0xB1, 0xB9, 0x03, 0x6D, 0xCC, + // Bytes 3540 - 357f + 0x81, 0xCD, 0x03, 0x6D, 0xCC, 0x87, 0xCD, 0x03, + 0x6D, 0xCC, 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0x80, + 0xCD, 0x03, 0x6E, 0xCC, 0x81, 0xCD, 0x03, 0x6E, + 0xCC, 0x83, 0xCD, 0x03, 0x6E, 0xCC, 0x87, 0xCD, + 0x03, 0x6E, 0xCC, 0x8C, 0xCD, 0x03, 0x6E, 0xCC, + 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0xA7, 0xA9, 0x03, + 0x6E, 0xCC, 0xAD, 0xB9, 0x03, 0x6E, 0xCC, 0xB1, + 0xB9, 0x03, 0x6F, 0xCC, 0x80, 0xCD, 0x03, 0x6F, + // Bytes 3580 - 35bf + 0xCC, 0x81, 0xCD, 0x03, 0x6F, 0xCC, 0x86, 0xCD, + 0x03, 0x6F, 0xCC, 0x89, 0xCD, 0x03, 0x6F, 0xCC, + 0x8B, 0xCD, 0x03, 0x6F, 0xCC, 0x8C, 0xCD, 0x03, + 0x6F, 0xCC, 0x8F, 0xCD, 0x03, 0x6F, 0xCC, 0x91, + 0xCD, 0x03, 0x70, 0xCC, 0x81, 0xCD, 0x03, 0x70, + 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, 0x81, 0xCD, + 0x03, 0x72, 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, + 0x8C, 0xCD, 0x03, 0x72, 0xCC, 0x8F, 0xCD, 0x03, + // Bytes 35c0 - 35ff + 0x72, 0xCC, 0x91, 0xCD, 0x03, 0x72, 0xCC, 0xA7, + 0xA9, 0x03, 0x72, 0xCC, 0xB1, 0xB9, 0x03, 0x73, + 0xCC, 0x82, 0xCD, 0x03, 0x73, 0xCC, 0x87, 0xCD, + 0x03, 0x73, 0xCC, 0xA6, 0xB9, 0x03, 0x73, 0xCC, + 0xA7, 0xA9, 0x03, 0x74, 0xCC, 0x87, 0xCD, 0x03, + 0x74, 0xCC, 0x88, 0xCD, 0x03, 0x74, 0xCC, 0x8C, + 0xCD, 0x03, 0x74, 0xCC, 0xA3, 0xB9, 0x03, 0x74, + 0xCC, 0xA6, 0xB9, 0x03, 0x74, 0xCC, 0xA7, 0xA9, + // Bytes 3600 - 363f + 0x03, 0x74, 0xCC, 0xAD, 0xB9, 0x03, 0x74, 0xCC, + 0xB1, 0xB9, 0x03, 0x75, 0xCC, 0x80, 0xCD, 0x03, + 0x75, 0xCC, 0x81, 0xCD, 0x03, 0x75, 0xCC, 0x82, + 0xCD, 0x03, 0x75, 0xCC, 0x86, 0xCD, 0x03, 0x75, + 0xCC, 0x89, 0xCD, 0x03, 0x75, 0xCC, 0x8A, 0xCD, + 0x03, 0x75, 0xCC, 0x8B, 0xCD, 0x03, 0x75, 0xCC, + 0x8C, 0xCD, 0x03, 0x75, 0xCC, 0x8F, 0xCD, 0x03, + 0x75, 0xCC, 0x91, 0xCD, 0x03, 0x75, 0xCC, 0xA3, + // Bytes 3640 - 367f + 0xB9, 0x03, 0x75, 0xCC, 0xA4, 0xB9, 0x03, 0x75, + 0xCC, 0xA8, 0xA9, 0x03, 0x75, 0xCC, 0xAD, 0xB9, + 0x03, 0x75, 0xCC, 0xB0, 0xB9, 0x03, 0x76, 0xCC, + 0x83, 0xCD, 0x03, 0x76, 0xCC, 0xA3, 0xB9, 0x03, + 0x77, 0xCC, 0x80, 0xCD, 0x03, 0x77, 0xCC, 0x81, + 0xCD, 0x03, 0x77, 0xCC, 0x82, 0xCD, 0x03, 0x77, + 0xCC, 0x87, 0xCD, 0x03, 0x77, 0xCC, 0x88, 0xCD, + 0x03, 0x77, 0xCC, 0x8A, 0xCD, 0x03, 0x77, 0xCC, + // Bytes 3680 - 36bf + 0xA3, 0xB9, 0x03, 0x78, 0xCC, 0x87, 0xCD, 0x03, + 0x78, 0xCC, 0x88, 0xCD, 0x03, 0x79, 0xCC, 0x80, + 0xCD, 0x03, 0x79, 0xCC, 0x81, 0xCD, 0x03, 0x79, + 0xCC, 0x82, 0xCD, 0x03, 0x79, 0xCC, 0x83, 0xCD, + 0x03, 0x79, 0xCC, 0x84, 0xCD, 0x03, 0x79, 0xCC, + 0x87, 0xCD, 0x03, 0x79, 0xCC, 0x88, 0xCD, 0x03, + 0x79, 0xCC, 0x89, 0xCD, 0x03, 0x79, 0xCC, 0x8A, + 0xCD, 0x03, 0x79, 0xCC, 0xA3, 0xB9, 0x03, 0x7A, + // Bytes 36c0 - 36ff + 0xCC, 0x81, 0xCD, 0x03, 0x7A, 0xCC, 0x82, 0xCD, + 0x03, 0x7A, 0xCC, 0x87, 0xCD, 0x03, 0x7A, 0xCC, + 0x8C, 0xCD, 0x03, 0x7A, 0xCC, 0xA3, 0xB9, 0x03, + 0x7A, 0xCC, 0xB1, 0xB9, 0x04, 0xC2, 0xA8, 0xCC, + 0x80, 0xCE, 0x04, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, + 0x04, 0xC2, 0xA8, 0xCD, 0x82, 0xCE, 0x04, 0xC3, + 0x86, 0xCC, 0x81, 0xCD, 0x04, 0xC3, 0x86, 0xCC, + 0x84, 0xCD, 0x04, 0xC3, 0x98, 0xCC, 0x81, 0xCD, + // Bytes 3700 - 373f + 0x04, 0xC3, 0xA6, 0xCC, 0x81, 0xCD, 0x04, 0xC3, + 0xA6, 0xCC, 0x84, 0xCD, 0x04, 0xC3, 0xB8, 0xCC, + 0x81, 0xCD, 0x04, 0xC5, 0xBF, 0xCC, 0x87, 0xCD, + 0x04, 0xC6, 0xB7, 0xCC, 0x8C, 0xCD, 0x04, 0xCA, + 0x92, 0xCC, 0x8C, 0xCD, 0x04, 0xCE, 0x91, 0xCC, + 0x80, 0xCD, 0x04, 0xCE, 0x91, 0xCC, 0x81, 0xCD, + 0x04, 0xCE, 0x91, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0x91, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0x91, 0xCD, + // Bytes 3740 - 377f + 0x85, 0xDD, 0x04, 0xCE, 0x95, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0x95, 0xCC, 0x81, 0xCD, 0x04, 0xCE, + 0x97, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x97, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0x97, 0xCD, 0x85, 0xDD, + 0x04, 0xCE, 0x99, 0xCC, 0x80, 0xCD, 0x04, 0xCE, + 0x99, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0x99, 0xCC, + 0x84, 0xCD, 0x04, 0xCE, 0x99, 0xCC, 0x86, 0xCD, + 0x04, 0xCE, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xCE, + // Bytes 3780 - 37bf + 0x9F, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x9F, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0xA1, 0xCC, 0x94, 0xCD, + 0x04, 0xCE, 0xA5, 0xCC, 0x80, 0xCD, 0x04, 0xCE, + 0xA5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, + 0x84, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, 0x86, 0xCD, + 0x04, 0xCE, 0xA5, 0xCC, 0x88, 0xCD, 0x04, 0xCE, + 0xA9, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0xA9, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0xA9, 0xCD, 0x85, 0xDD, + // Bytes 37c0 - 37ff + 0x04, 0xCE, 0xB1, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0xB1, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB1, 0xCD, + 0x85, 0xDD, 0x04, 0xCE, 0xB5, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0xB5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, + 0xB7, 0xCD, 0x85, 0xDD, 0x04, 0xCE, 0xB9, 0xCC, + 0x80, 0xCD, 0x04, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, + 0x04, 0xCE, 0xB9, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0xB9, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB9, 0xCD, + // Bytes 3800 - 383f + 0x82, 0xCD, 0x04, 0xCE, 0xBF, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x04, 0xCF, + 0x81, 0xCC, 0x93, 0xCD, 0x04, 0xCF, 0x81, 0xCC, + 0x94, 0xCD, 0x04, 0xCF, 0x85, 0xCC, 0x80, 0xCD, + 0x04, 0xCF, 0x85, 0xCC, 0x81, 0xCD, 0x04, 0xCF, + 0x85, 0xCC, 0x84, 0xCD, 0x04, 0xCF, 0x85, 0xCC, + 0x86, 0xCD, 0x04, 0xCF, 0x85, 0xCD, 0x82, 0xCD, + 0x04, 0xCF, 0x89, 0xCD, 0x85, 0xDD, 0x04, 0xCF, + // Bytes 3840 - 387f + 0x92, 0xCC, 0x81, 0xCD, 0x04, 0xCF, 0x92, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0x86, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0x90, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0x90, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x93, 0xCC, + 0x81, 0xCD, 0x04, 0xD0, 0x95, 0xCC, 0x80, 0xCD, + 0x04, 0xD0, 0x95, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0x95, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x96, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0x96, 0xCC, 0x88, 0xCD, + // Bytes 3880 - 38bf + 0x04, 0xD0, 0x97, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0x98, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0x98, 0xCC, + 0x84, 0xCD, 0x04, 0xD0, 0x98, 0xCC, 0x86, 0xCD, + 0x04, 0xD0, 0x98, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0x9A, 0xCC, 0x81, 0xCD, 0x04, 0xD0, 0x9E, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, 0x84, 0xCD, + 0x04, 0xD0, 0xA3, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0xA3, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, + // Bytes 38c0 - 38ff + 0x8B, 0xCD, 0x04, 0xD0, 0xA7, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xAB, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0xAD, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xB3, 0xCC, 0x81, 0xCD, 0x04, 0xD0, + 0xB5, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xB6, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + // Bytes 3900 - 393f + 0xB6, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB7, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, 0x80, 0xCD, + 0x04, 0xD0, 0xB8, 0xCC, 0x84, 0xCD, 0x04, 0xD0, + 0xB8, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xBA, 0xCC, 0x81, 0xCD, + 0x04, 0xD0, 0xBE, 0xCC, 0x88, 0xCD, 0x04, 0xD1, + 0x83, 0xCC, 0x84, 0xCD, 0x04, 0xD1, 0x83, 0xCC, + 0x86, 0xCD, 0x04, 0xD1, 0x83, 0xCC, 0x88, 0xCD, + // Bytes 3940 - 397f + 0x04, 0xD1, 0x83, 0xCC, 0x8B, 0xCD, 0x04, 0xD1, + 0x87, 0xCC, 0x88, 0xCD, 0x04, 0xD1, 0x8B, 0xCC, + 0x88, 0xCD, 0x04, 0xD1, 0x8D, 0xCC, 0x88, 0xCD, + 0x04, 0xD1, 0x96, 0xCC, 0x88, 0xCD, 0x04, 0xD1, + 0xB4, 0xCC, 0x8F, 0xCD, 0x04, 0xD1, 0xB5, 0xCC, + 0x8F, 0xCD, 0x04, 0xD3, 0x98, 0xCC, 0x88, 0xCD, + 0x04, 0xD3, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xD3, + 0xA8, 0xCC, 0x88, 0xCD, 0x04, 0xD3, 0xA9, 0xCC, + // Bytes 3980 - 39bf + 0x88, 0xCD, 0x04, 0xD8, 0xA7, 0xD9, 0x93, 0xCD, + 0x04, 0xD8, 0xA7, 0xD9, 0x94, 0xCD, 0x04, 0xD8, + 0xA7, 0xD9, 0x95, 0xB9, 0x04, 0xD9, 0x88, 0xD9, + 0x94, 0xCD, 0x04, 0xD9, 0x8A, 0xD9, 0x94, 0xCD, + 0x04, 0xDB, 0x81, 0xD9, 0x94, 0xCD, 0x04, 0xDB, + 0x92, 0xD9, 0x94, 0xCD, 0x04, 0xDB, 0x95, 0xD9, + 0x94, 0xCD, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x80, + 0xCE, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x81, 0xCE, + // Bytes 39c0 - 39ff + 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, + 0x41, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x41, + 0xCC, 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x41, 0xCC, + 0x86, 0xCC, 0x81, 0xCE, 0x05, 0x41, 0xCC, 0x86, + 0xCC, 0x83, 0xCE, 0x05, 0x41, 0xCC, 0x86, 0xCC, + 0x89, 0xCE, 0x05, 0x41, 0xCC, 0x87, 0xCC, 0x84, + 0xCE, 0x05, 0x41, 0xCC, 0x88, 0xCC, 0x84, 0xCE, + 0x05, 0x41, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, + // Bytes 3a00 - 3a3f + 0x41, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x41, + 0xCC, 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x43, 0xCC, + 0xA7, 0xCC, 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, + 0xCC, 0x80, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, + 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x83, + 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x89, 0xCE, + 0x05, 0x45, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, + 0x45, 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x45, + // Bytes 3a40 - 3a7f + 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x45, 0xCC, + 0xA7, 0xCC, 0x86, 0xCE, 0x05, 0x49, 0xCC, 0x88, + 0xCC, 0x81, 0xCE, 0x05, 0x4C, 0xCC, 0xA3, 0xCC, + 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x80, + 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, + 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, + 0x4F, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x4F, + 0xCC, 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, + // Bytes 3a80 - 3abf + 0x83, 0xCC, 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x83, + 0xCC, 0x88, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, + 0x80, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x81, + 0xCE, 0x05, 0x4F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, + 0x05, 0x4F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x4F, 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x4F, + 0xCC, 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, + 0x9B, 0xCC, 0x83, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, + // Bytes 3ac0 - 3aff + 0xCC, 0x89, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, + 0xA3, 0xBA, 0x05, 0x4F, 0xCC, 0xA3, 0xCC, 0x82, + 0xCE, 0x05, 0x4F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, + 0x05, 0x52, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, + 0x53, 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x53, + 0xCC, 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x53, 0xCC, + 0xA3, 0xCC, 0x87, 0xCE, 0x05, 0x55, 0xCC, 0x83, + 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x84, 0xCC, + // Bytes 3b00 - 3b3f + 0x88, 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x81, 0xCE, + 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x55, 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x55, + 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x55, 0xCC, + 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x9B, + 0xCC, 0x83, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, + 0x89, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0xA3, + // Bytes 3b40 - 3b7f + 0xBA, 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x80, 0xCE, + 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, + 0x61, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x61, + 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x61, 0xCC, + 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x61, 0xCC, 0x86, + 0xCC, 0x81, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, + 0x83, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x89, + 0xCE, 0x05, 0x61, 0xCC, 0x87, 0xCC, 0x84, 0xCE, + // Bytes 3b80 - 3bbf + 0x05, 0x61, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x61, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, 0x61, + 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x61, 0xCC, + 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x63, 0xCC, 0xA7, + 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, + 0x80, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x81, + 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x83, 0xCE, + 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, + // Bytes 3bc0 - 3bff + 0x65, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, 0x65, + 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, + 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x65, 0xCC, 0xA7, + 0xCC, 0x86, 0xCE, 0x05, 0x69, 0xCC, 0x88, 0xCC, + 0x81, 0xCE, 0x05, 0x6C, 0xCC, 0xA3, 0xCC, 0x84, + 0xCE, 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x80, 0xCE, + 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, + 0x6F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x6F, + // Bytes 3c00 - 3c3f + 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x6F, 0xCC, + 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x83, + 0xCC, 0x84, 0xCE, 0x05, 0x6F, 0xCC, 0x83, 0xCC, + 0x88, 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x80, + 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x81, 0xCE, + 0x05, 0x6F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, + 0x6F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x6F, + 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x6F, 0xCC, + // Bytes 3c40 - 3c7f + 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, + 0xCC, 0x83, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, + 0x89, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0xA3, + 0xBA, 0x05, 0x6F, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, + 0x05, 0x6F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, 0x05, + 0x72, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, 0x73, + 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, + 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, 0xA3, + // Bytes 3c80 - 3cbf + 0xCC, 0x87, 0xCE, 0x05, 0x75, 0xCC, 0x83, 0xCC, + 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x84, 0xCC, 0x88, + 0xCE, 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x80, 0xCE, + 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x05, + 0x75, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x75, + 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x75, 0xCC, + 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x75, 0xCC, 0x9B, + 0xCC, 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, + // Bytes 3cc0 - 3cff + 0x83, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x89, + 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, + 0x05, 0xE1, 0xBE, 0xBF, 0xCC, 0x80, 0xCE, 0x05, + 0xE1, 0xBE, 0xBF, 0xCC, 0x81, 0xCE, 0x05, 0xE1, + 0xBE, 0xBF, 0xCD, 0x82, 0xCE, 0x05, 0xE1, 0xBF, + 0xBE, 0xCC, 0x80, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, + 0xCC, 0x81, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, 0xCD, + 0x82, 0xCE, 0x05, 0xE2, 0x86, 0x90, 0xCC, 0xB8, + // Bytes 3d00 - 3d3f + 0x05, 0x05, 0xE2, 0x86, 0x92, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x86, 0x94, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x87, 0x90, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x87, 0x92, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, + 0x94, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x83, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x88, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x8B, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x88, 0xA3, 0xCC, 0xB8, 0x05, + // Bytes 3d40 - 3d7f + 0x05, 0xE2, 0x88, 0xA5, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x88, 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x89, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0x85, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x88, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x8D, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xA1, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xA4, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xA5, 0xCC, 0xB8, 0x05, 0x05, + // Bytes 3d80 - 3dbf + 0xE2, 0x89, 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x89, 0xB3, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0xB6, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB7, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBA, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBB, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xBC, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xBD, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0x82, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + // Bytes 3dc0 - 3dff + 0x8A, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + 0x86, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x87, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x91, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x92, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x8A, 0xA2, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x8A, 0xA8, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0xA9, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x8A, 0xAB, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + // Bytes 3e00 - 3e3f + 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB3, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB4, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB5, 0xCC, 0xB8, + 0x05, 0x06, 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x80, + // Bytes 3e40 - 3e7f + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 3e80 - 3ebf + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x82, + // Bytes 3ec0 - 3eff + 0xCE, 0x06, 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x80, + // Bytes 3f00 - 3f3f + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x85, + // Bytes 3f40 - 3f7f + 0xDE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 3f80 - 3fbf + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x82, + // Bytes 3fc0 - 3fff + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x85, + // Bytes 4000 - 403f + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x85, + 0xDE, 0x06, 0xE0, 0xA4, 0xA8, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xA4, 0xB0, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xA4, 0xB3, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xB1, 0x86, 0xE0, 0xB1, 0x96, + 0x89, 0x06, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8A, + // Bytes 4040 - 407f + 0x15, 0x06, 0xE3, 0x81, 0x86, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x91, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x93, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x95, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x97, 0xE3, 0x82, 0x99, + // Bytes 4080 - 40bf + 0x11, 0x06, 0xE3, 0x81, 0x99, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA1, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA4, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA6, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA8, 0xE3, 0x82, 0x99, + // Bytes 40c0 - 40ff + 0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x9A, + // Bytes 4100 - 413f + 0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x82, 0x9D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xA6, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, + // Bytes 4140 - 417f + 0x11, 0x06, 0xE3, 0x82, 0xB3, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB9, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBD, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x81, 0xE3, 0x82, 0x99, + // Bytes 4180 - 41bf + 0x11, 0x06, 0xE3, 0x83, 0x84, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x86, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, + // Bytes 41c0 - 41ff + 0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xB0, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xB1, 0xE3, 0x82, 0x99, + // Bytes 4200 - 423f + 0x11, 0x06, 0xE3, 0x83, 0xB2, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xBD, 0xE3, 0x82, 0x99, + 0x11, 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 4240 - 427f + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + // Bytes 4280 - 42bf + 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, + // Bytes 42c0 - 42ff + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + // Bytes 4300 - 433f + 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, + // Bytes 4340 - 437f + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + 0xDF, 0x08, 0xF0, 0x91, 0x82, 0x99, 0xF0, 0x91, + // Bytes 4380 - 43bf + 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, 0x82, 0x9B, + 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, + 0x82, 0xA5, 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x42, + 0xC2, 0xB4, 0x01, 0x43, 0x20, 0xCC, 0x81, 0xCD, + 0x43, 0x20, 0xCC, 0x83, 0xCD, 0x43, 0x20, 0xCC, + 0x84, 0xCD, 0x43, 0x20, 0xCC, 0x85, 0xCD, 0x43, + 0x20, 0xCC, 0x86, 0xCD, 0x43, 0x20, 0xCC, 0x87, + 0xCD, 0x43, 0x20, 0xCC, 0x88, 0xCD, 0x43, 0x20, + // Bytes 43c0 - 43ff + 0xCC, 0x8A, 0xCD, 0x43, 0x20, 0xCC, 0x8B, 0xCD, + 0x43, 0x20, 0xCC, 0x93, 0xCD, 0x43, 0x20, 0xCC, + 0x94, 0xCD, 0x43, 0x20, 0xCC, 0xA7, 0xA9, 0x43, + 0x20, 0xCC, 0xA8, 0xA9, 0x43, 0x20, 0xCC, 0xB3, + 0xB9, 0x43, 0x20, 0xCD, 0x82, 0xCD, 0x43, 0x20, + 0xCD, 0x85, 0xDD, 0x43, 0x20, 0xD9, 0x8B, 0x5D, + 0x43, 0x20, 0xD9, 0x8C, 0x61, 0x43, 0x20, 0xD9, + 0x8D, 0x65, 0x43, 0x20, 0xD9, 0x8E, 0x69, 0x43, + // Bytes 4400 - 443f + 0x20, 0xD9, 0x8F, 0x6D, 0x43, 0x20, 0xD9, 0x90, + 0x71, 0x43, 0x20, 0xD9, 0x91, 0x75, 0x43, 0x20, + 0xD9, 0x92, 0x79, 0x43, 0x41, 0xCC, 0x8A, 0xCD, + 0x43, 0x73, 0xCC, 0x87, 0xCD, 0x44, 0x20, 0xE3, + 0x82, 0x99, 0x11, 0x44, 0x20, 0xE3, 0x82, 0x9A, + 0x11, 0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, 0x44, + 0xCE, 0x91, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x95, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x97, 0xCC, 0x81, + // Bytes 4440 - 447f + 0xCD, 0x44, 0xCE, 0x99, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0x9F, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, 0xCC, 0x88, + 0xCD, 0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB5, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB7, 0xCC, 0x81, + 0xCD, 0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x85, + // Bytes 4480 - 44bf + 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x89, 0xCC, 0x81, + 0xCD, 0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x35, 0x44, + 0xD7, 0x90, 0xD6, 0xB8, 0x39, 0x44, 0xD7, 0x90, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x4D, 0x44, + 0xD7, 0x92, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x93, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x94, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x3D, 0x44, + // Bytes 44c0 - 44ff + 0xD7, 0x95, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x96, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x98, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x29, 0x44, + 0xD7, 0x99, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9A, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x4D, 0x44, + 0xD7, 0x9C, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9E, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, + // Bytes 4500 - 453f + 0x45, 0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x45, 0x44, + 0xD7, 0xA3, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, + 0x4D, 0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x45, 0x44, + 0xD7, 0xA7, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA8, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x51, 0x44, + 0xD7, 0xA9, 0xD7, 0x82, 0x55, 0x44, 0xD7, 0xAA, + // Bytes 4540 - 457f + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, + 0x35, 0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x5D, 0x44, + 0xD8, 0xA7, 0xD9, 0x93, 0xCD, 0x44, 0xD8, 0xA7, + 0xD9, 0x94, 0xCD, 0x44, 0xD8, 0xA7, 0xD9, 0x95, + 0xB9, 0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x7D, 0x44, + 0xD8, 0xB1, 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x80, + 0xD9, 0x8B, 0x5D, 0x44, 0xD9, 0x80, 0xD9, 0x8E, + 0x69, 0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x6D, 0x44, + // Bytes 4580 - 45bf + 0xD9, 0x80, 0xD9, 0x90, 0x71, 0x44, 0xD9, 0x80, + 0xD9, 0x91, 0x75, 0x44, 0xD9, 0x80, 0xD9, 0x92, + 0x79, 0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x7D, 0x44, + 0xD9, 0x88, 0xD9, 0x94, 0xCD, 0x44, 0xD9, 0x89, + 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x8A, 0xD9, 0x94, + 0xCD, 0x44, 0xDB, 0x92, 0xD9, 0x94, 0xCD, 0x44, + 0xDB, 0x95, 0xD9, 0x94, 0xCD, 0x45, 0x20, 0xCC, + 0x88, 0xCC, 0x80, 0xCE, 0x45, 0x20, 0xCC, 0x88, + // Bytes 45c0 - 45ff + 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, 0x88, 0xCD, + 0x82, 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCE, + 0x45, 0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x45, + 0x20, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x45, 0x20, + 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, + 0x94, 0xCD, 0x82, 0xCE, 0x45, 0x20, 0xD9, 0x8C, + 0xD9, 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8D, 0xD9, + // Bytes 4600 - 463f + 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, + 0x76, 0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x76, + 0x45, 0x20, 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x45, + 0x20, 0xD9, 0x91, 0xD9, 0xB0, 0x7E, 0x45, 0xE2, + 0xAB, 0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, + 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xCF, 0x85, + 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xD7, 0xA9, + 0xD6, 0xBC, 0xD7, 0x81, 0x52, 0x46, 0xD7, 0xA9, + // Bytes 4640 - 467f + 0xD6, 0xBC, 0xD7, 0x82, 0x56, 0x46, 0xD9, 0x80, + 0xD9, 0x8E, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, + 0xD9, 0x8F, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, + 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x46, 0xE0, 0xA4, + 0x95, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x96, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x97, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x9C, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + // Bytes 4680 - 46bf + 0xA1, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xA2, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xAB, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xAF, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xA1, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xA2, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xAF, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0x96, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + // Bytes 46c0 - 46ff + 0x97, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0x9C, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xAB, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xB2, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xB8, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, + 0xA1, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, + 0xA2, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xBE, + 0xB2, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE0, 0xBE, + // Bytes 4700 - 473f + 0xB3, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE3, 0x83, + 0x86, 0xE3, 0x82, 0x99, 0x11, 0x48, 0xF0, 0x9D, + 0x85, 0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x48, + 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, + 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, + 0x85, 0xA5, 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xBA, + 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x49, 0xE0, 0xBE, + 0xB2, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, + // Bytes 4740 - 477f + 0x49, 0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, + 0xBE, 0x80, 0xA2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, + 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, + 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, + 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, + 0xF0, 0x9D, 0x85, 0xB0, 0xB2, 0x4C, 0xF0, 0x9D, + 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, + // Bytes 4780 - 47bf + 0x85, 0xB1, 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, + 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, + 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xB2, 0x4C, + 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, + 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, 0xF0, 0x9D, + 0x86, 0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, + 0x85, 0xAE, 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, + // Bytes 47c0 - 47ff + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, + 0xB2, 0x83, 0x41, 0xCC, 0x82, 0xCD, 0x83, 0x41, + 0xCC, 0x86, 0xCD, 0x83, 0x41, 0xCC, 0x87, 0xCD, + 0x83, 0x41, 0xCC, 0x88, 0xCD, 0x83, 0x41, 0xCC, + 0x8A, 0xCD, 0x83, 0x41, 0xCC, 0xA3, 0xB9, 0x83, + 0x43, 0xCC, 0xA7, 0xA9, 0x83, 0x45, 0xCC, 0x82, + 0xCD, 0x83, 0x45, 0xCC, 0x84, 0xCD, 0x83, 0x45, + 0xCC, 0xA3, 0xB9, 0x83, 0x45, 0xCC, 0xA7, 0xA9, + // Bytes 4800 - 483f + 0x83, 0x49, 0xCC, 0x88, 0xCD, 0x83, 0x4C, 0xCC, + 0xA3, 0xB9, 0x83, 0x4F, 0xCC, 0x82, 0xCD, 0x83, + 0x4F, 0xCC, 0x83, 0xCD, 0x83, 0x4F, 0xCC, 0x84, + 0xCD, 0x83, 0x4F, 0xCC, 0x87, 0xCD, 0x83, 0x4F, + 0xCC, 0x88, 0xCD, 0x83, 0x4F, 0xCC, 0x9B, 0xB1, + 0x83, 0x4F, 0xCC, 0xA3, 0xB9, 0x83, 0x4F, 0xCC, + 0xA8, 0xA9, 0x83, 0x52, 0xCC, 0xA3, 0xB9, 0x83, + 0x53, 0xCC, 0x81, 0xCD, 0x83, 0x53, 0xCC, 0x8C, + // Bytes 4840 - 487f + 0xCD, 0x83, 0x53, 0xCC, 0xA3, 0xB9, 0x83, 0x55, + 0xCC, 0x83, 0xCD, 0x83, 0x55, 0xCC, 0x84, 0xCD, + 0x83, 0x55, 0xCC, 0x88, 0xCD, 0x83, 0x55, 0xCC, + 0x9B, 0xB1, 0x83, 0x61, 0xCC, 0x82, 0xCD, 0x83, + 0x61, 0xCC, 0x86, 0xCD, 0x83, 0x61, 0xCC, 0x87, + 0xCD, 0x83, 0x61, 0xCC, 0x88, 0xCD, 0x83, 0x61, + 0xCC, 0x8A, 0xCD, 0x83, 0x61, 0xCC, 0xA3, 0xB9, + 0x83, 0x63, 0xCC, 0xA7, 0xA9, 0x83, 0x65, 0xCC, + // Bytes 4880 - 48bf + 0x82, 0xCD, 0x83, 0x65, 0xCC, 0x84, 0xCD, 0x83, + 0x65, 0xCC, 0xA3, 0xB9, 0x83, 0x65, 0xCC, 0xA7, + 0xA9, 0x83, 0x69, 0xCC, 0x88, 0xCD, 0x83, 0x6C, + 0xCC, 0xA3, 0xB9, 0x83, 0x6F, 0xCC, 0x82, 0xCD, + 0x83, 0x6F, 0xCC, 0x83, 0xCD, 0x83, 0x6F, 0xCC, + 0x84, 0xCD, 0x83, 0x6F, 0xCC, 0x87, 0xCD, 0x83, + 0x6F, 0xCC, 0x88, 0xCD, 0x83, 0x6F, 0xCC, 0x9B, + 0xB1, 0x83, 0x6F, 0xCC, 0xA3, 0xB9, 0x83, 0x6F, + // Bytes 48c0 - 48ff + 0xCC, 0xA8, 0xA9, 0x83, 0x72, 0xCC, 0xA3, 0xB9, + 0x83, 0x73, 0xCC, 0x81, 0xCD, 0x83, 0x73, 0xCC, + 0x8C, 0xCD, 0x83, 0x73, 0xCC, 0xA3, 0xB9, 0x83, + 0x75, 0xCC, 0x83, 0xCD, 0x83, 0x75, 0xCC, 0x84, + 0xCD, 0x83, 0x75, 0xCC, 0x88, 0xCD, 0x83, 0x75, + 0xCC, 0x9B, 0xB1, 0x84, 0xCE, 0x91, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0x95, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x95, + // Bytes 4900 - 493f + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x99, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xA9, + 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xA9, 0xCC, 0x94, + 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x84, + // Bytes 4940 - 497f + 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x84, 0xCE, 0xB1, + 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x94, + 0xCD, 0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x84, + 0xCE, 0xB5, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB5, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x80, + 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x84, + 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB7, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCD, 0x82, + // Bytes 4980 - 49bf + 0xCD, 0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x84, + 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB9, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xCD, 0x84, + 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x84, 0xCF, 0x85, + 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x85, 0xCC, 0x94, + 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x84, + 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x84, 0xCF, 0x89, + // Bytes 49c0 - 49ff + 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x94, + 0xCD, 0x84, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + // Bytes 4a00 - 4a3f + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + // Bytes 4a40 - 4a7f + 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + // Bytes 4a80 - 4abf + 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + // Bytes 4ac0 - 4aff + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x42, + 0xCC, 0x80, 0xCD, 0x33, 0x42, 0xCC, 0x81, 0xCD, + 0x33, 0x42, 0xCC, 0x93, 0xCD, 0x33, 0x43, 0xE1, + // Bytes 4b00 - 4b3f + 0x85, 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, + // Bytes 4b40 - 4b7f + 0x43, 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, + // Bytes 4b80 - 4bbf + 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, + 0x43, 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, + 0x86, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, + 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, + 0x43, 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, + 0x86, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, + 0x01, 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCE, + 0x33, 0x43, 0xE3, 0x82, 0x99, 0x11, 0x04, 0x43, + // Bytes 4bc0 - 4bff + 0xE3, 0x82, 0x9A, 0x11, 0x04, 0x46, 0xE0, 0xBD, + 0xB1, 0xE0, 0xBD, 0xB2, 0xA2, 0x27, 0x46, 0xE0, + 0xBD, 0xB1, 0xE0, 0xBD, 0xB4, 0xA6, 0x27, 0x46, + 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, 0x27, + 0x00, 0x01, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfcTrie. Total size: 10798 bytes (10.54 KiB). Checksum: b5981cc85e3bd14. +type nfcTrie struct{} + +func newNfcTrie(i int) *nfcTrie { + return &nfcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 46: + return uint16(nfcValues[n<<6+uint32(b)]) + default: + n -= 46 + return uint16(nfcSparse.lookup(n, b)) + } +} + +// nfcValues: 48 blocks, 3072 entries, 6144 bytes +// The third block is the zero block. +var nfcValues = [3072]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd, + 0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c, + 0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245, + 0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e, + 0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376, + 0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6, + 0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434, + 0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891, + 0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0, + 0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614, + 0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa, + // Block 0x4, offset 0x100 + 0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9, + 0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407, + 0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416, + 0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443, + 0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a, + 0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493, + 0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf, + 0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7, + 0x130: 0x31cd, 0x134: 0x31f5, 0x135: 0x3501, + 0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d, + 0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, + // Block 0x5, offset 0x140 + 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259, + 0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, + 0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d, + 0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4, + 0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce, + 0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb, + 0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7, + 0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623, + 0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669, + 0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8, + 0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0xa000, + // Block 0x6, offset 0x180 + 0x184: 0x8100, 0x185: 0x8100, + 0x186: 0x8100, + 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281, + 0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09, + 0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91, + 0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706, + 0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510, + 0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e, + 0x1b0: 0x3506, 0x1b4: 0x3169, 0x1b5: 0x3475, + 0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87, + 0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457, + 0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed, + 0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba, + 0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637, + 0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6, + 0x1de: 0x319b, 0x1df: 0x34a7, + 0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c, + 0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa, + 0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0, + // Block 0x8, offset 0x200 + 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, + 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, + 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, + 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, + 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, + 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, + 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, + 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, + 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, + 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, + // Block 0x9, offset 0x240 + 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, + 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, + 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, + 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, + 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, + 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, + 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, + 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, + 0x274: 0x01ee, + 0x27a: 0x8100, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x8100, 0x285: 0x36e2, + 0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766, + 0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea, + 0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x3862, 0x2c1: 0x386e, 0x2c3: 0x385c, + 0x2c6: 0xa000, 0x2c7: 0x384a, + 0x2cc: 0x389e, 0x2cd: 0x3886, 0x2ce: 0x38b0, 0x2d0: 0xa000, + 0x2d3: 0xa000, 0x2d5: 0xa000, 0x2d6: 0xa000, 0x2d7: 0xa000, + 0x2d8: 0xa000, 0x2d9: 0x3892, 0x2da: 0xa000, + 0x2de: 0xa000, 0x2e3: 0xa000, + 0x2e7: 0xa000, + 0x2eb: 0xa000, 0x2ed: 0xa000, + 0x2f0: 0xa000, 0x2f3: 0xa000, 0x2f5: 0xa000, + 0x2f6: 0xa000, 0x2f7: 0xa000, 0x2f8: 0xa000, 0x2f9: 0x3916, 0x2fa: 0xa000, + 0x2fe: 0xa000, + // Block 0xc, offset 0x300 + 0x301: 0x3874, 0x302: 0x38f8, + 0x310: 0x3850, 0x311: 0x38d4, + 0x312: 0x3856, 0x313: 0x38da, 0x316: 0x3868, 0x317: 0x38ec, + 0x318: 0xa000, 0x319: 0xa000, 0x31a: 0x396a, 0x31b: 0x3970, 0x31c: 0x387a, 0x31d: 0x38fe, + 0x31e: 0x3880, 0x31f: 0x3904, 0x322: 0x388c, 0x323: 0x3910, + 0x324: 0x3898, 0x325: 0x391c, 0x326: 0x38a4, 0x327: 0x3928, 0x328: 0xa000, 0x329: 0xa000, + 0x32a: 0x3976, 0x32b: 0x397c, 0x32c: 0x38ce, 0x32d: 0x3952, 0x32e: 0x38aa, 0x32f: 0x392e, + 0x330: 0x38b6, 0x331: 0x393a, 0x332: 0x38bc, 0x333: 0x3940, 0x334: 0x38c2, 0x335: 0x3946, + 0x338: 0x38c8, 0x339: 0x394c, + // Block 0xd, offset 0x340 + 0x351: 0x812e, + 0x352: 0x8133, 0x353: 0x8133, 0x354: 0x8133, 0x355: 0x8133, 0x356: 0x812e, 0x357: 0x8133, + 0x358: 0x8133, 0x359: 0x8133, 0x35a: 0x812f, 0x35b: 0x812e, 0x35c: 0x8133, 0x35d: 0x8133, + 0x35e: 0x8133, 0x35f: 0x8133, 0x360: 0x8133, 0x361: 0x8133, 0x362: 0x812e, 0x363: 0x812e, + 0x364: 0x812e, 0x365: 0x812e, 0x366: 0x812e, 0x367: 0x812e, 0x368: 0x8133, 0x369: 0x8133, + 0x36a: 0x812e, 0x36b: 0x8133, 0x36c: 0x8133, 0x36d: 0x812f, 0x36e: 0x8132, 0x36f: 0x8133, + 0x370: 0x8106, 0x371: 0x8107, 0x372: 0x8108, 0x373: 0x8109, 0x374: 0x810a, 0x375: 0x810b, + 0x376: 0x810c, 0x377: 0x810d, 0x378: 0x810e, 0x379: 0x810f, 0x37a: 0x810f, 0x37b: 0x8110, + 0x37c: 0x8111, 0x37d: 0x8112, 0x37f: 0x8113, + // Block 0xe, offset 0x380 + 0x388: 0xa000, 0x38a: 0xa000, 0x38b: 0x8117, + 0x38c: 0x8118, 0x38d: 0x8119, 0x38e: 0x811a, 0x38f: 0x811b, 0x390: 0x811c, 0x391: 0x811d, + 0x392: 0x811e, 0x393: 0x9933, 0x394: 0x9933, 0x395: 0x992e, 0x396: 0x812e, 0x397: 0x8133, + 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x8133, 0x39b: 0x8133, 0x39c: 0x812e, 0x39d: 0x8133, + 0x39e: 0x8133, 0x39f: 0x812e, + 0x3b0: 0x811f, + // Block 0xf, offset 0x3c0 + 0x3ca: 0x8133, 0x3cb: 0x8133, + 0x3cc: 0x8133, 0x3cd: 0x8133, 0x3ce: 0x8133, 0x3cf: 0x812e, 0x3d0: 0x812e, 0x3d1: 0x812e, + 0x3d2: 0x812e, 0x3d3: 0x812e, 0x3d4: 0x8133, 0x3d5: 0x8133, 0x3d6: 0x8133, 0x3d7: 0x8133, + 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x8133, 0x3dd: 0x8133, + 0x3de: 0x8133, 0x3df: 0x8133, 0x3e0: 0x8133, 0x3e1: 0x8133, 0x3e3: 0x812e, + 0x3e4: 0x8133, 0x3e5: 0x8133, 0x3e6: 0x812e, 0x3e7: 0x8133, 0x3e8: 0x8133, 0x3e9: 0x812e, + 0x3ea: 0x8133, 0x3eb: 0x8133, 0x3ec: 0x8133, 0x3ed: 0x812e, 0x3ee: 0x812e, 0x3ef: 0x812e, + 0x3f0: 0x8117, 0x3f1: 0x8118, 0x3f2: 0x8119, 0x3f3: 0x8133, 0x3f4: 0x8133, 0x3f5: 0x8133, + 0x3f6: 0x812e, 0x3f7: 0x8133, 0x3f8: 0x8133, 0x3f9: 0x812e, 0x3fa: 0x812e, 0x3fb: 0x8133, + 0x3fc: 0x8133, 0x3fd: 0x8133, 0x3fe: 0x8133, 0x3ff: 0x8133, + // Block 0x10, offset 0x400 + 0x405: 0xa000, + 0x406: 0x2e5d, 0x407: 0xa000, 0x408: 0x2e65, 0x409: 0xa000, 0x40a: 0x2e6d, 0x40b: 0xa000, + 0x40c: 0x2e75, 0x40d: 0xa000, 0x40e: 0x2e7d, 0x411: 0xa000, + 0x412: 0x2e85, + 0x434: 0x8103, 0x435: 0x9900, + 0x43a: 0xa000, 0x43b: 0x2e8d, + 0x43c: 0xa000, 0x43d: 0x2e95, 0x43e: 0xa000, 0x43f: 0xa000, + // Block 0x11, offset 0x440 + 0x440: 0x8133, 0x441: 0x8133, 0x442: 0x812e, 0x443: 0x8133, 0x444: 0x8133, 0x445: 0x8133, + 0x446: 0x8133, 0x447: 0x8133, 0x448: 0x8133, 0x449: 0x8133, 0x44a: 0x812e, 0x44b: 0x8133, + 0x44c: 0x8133, 0x44d: 0x8136, 0x44e: 0x812b, 0x44f: 0x812e, 0x450: 0x812a, 0x451: 0x8133, + 0x452: 0x8133, 0x453: 0x8133, 0x454: 0x8133, 0x455: 0x8133, 0x456: 0x8133, 0x457: 0x8133, + 0x458: 0x8133, 0x459: 0x8133, 0x45a: 0x8133, 0x45b: 0x8133, 0x45c: 0x8133, 0x45d: 0x8133, + 0x45e: 0x8133, 0x45f: 0x8133, 0x460: 0x8133, 0x461: 0x8133, 0x462: 0x8133, 0x463: 0x8133, + 0x464: 0x8133, 0x465: 0x8133, 0x466: 0x8133, 0x467: 0x8133, 0x468: 0x8133, 0x469: 0x8133, + 0x46a: 0x8133, 0x46b: 0x8133, 0x46c: 0x8133, 0x46d: 0x8133, 0x46e: 0x8133, 0x46f: 0x8133, + 0x470: 0x8133, 0x471: 0x8133, 0x472: 0x8133, 0x473: 0x8133, 0x474: 0x8133, 0x475: 0x8133, + 0x476: 0x8134, 0x477: 0x8132, 0x478: 0x8132, 0x479: 0x812e, 0x47a: 0x812d, 0x47b: 0x8133, + 0x47c: 0x8135, 0x47d: 0x812e, 0x47e: 0x8133, 0x47f: 0x812e, + // Block 0x12, offset 0x480 + 0x480: 0x30d8, 0x481: 0x33e4, 0x482: 0x30e2, 0x483: 0x33ee, 0x484: 0x30e7, 0x485: 0x33f3, + 0x486: 0x30ec, 0x487: 0x33f8, 0x488: 0x3a0d, 0x489: 0x3b9c, 0x48a: 0x3105, 0x48b: 0x3411, + 0x48c: 0x310f, 0x48d: 0x341b, 0x48e: 0x311e, 0x48f: 0x342a, 0x490: 0x3114, 0x491: 0x3420, + 0x492: 0x3119, 0x493: 0x3425, 0x494: 0x3a30, 0x495: 0x3bbf, 0x496: 0x3a37, 0x497: 0x3bc6, + 0x498: 0x315a, 0x499: 0x3466, 0x49a: 0x315f, 0x49b: 0x346b, 0x49c: 0x3a45, 0x49d: 0x3bd4, + 0x49e: 0x3164, 0x49f: 0x3470, 0x4a0: 0x3173, 0x4a1: 0x347f, 0x4a2: 0x3191, 0x4a3: 0x349d, + 0x4a4: 0x31a0, 0x4a5: 0x34ac, 0x4a6: 0x3196, 0x4a7: 0x34a2, 0x4a8: 0x31a5, 0x4a9: 0x34b1, + 0x4aa: 0x31aa, 0x4ab: 0x34b6, 0x4ac: 0x31f0, 0x4ad: 0x34fc, 0x4ae: 0x3a4c, 0x4af: 0x3bdb, + 0x4b0: 0x31fa, 0x4b1: 0x350b, 0x4b2: 0x3204, 0x4b3: 0x3515, 0x4b4: 0x320e, 0x4b5: 0x351f, + 0x4b6: 0x4805, 0x4b7: 0x4896, 0x4b8: 0x3a53, 0x4b9: 0x3be2, 0x4ba: 0x3227, 0x4bb: 0x3538, + 0x4bc: 0x3222, 0x4bd: 0x3533, 0x4be: 0x322c, 0x4bf: 0x353d, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x3231, 0x4c1: 0x3542, 0x4c2: 0x3236, 0x4c3: 0x3547, 0x4c4: 0x324a, 0x4c5: 0x355b, + 0x4c6: 0x3254, 0x4c7: 0x3565, 0x4c8: 0x3263, 0x4c9: 0x3574, 0x4ca: 0x325e, 0x4cb: 0x356f, + 0x4cc: 0x3a76, 0x4cd: 0x3c05, 0x4ce: 0x3a84, 0x4cf: 0x3c13, 0x4d0: 0x3a8b, 0x4d1: 0x3c1a, + 0x4d2: 0x3a92, 0x4d3: 0x3c21, 0x4d4: 0x3290, 0x4d5: 0x35a1, 0x4d6: 0x3295, 0x4d7: 0x35a6, + 0x4d8: 0x329f, 0x4d9: 0x35b0, 0x4da: 0x4832, 0x4db: 0x48c3, 0x4dc: 0x3ad8, 0x4dd: 0x3c67, + 0x4de: 0x32b8, 0x4df: 0x35c9, 0x4e0: 0x32c2, 0x4e1: 0x35d3, 0x4e2: 0x4841, 0x4e3: 0x48d2, + 0x4e4: 0x3adf, 0x4e5: 0x3c6e, 0x4e6: 0x3ae6, 0x4e7: 0x3c75, 0x4e8: 0x3aed, 0x4e9: 0x3c7c, + 0x4ea: 0x32d1, 0x4eb: 0x35e2, 0x4ec: 0x32db, 0x4ed: 0x35f1, 0x4ee: 0x32ef, 0x4ef: 0x3605, + 0x4f0: 0x32ea, 0x4f1: 0x3600, 0x4f2: 0x332b, 0x4f3: 0x3641, 0x4f4: 0x333a, 0x4f5: 0x3650, + 0x4f6: 0x3335, 0x4f7: 0x364b, 0x4f8: 0x3af4, 0x4f9: 0x3c83, 0x4fa: 0x3afb, 0x4fb: 0x3c8a, + 0x4fc: 0x333f, 0x4fd: 0x3655, 0x4fe: 0x3344, 0x4ff: 0x365a, + // Block 0x14, offset 0x500 + 0x500: 0x3349, 0x501: 0x365f, 0x502: 0x334e, 0x503: 0x3664, 0x504: 0x335d, 0x505: 0x3673, + 0x506: 0x3358, 0x507: 0x366e, 0x508: 0x3362, 0x509: 0x367d, 0x50a: 0x3367, 0x50b: 0x3682, + 0x50c: 0x336c, 0x50d: 0x3687, 0x50e: 0x338a, 0x50f: 0x36a5, 0x510: 0x33a3, 0x511: 0x36c3, + 0x512: 0x33b2, 0x513: 0x36d2, 0x514: 0x33b7, 0x515: 0x36d7, 0x516: 0x34bb, 0x517: 0x35e7, + 0x518: 0x3678, 0x519: 0x36b4, 0x51b: 0x3712, + 0x520: 0x47e2, 0x521: 0x4873, 0x522: 0x30c4, 0x523: 0x33d0, + 0x524: 0x39b9, 0x525: 0x3b48, 0x526: 0x39b2, 0x527: 0x3b41, 0x528: 0x39c7, 0x529: 0x3b56, + 0x52a: 0x39c0, 0x52b: 0x3b4f, 0x52c: 0x39ff, 0x52d: 0x3b8e, 0x52e: 0x39d5, 0x52f: 0x3b64, + 0x530: 0x39ce, 0x531: 0x3b5d, 0x532: 0x39e3, 0x533: 0x3b72, 0x534: 0x39dc, 0x535: 0x3b6b, + 0x536: 0x3a06, 0x537: 0x3b95, 0x538: 0x47f6, 0x539: 0x4887, 0x53a: 0x3141, 0x53b: 0x344d, + 0x53c: 0x312d, 0x53d: 0x3439, 0x53e: 0x3a1b, 0x53f: 0x3baa, + // Block 0x15, offset 0x540 + 0x540: 0x3a14, 0x541: 0x3ba3, 0x542: 0x3a29, 0x543: 0x3bb8, 0x544: 0x3a22, 0x545: 0x3bb1, + 0x546: 0x3a3e, 0x547: 0x3bcd, 0x548: 0x31d2, 0x549: 0x34de, 0x54a: 0x31e6, 0x54b: 0x34f2, + 0x54c: 0x4828, 0x54d: 0x48b9, 0x54e: 0x3277, 0x54f: 0x3588, 0x550: 0x3a61, 0x551: 0x3bf0, + 0x552: 0x3a5a, 0x553: 0x3be9, 0x554: 0x3a6f, 0x555: 0x3bfe, 0x556: 0x3a68, 0x557: 0x3bf7, + 0x558: 0x3aca, 0x559: 0x3c59, 0x55a: 0x3aae, 0x55b: 0x3c3d, 0x55c: 0x3aa7, 0x55d: 0x3c36, + 0x55e: 0x3abc, 0x55f: 0x3c4b, 0x560: 0x3ab5, 0x561: 0x3c44, 0x562: 0x3ac3, 0x563: 0x3c52, + 0x564: 0x3326, 0x565: 0x363c, 0x566: 0x3308, 0x567: 0x361e, 0x568: 0x3b25, 0x569: 0x3cb4, + 0x56a: 0x3b1e, 0x56b: 0x3cad, 0x56c: 0x3b33, 0x56d: 0x3cc2, 0x56e: 0x3b2c, 0x56f: 0x3cbb, + 0x570: 0x3b3a, 0x571: 0x3cc9, 0x572: 0x3371, 0x573: 0x368c, 0x574: 0x3399, 0x575: 0x36b9, + 0x576: 0x3394, 0x577: 0x36af, 0x578: 0x3380, 0x579: 0x369b, + // Block 0x16, offset 0x580 + 0x580: 0x4945, 0x581: 0x494b, 0x582: 0x4a5f, 0x583: 0x4a77, 0x584: 0x4a67, 0x585: 0x4a7f, + 0x586: 0x4a6f, 0x587: 0x4a87, 0x588: 0x48eb, 0x589: 0x48f1, 0x58a: 0x49cf, 0x58b: 0x49e7, + 0x58c: 0x49d7, 0x58d: 0x49ef, 0x58e: 0x49df, 0x58f: 0x49f7, 0x590: 0x4957, 0x591: 0x495d, + 0x592: 0x3ef9, 0x593: 0x3f09, 0x594: 0x3f01, 0x595: 0x3f11, + 0x598: 0x48f7, 0x599: 0x48fd, 0x59a: 0x3e29, 0x59b: 0x3e39, 0x59c: 0x3e31, 0x59d: 0x3e41, + 0x5a0: 0x496f, 0x5a1: 0x4975, 0x5a2: 0x4a8f, 0x5a3: 0x4aa7, + 0x5a4: 0x4a97, 0x5a5: 0x4aaf, 0x5a6: 0x4a9f, 0x5a7: 0x4ab7, 0x5a8: 0x4903, 0x5a9: 0x4909, + 0x5aa: 0x49ff, 0x5ab: 0x4a17, 0x5ac: 0x4a07, 0x5ad: 0x4a1f, 0x5ae: 0x4a0f, 0x5af: 0x4a27, + 0x5b0: 0x4987, 0x5b1: 0x498d, 0x5b2: 0x3f59, 0x5b3: 0x3f71, 0x5b4: 0x3f61, 0x5b5: 0x3f79, + 0x5b6: 0x3f69, 0x5b7: 0x3f81, 0x5b8: 0x490f, 0x5b9: 0x4915, 0x5ba: 0x3e59, 0x5bb: 0x3e71, + 0x5bc: 0x3e61, 0x5bd: 0x3e79, 0x5be: 0x3e69, 0x5bf: 0x3e81, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x4993, 0x5c1: 0x4999, 0x5c2: 0x3f89, 0x5c3: 0x3f99, 0x5c4: 0x3f91, 0x5c5: 0x3fa1, + 0x5c8: 0x491b, 0x5c9: 0x4921, 0x5ca: 0x3e89, 0x5cb: 0x3e99, + 0x5cc: 0x3e91, 0x5cd: 0x3ea1, 0x5d0: 0x49a5, 0x5d1: 0x49ab, + 0x5d2: 0x3fc1, 0x5d3: 0x3fd9, 0x5d4: 0x3fc9, 0x5d5: 0x3fe1, 0x5d6: 0x3fd1, 0x5d7: 0x3fe9, + 0x5d9: 0x4927, 0x5db: 0x3ea9, 0x5dd: 0x3eb1, + 0x5df: 0x3eb9, 0x5e0: 0x49bd, 0x5e1: 0x49c3, 0x5e2: 0x4abf, 0x5e3: 0x4ad7, + 0x5e4: 0x4ac7, 0x5e5: 0x4adf, 0x5e6: 0x4acf, 0x5e7: 0x4ae7, 0x5e8: 0x492d, 0x5e9: 0x4933, + 0x5ea: 0x4a2f, 0x5eb: 0x4a47, 0x5ec: 0x4a37, 0x5ed: 0x4a4f, 0x5ee: 0x4a3f, 0x5ef: 0x4a57, + 0x5f0: 0x4939, 0x5f1: 0x445f, 0x5f2: 0x37d2, 0x5f3: 0x4465, 0x5f4: 0x4963, 0x5f5: 0x446b, + 0x5f6: 0x37e4, 0x5f7: 0x4471, 0x5f8: 0x3802, 0x5f9: 0x4477, 0x5fa: 0x381a, 0x5fb: 0x447d, + 0x5fc: 0x49b1, 0x5fd: 0x4483, + // Block 0x18, offset 0x600 + 0x600: 0x3ee1, 0x601: 0x3ee9, 0x602: 0x42c5, 0x603: 0x42e3, 0x604: 0x42cf, 0x605: 0x42ed, + 0x606: 0x42d9, 0x607: 0x42f7, 0x608: 0x3e19, 0x609: 0x3e21, 0x60a: 0x4211, 0x60b: 0x422f, + 0x60c: 0x421b, 0x60d: 0x4239, 0x60e: 0x4225, 0x60f: 0x4243, 0x610: 0x3f29, 0x611: 0x3f31, + 0x612: 0x4301, 0x613: 0x431f, 0x614: 0x430b, 0x615: 0x4329, 0x616: 0x4315, 0x617: 0x4333, + 0x618: 0x3e49, 0x619: 0x3e51, 0x61a: 0x424d, 0x61b: 0x426b, 0x61c: 0x4257, 0x61d: 0x4275, + 0x61e: 0x4261, 0x61f: 0x427f, 0x620: 0x4001, 0x621: 0x4009, 0x622: 0x433d, 0x623: 0x435b, + 0x624: 0x4347, 0x625: 0x4365, 0x626: 0x4351, 0x627: 0x436f, 0x628: 0x3ec1, 0x629: 0x3ec9, + 0x62a: 0x4289, 0x62b: 0x42a7, 0x62c: 0x4293, 0x62d: 0x42b1, 0x62e: 0x429d, 0x62f: 0x42bb, + 0x630: 0x37c6, 0x631: 0x37c0, 0x632: 0x3ed1, 0x633: 0x37cc, 0x634: 0x3ed9, + 0x636: 0x4951, 0x637: 0x3ef1, 0x638: 0x3736, 0x639: 0x3730, 0x63a: 0x3724, 0x63b: 0x442f, + 0x63c: 0x373c, 0x63d: 0x8100, 0x63e: 0x0257, 0x63f: 0xa100, + // Block 0x19, offset 0x640 + 0x640: 0x8100, 0x641: 0x36e8, 0x642: 0x3f19, 0x643: 0x37de, 0x644: 0x3f21, + 0x646: 0x497b, 0x647: 0x3f39, 0x648: 0x3742, 0x649: 0x4435, 0x64a: 0x374e, 0x64b: 0x443b, + 0x64c: 0x375a, 0x64d: 0x3cd0, 0x64e: 0x3cd7, 0x64f: 0x3cde, 0x650: 0x37f6, 0x651: 0x37f0, + 0x652: 0x3f41, 0x653: 0x4625, 0x656: 0x37fc, 0x657: 0x3f51, + 0x658: 0x3772, 0x659: 0x376c, 0x65a: 0x3760, 0x65b: 0x4441, 0x65d: 0x3ce5, + 0x65e: 0x3cec, 0x65f: 0x3cf3, 0x660: 0x382c, 0x661: 0x3826, 0x662: 0x3fa9, 0x663: 0x462d, + 0x664: 0x380e, 0x665: 0x3814, 0x666: 0x3832, 0x667: 0x3fb9, 0x668: 0x37a2, 0x669: 0x379c, + 0x66a: 0x3790, 0x66b: 0x444d, 0x66c: 0x378a, 0x66d: 0x36dc, 0x66e: 0x4429, 0x66f: 0x0081, + 0x672: 0x3ff1, 0x673: 0x3838, 0x674: 0x3ff9, + 0x676: 0x49c9, 0x677: 0x4011, 0x678: 0x377e, 0x679: 0x4447, 0x67a: 0x37ae, 0x67b: 0x4459, + 0x67c: 0x37ba, 0x67d: 0x4397, 0x67e: 0xa100, + // Block 0x1a, offset 0x680 + 0x681: 0x3d47, 0x683: 0xa000, 0x684: 0x3d4e, 0x685: 0xa000, + 0x687: 0x3d55, 0x688: 0xa000, 0x689: 0x3d5c, + 0x68d: 0xa000, + 0x6a0: 0x30a6, 0x6a1: 0xa000, 0x6a2: 0x3d6a, + 0x6a4: 0xa000, 0x6a5: 0xa000, + 0x6ad: 0x3d63, 0x6ae: 0x30a1, 0x6af: 0x30ab, + 0x6b0: 0x3d71, 0x6b1: 0x3d78, 0x6b2: 0xa000, 0x6b3: 0xa000, 0x6b4: 0x3d7f, 0x6b5: 0x3d86, + 0x6b6: 0xa000, 0x6b7: 0xa000, 0x6b8: 0x3d8d, 0x6b9: 0x3d94, 0x6ba: 0xa000, 0x6bb: 0xa000, + 0x6bc: 0xa000, 0x6bd: 0xa000, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3d9b, 0x6c1: 0x3da2, 0x6c2: 0xa000, 0x6c3: 0xa000, 0x6c4: 0x3db7, 0x6c5: 0x3dbe, + 0x6c6: 0xa000, 0x6c7: 0xa000, 0x6c8: 0x3dc5, 0x6c9: 0x3dcc, + 0x6d1: 0xa000, + 0x6d2: 0xa000, + 0x6e2: 0xa000, + 0x6e8: 0xa000, 0x6e9: 0xa000, + 0x6eb: 0xa000, 0x6ec: 0x3de1, 0x6ed: 0x3de8, 0x6ee: 0x3def, 0x6ef: 0x3df6, + 0x6f2: 0xa000, 0x6f3: 0xa000, 0x6f4: 0xa000, 0x6f5: 0xa000, + // Block 0x1c, offset 0x700 + 0x706: 0xa000, 0x70b: 0xa000, + 0x70c: 0x4049, 0x70d: 0xa000, 0x70e: 0x4051, 0x70f: 0xa000, 0x710: 0x4059, 0x711: 0xa000, + 0x712: 0x4061, 0x713: 0xa000, 0x714: 0x4069, 0x715: 0xa000, 0x716: 0x4071, 0x717: 0xa000, + 0x718: 0x4079, 0x719: 0xa000, 0x71a: 0x4081, 0x71b: 0xa000, 0x71c: 0x4089, 0x71d: 0xa000, + 0x71e: 0x4091, 0x71f: 0xa000, 0x720: 0x4099, 0x721: 0xa000, 0x722: 0x40a1, + 0x724: 0xa000, 0x725: 0x40a9, 0x726: 0xa000, 0x727: 0x40b1, 0x728: 0xa000, 0x729: 0x40b9, + 0x72f: 0xa000, + 0x730: 0x40c1, 0x731: 0x40c9, 0x732: 0xa000, 0x733: 0x40d1, 0x734: 0x40d9, 0x735: 0xa000, + 0x736: 0x40e1, 0x737: 0x40e9, 0x738: 0xa000, 0x739: 0x40f1, 0x73a: 0x40f9, 0x73b: 0xa000, + 0x73c: 0x4101, 0x73d: 0x4109, + // Block 0x1d, offset 0x740 + 0x754: 0x4041, + 0x759: 0x9904, 0x75a: 0x9904, 0x75b: 0x8100, 0x75c: 0x8100, 0x75d: 0xa000, + 0x75e: 0x4111, + 0x766: 0xa000, + 0x76b: 0xa000, 0x76c: 0x4121, 0x76d: 0xa000, 0x76e: 0x4129, 0x76f: 0xa000, + 0x770: 0x4131, 0x771: 0xa000, 0x772: 0x4139, 0x773: 0xa000, 0x774: 0x4141, 0x775: 0xa000, + 0x776: 0x4149, 0x777: 0xa000, 0x778: 0x4151, 0x779: 0xa000, 0x77a: 0x4159, 0x77b: 0xa000, + 0x77c: 0x4161, 0x77d: 0xa000, 0x77e: 0x4169, 0x77f: 0xa000, + // Block 0x1e, offset 0x780 + 0x780: 0x4171, 0x781: 0xa000, 0x782: 0x4179, 0x784: 0xa000, 0x785: 0x4181, + 0x786: 0xa000, 0x787: 0x4189, 0x788: 0xa000, 0x789: 0x4191, + 0x78f: 0xa000, 0x790: 0x4199, 0x791: 0x41a1, + 0x792: 0xa000, 0x793: 0x41a9, 0x794: 0x41b1, 0x795: 0xa000, 0x796: 0x41b9, 0x797: 0x41c1, + 0x798: 0xa000, 0x799: 0x41c9, 0x79a: 0x41d1, 0x79b: 0xa000, 0x79c: 0x41d9, 0x79d: 0x41e1, + 0x7af: 0xa000, + 0x7b0: 0xa000, 0x7b1: 0xa000, 0x7b2: 0xa000, 0x7b4: 0x4119, + 0x7b7: 0x41e9, 0x7b8: 0x41f1, 0x7b9: 0x41f9, 0x7ba: 0x4201, + 0x7bd: 0xa000, 0x7be: 0x4209, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x1472, 0x7c1: 0x0df6, 0x7c2: 0x14ce, 0x7c3: 0x149a, 0x7c4: 0x0f52, 0x7c5: 0x07e6, + 0x7c6: 0x09da, 0x7c7: 0x1726, 0x7c8: 0x1726, 0x7c9: 0x0b06, 0x7ca: 0x155a, 0x7cb: 0x0a3e, + 0x7cc: 0x0b02, 0x7cd: 0x0cea, 0x7ce: 0x10ca, 0x7cf: 0x125a, 0x7d0: 0x1392, 0x7d1: 0x13ce, + 0x7d2: 0x1402, 0x7d3: 0x1516, 0x7d4: 0x0e6e, 0x7d5: 0x0efa, 0x7d6: 0x0fa6, 0x7d7: 0x103e, + 0x7d8: 0x135a, 0x7d9: 0x1542, 0x7da: 0x166e, 0x7db: 0x080a, 0x7dc: 0x09ae, 0x7dd: 0x0e82, + 0x7de: 0x0fca, 0x7df: 0x138e, 0x7e0: 0x16be, 0x7e1: 0x0bae, 0x7e2: 0x0f72, 0x7e3: 0x137e, + 0x7e4: 0x1412, 0x7e5: 0x0d1e, 0x7e6: 0x12b6, 0x7e7: 0x13da, 0x7e8: 0x0c1a, 0x7e9: 0x0e0a, + 0x7ea: 0x0f12, 0x7eb: 0x1016, 0x7ec: 0x1522, 0x7ed: 0x084a, 0x7ee: 0x08e2, 0x7ef: 0x094e, + 0x7f0: 0x0d86, 0x7f1: 0x0e7a, 0x7f2: 0x0fc6, 0x7f3: 0x10ea, 0x7f4: 0x1272, 0x7f5: 0x1386, + 0x7f6: 0x139e, 0x7f7: 0x14c2, 0x7f8: 0x15ea, 0x7f9: 0x169e, 0x7fa: 0x16ba, 0x7fb: 0x1126, + 0x7fc: 0x1166, 0x7fd: 0x121e, 0x7fe: 0x133e, 0x7ff: 0x1576, + // Block 0x20, offset 0x800 + 0x800: 0x16c6, 0x801: 0x1446, 0x802: 0x0ac2, 0x803: 0x0c36, 0x804: 0x11d6, 0x805: 0x1296, + 0x806: 0x0ffa, 0x807: 0x112e, 0x808: 0x1492, 0x809: 0x15e2, 0x80a: 0x0abe, 0x80b: 0x0b8a, + 0x80c: 0x0e72, 0x80d: 0x0f26, 0x80e: 0x0f5a, 0x80f: 0x120e, 0x810: 0x1236, 0x811: 0x15a2, + 0x812: 0x094a, 0x813: 0x12a2, 0x814: 0x08ee, 0x815: 0x08ea, 0x816: 0x1192, 0x817: 0x1222, + 0x818: 0x1356, 0x819: 0x15aa, 0x81a: 0x1462, 0x81b: 0x0d22, 0x81c: 0x0e6e, 0x81d: 0x1452, + 0x81e: 0x07f2, 0x81f: 0x0b5e, 0x820: 0x0c8e, 0x821: 0x102a, 0x822: 0x10aa, 0x823: 0x096e, + 0x824: 0x1136, 0x825: 0x085a, 0x826: 0x0c72, 0x827: 0x07d2, 0x828: 0x0ee6, 0x829: 0x0d9e, + 0x82a: 0x120a, 0x82b: 0x09c2, 0x82c: 0x0aae, 0x82d: 0x10f6, 0x82e: 0x135e, 0x82f: 0x1436, + 0x830: 0x0eb2, 0x831: 0x14f2, 0x832: 0x0ede, 0x833: 0x0d32, 0x834: 0x1316, 0x835: 0x0d52, + 0x836: 0x10a6, 0x837: 0x0826, 0x838: 0x08a2, 0x839: 0x08e6, 0x83a: 0x0e4e, 0x83b: 0x11f6, + 0x83c: 0x12ee, 0x83d: 0x1442, 0x83e: 0x1556, 0x83f: 0x0956, + // Block 0x21, offset 0x840 + 0x840: 0x0a0a, 0x841: 0x0b12, 0x842: 0x0c2a, 0x843: 0x0dba, 0x844: 0x0f76, 0x845: 0x113a, + 0x846: 0x1592, 0x847: 0x1676, 0x848: 0x16ca, 0x849: 0x16e2, 0x84a: 0x0932, 0x84b: 0x0dee, + 0x84c: 0x0e9e, 0x84d: 0x14e6, 0x84e: 0x0bf6, 0x84f: 0x0cd2, 0x850: 0x0cee, 0x851: 0x0d7e, + 0x852: 0x0f66, 0x853: 0x0fb2, 0x854: 0x1062, 0x855: 0x1186, 0x856: 0x122a, 0x857: 0x128e, + 0x858: 0x14d6, 0x859: 0x1366, 0x85a: 0x14fe, 0x85b: 0x157a, 0x85c: 0x090a, 0x85d: 0x0936, + 0x85e: 0x0a1e, 0x85f: 0x0fa2, 0x860: 0x13ee, 0x861: 0x1436, 0x862: 0x0c16, 0x863: 0x0c86, + 0x864: 0x0d4a, 0x865: 0x0eaa, 0x866: 0x11d2, 0x867: 0x101e, 0x868: 0x0836, 0x869: 0x0a7a, + 0x86a: 0x0b5e, 0x86b: 0x0bc2, 0x86c: 0x0c92, 0x86d: 0x103a, 0x86e: 0x1056, 0x86f: 0x1266, + 0x870: 0x1286, 0x871: 0x155e, 0x872: 0x15de, 0x873: 0x15ee, 0x874: 0x162a, 0x875: 0x084e, + 0x876: 0x117a, 0x877: 0x154a, 0x878: 0x15c6, 0x879: 0x0caa, 0x87a: 0x0812, 0x87b: 0x0872, + 0x87c: 0x0b62, 0x87d: 0x0b82, 0x87e: 0x0daa, 0x87f: 0x0e6e, + // Block 0x22, offset 0x880 + 0x880: 0x0fbe, 0x881: 0x10c6, 0x882: 0x1372, 0x883: 0x1512, 0x884: 0x171e, 0x885: 0x0dde, + 0x886: 0x159e, 0x887: 0x092e, 0x888: 0x0e2a, 0x889: 0x0e36, 0x88a: 0x0f0a, 0x88b: 0x0f42, + 0x88c: 0x1046, 0x88d: 0x10a2, 0x88e: 0x1122, 0x88f: 0x1206, 0x890: 0x1636, 0x891: 0x08aa, + 0x892: 0x0cfe, 0x893: 0x15ae, 0x894: 0x0862, 0x895: 0x0ba6, 0x896: 0x0f2a, 0x897: 0x14da, + 0x898: 0x0c62, 0x899: 0x0cb2, 0x89a: 0x0e3e, 0x89b: 0x102a, 0x89c: 0x15b6, 0x89d: 0x0912, + 0x89e: 0x09fa, 0x89f: 0x0b92, 0x8a0: 0x0dce, 0x8a1: 0x0e1a, 0x8a2: 0x0e5a, 0x8a3: 0x0eee, + 0x8a4: 0x1042, 0x8a5: 0x10b6, 0x8a6: 0x1252, 0x8a7: 0x13f2, 0x8a8: 0x13fe, 0x8a9: 0x1552, + 0x8aa: 0x15d2, 0x8ab: 0x097e, 0x8ac: 0x0f46, 0x8ad: 0x09fe, 0x8ae: 0x0fc2, 0x8af: 0x1066, + 0x8b0: 0x1382, 0x8b1: 0x15ba, 0x8b2: 0x16a6, 0x8b3: 0x16ce, 0x8b4: 0x0e32, 0x8b5: 0x0f22, + 0x8b6: 0x12be, 0x8b7: 0x11b2, 0x8b8: 0x11be, 0x8b9: 0x11e2, 0x8ba: 0x1012, 0x8bb: 0x0f9a, + 0x8bc: 0x145e, 0x8bd: 0x082e, 0x8be: 0x1326, 0x8bf: 0x0916, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0906, 0x8c1: 0x0c06, 0x8c2: 0x0d26, 0x8c3: 0x11ee, 0x8c4: 0x0b4e, 0x8c5: 0x0efe, + 0x8c6: 0x0dea, 0x8c7: 0x14e2, 0x8c8: 0x13e2, 0x8c9: 0x15a6, 0x8ca: 0x141e, 0x8cb: 0x0c22, + 0x8cc: 0x0882, 0x8cd: 0x0a56, 0x8d0: 0x0aaa, + 0x8d2: 0x0dda, 0x8d5: 0x08f2, 0x8d6: 0x101a, 0x8d7: 0x10de, + 0x8d8: 0x1142, 0x8d9: 0x115e, 0x8da: 0x1162, 0x8db: 0x1176, 0x8dc: 0x15f6, 0x8dd: 0x11e6, + 0x8de: 0x126a, 0x8e0: 0x138a, 0x8e2: 0x144e, + 0x8e5: 0x1502, 0x8e6: 0x152e, + 0x8ea: 0x164a, 0x8eb: 0x164e, 0x8ec: 0x1652, 0x8ed: 0x16b6, 0x8ee: 0x1526, 0x8ef: 0x15c2, + 0x8f0: 0x0852, 0x8f1: 0x0876, 0x8f2: 0x088a, 0x8f3: 0x0946, 0x8f4: 0x0952, 0x8f5: 0x0992, + 0x8f6: 0x0a46, 0x8f7: 0x0a62, 0x8f8: 0x0a6a, 0x8f9: 0x0aa6, 0x8fa: 0x0ab2, 0x8fb: 0x0b8e, + 0x8fc: 0x0b96, 0x8fd: 0x0c9e, 0x8fe: 0x0cc6, 0x8ff: 0x0cce, + // Block 0x24, offset 0x900 + 0x900: 0x0ce6, 0x901: 0x0d92, 0x902: 0x0dc2, 0x903: 0x0de2, 0x904: 0x0e52, 0x905: 0x0f16, + 0x906: 0x0f32, 0x907: 0x0f62, 0x908: 0x0fb6, 0x909: 0x0fd6, 0x90a: 0x104a, 0x90b: 0x112a, + 0x90c: 0x1146, 0x90d: 0x114e, 0x90e: 0x114a, 0x90f: 0x1152, 0x910: 0x1156, 0x911: 0x115a, + 0x912: 0x116e, 0x913: 0x1172, 0x914: 0x1196, 0x915: 0x11aa, 0x916: 0x11c6, 0x917: 0x122a, + 0x918: 0x1232, 0x919: 0x123a, 0x91a: 0x124e, 0x91b: 0x1276, 0x91c: 0x12c6, 0x91d: 0x12fa, + 0x91e: 0x12fa, 0x91f: 0x1362, 0x920: 0x140a, 0x921: 0x1422, 0x922: 0x1456, 0x923: 0x145a, + 0x924: 0x149e, 0x925: 0x14a2, 0x926: 0x14fa, 0x927: 0x1502, 0x928: 0x15d6, 0x929: 0x161a, + 0x92a: 0x1632, 0x92b: 0x0c96, 0x92c: 0x184b, 0x92d: 0x12de, + 0x930: 0x07da, 0x931: 0x08de, 0x932: 0x089e, 0x933: 0x0846, 0x934: 0x0886, 0x935: 0x08b2, + 0x936: 0x0942, 0x937: 0x095e, 0x938: 0x0a46, 0x939: 0x0a32, 0x93a: 0x0a42, 0x93b: 0x0a5e, + 0x93c: 0x0aaa, 0x93d: 0x0aba, 0x93e: 0x0afe, 0x93f: 0x0b0a, + // Block 0x25, offset 0x940 + 0x940: 0x0b26, 0x941: 0x0b36, 0x942: 0x0c1e, 0x943: 0x0c26, 0x944: 0x0c56, 0x945: 0x0c76, + 0x946: 0x0ca6, 0x947: 0x0cbe, 0x948: 0x0cae, 0x949: 0x0cce, 0x94a: 0x0cc2, 0x94b: 0x0ce6, + 0x94c: 0x0d02, 0x94d: 0x0d5a, 0x94e: 0x0d66, 0x94f: 0x0d6e, 0x950: 0x0d96, 0x951: 0x0dda, + 0x952: 0x0e0a, 0x953: 0x0e0e, 0x954: 0x0e22, 0x955: 0x0ea2, 0x956: 0x0eb2, 0x957: 0x0f0a, + 0x958: 0x0f56, 0x959: 0x0f4e, 0x95a: 0x0f62, 0x95b: 0x0f7e, 0x95c: 0x0fb6, 0x95d: 0x110e, + 0x95e: 0x0fda, 0x95f: 0x100e, 0x960: 0x101a, 0x961: 0x105a, 0x962: 0x1076, 0x963: 0x109a, + 0x964: 0x10be, 0x965: 0x10c2, 0x966: 0x10de, 0x967: 0x10e2, 0x968: 0x10f2, 0x969: 0x1106, + 0x96a: 0x1102, 0x96b: 0x1132, 0x96c: 0x11ae, 0x96d: 0x11c6, 0x96e: 0x11de, 0x96f: 0x1216, + 0x970: 0x122a, 0x971: 0x1246, 0x972: 0x1276, 0x973: 0x132a, 0x974: 0x1352, 0x975: 0x13c6, + 0x976: 0x140e, 0x977: 0x141a, 0x978: 0x1422, 0x979: 0x143a, 0x97a: 0x144e, 0x97b: 0x143e, + 0x97c: 0x1456, 0x97d: 0x1452, 0x97e: 0x144a, 0x97f: 0x145a, + // Block 0x26, offset 0x980 + 0x980: 0x1466, 0x981: 0x14a2, 0x982: 0x14de, 0x983: 0x150e, 0x984: 0x1546, 0x985: 0x1566, + 0x986: 0x15b2, 0x987: 0x15d6, 0x988: 0x15f6, 0x989: 0x160a, 0x98a: 0x161a, 0x98b: 0x1626, + 0x98c: 0x1632, 0x98d: 0x1686, 0x98e: 0x1726, 0x98f: 0x17e2, 0x990: 0x17dd, 0x991: 0x180f, + 0x992: 0x0702, 0x993: 0x072a, 0x994: 0x072e, 0x995: 0x1891, 0x996: 0x18be, 0x997: 0x1936, + 0x998: 0x1712, 0x999: 0x1722, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x07f6, 0x9c1: 0x07ee, 0x9c2: 0x07fe, 0x9c3: 0x1774, 0x9c4: 0x0842, 0x9c5: 0x0852, + 0x9c6: 0x0856, 0x9c7: 0x085e, 0x9c8: 0x0866, 0x9c9: 0x086a, 0x9ca: 0x0876, 0x9cb: 0x086e, + 0x9cc: 0x06ae, 0x9cd: 0x1788, 0x9ce: 0x088a, 0x9cf: 0x088e, 0x9d0: 0x0892, 0x9d1: 0x08ae, + 0x9d2: 0x1779, 0x9d3: 0x06b2, 0x9d4: 0x089a, 0x9d5: 0x08ba, 0x9d6: 0x1783, 0x9d7: 0x08ca, + 0x9d8: 0x08d2, 0x9d9: 0x0832, 0x9da: 0x08da, 0x9db: 0x08de, 0x9dc: 0x195e, 0x9dd: 0x08fa, + 0x9de: 0x0902, 0x9df: 0x06ba, 0x9e0: 0x091a, 0x9e1: 0x091e, 0x9e2: 0x0926, 0x9e3: 0x092a, + 0x9e4: 0x06be, 0x9e5: 0x0942, 0x9e6: 0x0946, 0x9e7: 0x0952, 0x9e8: 0x095e, 0x9e9: 0x0962, + 0x9ea: 0x0966, 0x9eb: 0x096e, 0x9ec: 0x098e, 0x9ed: 0x0992, 0x9ee: 0x099a, 0x9ef: 0x09aa, + 0x9f0: 0x09b2, 0x9f1: 0x09b6, 0x9f2: 0x09b6, 0x9f3: 0x09b6, 0x9f4: 0x1797, 0x9f5: 0x0f8e, + 0x9f6: 0x09ca, 0x9f7: 0x09d2, 0x9f8: 0x179c, 0x9f9: 0x09de, 0x9fa: 0x09e6, 0x9fb: 0x09ee, + 0x9fc: 0x0a16, 0x9fd: 0x0a02, 0x9fe: 0x0a0e, 0x9ff: 0x0a12, + // Block 0x28, offset 0xa00 + 0xa00: 0x0a1a, 0xa01: 0x0a22, 0xa02: 0x0a26, 0xa03: 0x0a2e, 0xa04: 0x0a36, 0xa05: 0x0a3a, + 0xa06: 0x0a3a, 0xa07: 0x0a42, 0xa08: 0x0a4a, 0xa09: 0x0a4e, 0xa0a: 0x0a5a, 0xa0b: 0x0a7e, + 0xa0c: 0x0a62, 0xa0d: 0x0a82, 0xa0e: 0x0a66, 0xa0f: 0x0a6e, 0xa10: 0x0906, 0xa11: 0x0aca, + 0xa12: 0x0a92, 0xa13: 0x0a96, 0xa14: 0x0a9a, 0xa15: 0x0a8e, 0xa16: 0x0aa2, 0xa17: 0x0a9e, + 0xa18: 0x0ab6, 0xa19: 0x17a1, 0xa1a: 0x0ad2, 0xa1b: 0x0ad6, 0xa1c: 0x0ade, 0xa1d: 0x0aea, + 0xa1e: 0x0af2, 0xa1f: 0x0b0e, 0xa20: 0x17a6, 0xa21: 0x17ab, 0xa22: 0x0b1a, 0xa23: 0x0b1e, + 0xa24: 0x0b22, 0xa25: 0x0b16, 0xa26: 0x0b2a, 0xa27: 0x06c2, 0xa28: 0x06c6, 0xa29: 0x0b32, + 0xa2a: 0x0b3a, 0xa2b: 0x0b3a, 0xa2c: 0x17b0, 0xa2d: 0x0b56, 0xa2e: 0x0b5a, 0xa2f: 0x0b5e, + 0xa30: 0x0b66, 0xa31: 0x17b5, 0xa32: 0x0b6e, 0xa33: 0x0b72, 0xa34: 0x0c4a, 0xa35: 0x0b7a, + 0xa36: 0x06ca, 0xa37: 0x0b86, 0xa38: 0x0b96, 0xa39: 0x0ba2, 0xa3a: 0x0b9e, 0xa3b: 0x17bf, + 0xa3c: 0x0baa, 0xa3d: 0x17c4, 0xa3e: 0x0bb6, 0xa3f: 0x0bb2, + // Block 0x29, offset 0xa40 + 0xa40: 0x0bba, 0xa41: 0x0bca, 0xa42: 0x0bce, 0xa43: 0x06ce, 0xa44: 0x0bde, 0xa45: 0x0be6, + 0xa46: 0x0bea, 0xa47: 0x0bee, 0xa48: 0x06d2, 0xa49: 0x17c9, 0xa4a: 0x06d6, 0xa4b: 0x0c0a, + 0xa4c: 0x0c0e, 0xa4d: 0x0c12, 0xa4e: 0x0c1a, 0xa4f: 0x1990, 0xa50: 0x0c32, 0xa51: 0x17d3, + 0xa52: 0x17d3, 0xa53: 0x12d2, 0xa54: 0x0c42, 0xa55: 0x0c42, 0xa56: 0x06da, 0xa57: 0x17f6, + 0xa58: 0x18c8, 0xa59: 0x0c52, 0xa5a: 0x0c5a, 0xa5b: 0x06de, 0xa5c: 0x0c6e, 0xa5d: 0x0c7e, + 0xa5e: 0x0c82, 0xa5f: 0x0c8a, 0xa60: 0x0c9a, 0xa61: 0x06e6, 0xa62: 0x06e2, 0xa63: 0x0c9e, + 0xa64: 0x17d8, 0xa65: 0x0ca2, 0xa66: 0x0cb6, 0xa67: 0x0cba, 0xa68: 0x0cbe, 0xa69: 0x0cba, + 0xa6a: 0x0cca, 0xa6b: 0x0cce, 0xa6c: 0x0cde, 0xa6d: 0x0cd6, 0xa6e: 0x0cda, 0xa6f: 0x0ce2, + 0xa70: 0x0ce6, 0xa71: 0x0cea, 0xa72: 0x0cf6, 0xa73: 0x0cfa, 0xa74: 0x0d12, 0xa75: 0x0d1a, + 0xa76: 0x0d2a, 0xa77: 0x0d3e, 0xa78: 0x17e7, 0xa79: 0x0d3a, 0xa7a: 0x0d2e, 0xa7b: 0x0d46, + 0xa7c: 0x0d4e, 0xa7d: 0x0d62, 0xa7e: 0x17ec, 0xa7f: 0x0d6a, + // Block 0x2a, offset 0xa80 + 0xa80: 0x0d5e, 0xa81: 0x0d56, 0xa82: 0x06ea, 0xa83: 0x0d72, 0xa84: 0x0d7a, 0xa85: 0x0d82, + 0xa86: 0x0d76, 0xa87: 0x06ee, 0xa88: 0x0d92, 0xa89: 0x0d9a, 0xa8a: 0x17f1, 0xa8b: 0x0dc6, + 0xa8c: 0x0dfa, 0xa8d: 0x0dd6, 0xa8e: 0x06fa, 0xa8f: 0x0de2, 0xa90: 0x06f6, 0xa91: 0x06f2, + 0xa92: 0x08be, 0xa93: 0x08c2, 0xa94: 0x0dfe, 0xa95: 0x0de6, 0xa96: 0x12a6, 0xa97: 0x075e, + 0xa98: 0x0e0a, 0xa99: 0x0e0e, 0xa9a: 0x0e12, 0xa9b: 0x0e26, 0xa9c: 0x0e1e, 0xa9d: 0x180a, + 0xa9e: 0x06fe, 0xa9f: 0x0e3a, 0xaa0: 0x0e2e, 0xaa1: 0x0e4a, 0xaa2: 0x0e52, 0xaa3: 0x1814, + 0xaa4: 0x0e56, 0xaa5: 0x0e42, 0xaa6: 0x0e5e, 0xaa7: 0x0702, 0xaa8: 0x0e62, 0xaa9: 0x0e66, + 0xaaa: 0x0e6a, 0xaab: 0x0e76, 0xaac: 0x1819, 0xaad: 0x0e7e, 0xaae: 0x0706, 0xaaf: 0x0e8a, + 0xab0: 0x181e, 0xab1: 0x0e8e, 0xab2: 0x070a, 0xab3: 0x0e9a, 0xab4: 0x0ea6, 0xab5: 0x0eb2, + 0xab6: 0x0eb6, 0xab7: 0x1823, 0xab8: 0x17ba, 0xab9: 0x1828, 0xaba: 0x0ed6, 0xabb: 0x182d, + 0xabc: 0x0ee2, 0xabd: 0x0eea, 0xabe: 0x0eda, 0xabf: 0x0ef6, + // Block 0x2b, offset 0xac0 + 0xac0: 0x0f06, 0xac1: 0x0f16, 0xac2: 0x0f0a, 0xac3: 0x0f0e, 0xac4: 0x0f1a, 0xac5: 0x0f1e, + 0xac6: 0x1832, 0xac7: 0x0f02, 0xac8: 0x0f36, 0xac9: 0x0f3a, 0xaca: 0x070e, 0xacb: 0x0f4e, + 0xacc: 0x0f4a, 0xacd: 0x1837, 0xace: 0x0f2e, 0xacf: 0x0f6a, 0xad0: 0x183c, 0xad1: 0x1841, + 0xad2: 0x0f6e, 0xad3: 0x0f82, 0xad4: 0x0f7e, 0xad5: 0x0f7a, 0xad6: 0x0712, 0xad7: 0x0f86, + 0xad8: 0x0f96, 0xad9: 0x0f92, 0xada: 0x0f9e, 0xadb: 0x177e, 0xadc: 0x0fae, 0xadd: 0x1846, + 0xade: 0x0fba, 0xadf: 0x1850, 0xae0: 0x0fce, 0xae1: 0x0fda, 0xae2: 0x0fee, 0xae3: 0x1855, + 0xae4: 0x1002, 0xae5: 0x1006, 0xae6: 0x185a, 0xae7: 0x185f, 0xae8: 0x1022, 0xae9: 0x1032, + 0xaea: 0x0716, 0xaeb: 0x1036, 0xaec: 0x071a, 0xaed: 0x071a, 0xaee: 0x104e, 0xaef: 0x1052, + 0xaf0: 0x105a, 0xaf1: 0x105e, 0xaf2: 0x106a, 0xaf3: 0x071e, 0xaf4: 0x1082, 0xaf5: 0x1864, + 0xaf6: 0x109e, 0xaf7: 0x1869, 0xaf8: 0x10aa, 0xaf9: 0x17ce, 0xafa: 0x10ba, 0xafb: 0x186e, + 0xafc: 0x1873, 0xafd: 0x1878, 0xafe: 0x0722, 0xaff: 0x0726, + // Block 0x2c, offset 0xb00 + 0xb00: 0x10f2, 0xb01: 0x1882, 0xb02: 0x187d, 0xb03: 0x1887, 0xb04: 0x188c, 0xb05: 0x10fa, + 0xb06: 0x10fe, 0xb07: 0x10fe, 0xb08: 0x1106, 0xb09: 0x072e, 0xb0a: 0x110a, 0xb0b: 0x0732, + 0xb0c: 0x0736, 0xb0d: 0x1896, 0xb0e: 0x111e, 0xb0f: 0x1126, 0xb10: 0x1132, 0xb11: 0x073a, + 0xb12: 0x189b, 0xb13: 0x1156, 0xb14: 0x18a0, 0xb15: 0x18a5, 0xb16: 0x1176, 0xb17: 0x118e, + 0xb18: 0x073e, 0xb19: 0x1196, 0xb1a: 0x119a, 0xb1b: 0x119e, 0xb1c: 0x18aa, 0xb1d: 0x18af, + 0xb1e: 0x18af, 0xb1f: 0x11b6, 0xb20: 0x0742, 0xb21: 0x18b4, 0xb22: 0x11ca, 0xb23: 0x11ce, + 0xb24: 0x0746, 0xb25: 0x18b9, 0xb26: 0x11ea, 0xb27: 0x074a, 0xb28: 0x11fa, 0xb29: 0x11f2, + 0xb2a: 0x1202, 0xb2b: 0x18c3, 0xb2c: 0x121a, 0xb2d: 0x074e, 0xb2e: 0x1226, 0xb2f: 0x122e, + 0xb30: 0x123e, 0xb31: 0x0752, 0xb32: 0x18cd, 0xb33: 0x18d2, 0xb34: 0x0756, 0xb35: 0x18d7, + 0xb36: 0x1256, 0xb37: 0x18dc, 0xb38: 0x1262, 0xb39: 0x126e, 0xb3a: 0x1276, 0xb3b: 0x18e1, + 0xb3c: 0x18e6, 0xb3d: 0x128a, 0xb3e: 0x18eb, 0xb3f: 0x1292, + // Block 0x2d, offset 0xb40 + 0xb40: 0x17fb, 0xb41: 0x075a, 0xb42: 0x12aa, 0xb43: 0x12ae, 0xb44: 0x0762, 0xb45: 0x12b2, + 0xb46: 0x0b2e, 0xb47: 0x18f0, 0xb48: 0x18f5, 0xb49: 0x1800, 0xb4a: 0x1805, 0xb4b: 0x12d2, + 0xb4c: 0x12d6, 0xb4d: 0x14ee, 0xb4e: 0x0766, 0xb4f: 0x1302, 0xb50: 0x12fe, 0xb51: 0x1306, + 0xb52: 0x093a, 0xb53: 0x130a, 0xb54: 0x130e, 0xb55: 0x1312, 0xb56: 0x131a, 0xb57: 0x18fa, + 0xb58: 0x1316, 0xb59: 0x131e, 0xb5a: 0x1332, 0xb5b: 0x1336, 0xb5c: 0x1322, 0xb5d: 0x133a, + 0xb5e: 0x134e, 0xb5f: 0x1362, 0xb60: 0x132e, 0xb61: 0x1342, 0xb62: 0x1346, 0xb63: 0x134a, + 0xb64: 0x18ff, 0xb65: 0x1909, 0xb66: 0x1904, 0xb67: 0x076a, 0xb68: 0x136a, 0xb69: 0x136e, + 0xb6a: 0x1376, 0xb6b: 0x191d, 0xb6c: 0x137a, 0xb6d: 0x190e, 0xb6e: 0x076e, 0xb6f: 0x0772, + 0xb70: 0x1913, 0xb71: 0x1918, 0xb72: 0x0776, 0xb73: 0x139a, 0xb74: 0x139e, 0xb75: 0x13a2, + 0xb76: 0x13a6, 0xb77: 0x13b2, 0xb78: 0x13ae, 0xb79: 0x13ba, 0xb7a: 0x13b6, 0xb7b: 0x13c6, + 0xb7c: 0x13be, 0xb7d: 0x13c2, 0xb7e: 0x13ca, 0xb7f: 0x077a, + // Block 0x2e, offset 0xb80 + 0xb80: 0x13d2, 0xb81: 0x13d6, 0xb82: 0x077e, 0xb83: 0x13e6, 0xb84: 0x13ea, 0xb85: 0x1922, + 0xb86: 0x13f6, 0xb87: 0x13fa, 0xb88: 0x0782, 0xb89: 0x1406, 0xb8a: 0x06b6, 0xb8b: 0x1927, + 0xb8c: 0x192c, 0xb8d: 0x0786, 0xb8e: 0x078a, 0xb8f: 0x1432, 0xb90: 0x144a, 0xb91: 0x1466, + 0xb92: 0x1476, 0xb93: 0x1931, 0xb94: 0x148a, 0xb95: 0x148e, 0xb96: 0x14a6, 0xb97: 0x14b2, + 0xb98: 0x193b, 0xb99: 0x178d, 0xb9a: 0x14be, 0xb9b: 0x14ba, 0xb9c: 0x14c6, 0xb9d: 0x1792, + 0xb9e: 0x14d2, 0xb9f: 0x14de, 0xba0: 0x1940, 0xba1: 0x1945, 0xba2: 0x151e, 0xba3: 0x152a, + 0xba4: 0x1532, 0xba5: 0x194a, 0xba6: 0x1536, 0xba7: 0x1562, 0xba8: 0x156e, 0xba9: 0x1572, + 0xbaa: 0x156a, 0xbab: 0x157e, 0xbac: 0x1582, 0xbad: 0x194f, 0xbae: 0x158e, 0xbaf: 0x078e, + 0xbb0: 0x1596, 0xbb1: 0x1954, 0xbb2: 0x0792, 0xbb3: 0x15ce, 0xbb4: 0x0bbe, 0xbb5: 0x15e6, + 0xbb6: 0x1959, 0xbb7: 0x1963, 0xbb8: 0x0796, 0xbb9: 0x079a, 0xbba: 0x160e, 0xbbb: 0x1968, + 0xbbc: 0x079e, 0xbbd: 0x196d, 0xbbe: 0x1626, 0xbbf: 0x1626, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x162e, 0xbc1: 0x1972, 0xbc2: 0x1646, 0xbc3: 0x07a2, 0xbc4: 0x1656, 0xbc5: 0x1662, + 0xbc6: 0x166a, 0xbc7: 0x1672, 0xbc8: 0x07a6, 0xbc9: 0x1977, 0xbca: 0x1686, 0xbcb: 0x16a2, + 0xbcc: 0x16ae, 0xbcd: 0x07aa, 0xbce: 0x07ae, 0xbcf: 0x16b2, 0xbd0: 0x197c, 0xbd1: 0x07b2, + 0xbd2: 0x1981, 0xbd3: 0x1986, 0xbd4: 0x198b, 0xbd5: 0x16d6, 0xbd6: 0x07b6, 0xbd7: 0x16ea, + 0xbd8: 0x16f2, 0xbd9: 0x16f6, 0xbda: 0x16fe, 0xbdb: 0x1706, 0xbdc: 0x170e, 0xbdd: 0x1995, +} + +// nfcIndex: 22 blocks, 1408 entries, 1408 bytes +// Block 0 is the zero block. +var nfcIndex = [1408]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x2e, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x2f, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x30, 0xcb: 0x31, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x32, + 0xd0: 0x09, 0xd1: 0x33, 0xd2: 0x34, 0xd3: 0x0a, 0xd6: 0x0b, 0xd7: 0x35, + 0xd8: 0x36, 0xd9: 0x0c, 0xdb: 0x37, 0xdc: 0x38, 0xdd: 0x39, 0xdf: 0x3a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x3b, 0x121: 0x3c, 0x122: 0x3d, 0x123: 0x0d, 0x124: 0x3e, 0x125: 0x3f, 0x126: 0x40, 0x127: 0x41, + 0x128: 0x42, 0x129: 0x43, 0x12a: 0x44, 0x12b: 0x45, 0x12c: 0x40, 0x12d: 0x46, 0x12e: 0x47, 0x12f: 0x48, + 0x130: 0x44, 0x131: 0x49, 0x132: 0x4a, 0x133: 0x4b, 0x134: 0x4c, 0x135: 0x4d, 0x137: 0x4e, + 0x138: 0x4f, 0x139: 0x50, 0x13a: 0x51, 0x13b: 0x52, 0x13c: 0x53, 0x13d: 0x54, 0x13e: 0x55, 0x13f: 0x56, + // Block 0x5, offset 0x140 + 0x140: 0x57, 0x142: 0x58, 0x144: 0x59, 0x145: 0x5a, 0x146: 0x5b, 0x147: 0x5c, + 0x14d: 0x5d, + 0x15c: 0x5e, 0x15f: 0x5f, + 0x162: 0x60, 0x164: 0x61, + 0x168: 0x62, 0x169: 0x63, 0x16a: 0x64, 0x16b: 0x65, 0x16c: 0x0e, 0x16d: 0x66, 0x16e: 0x67, 0x16f: 0x68, + 0x170: 0x69, 0x173: 0x6a, 0x177: 0x0f, + 0x178: 0x10, 0x179: 0x11, 0x17a: 0x12, 0x17b: 0x13, 0x17c: 0x14, 0x17d: 0x15, 0x17e: 0x16, 0x17f: 0x17, + // Block 0x6, offset 0x180 + 0x180: 0x6b, 0x183: 0x6c, 0x184: 0x6d, 0x186: 0x6e, 0x187: 0x6f, + 0x188: 0x70, 0x189: 0x18, 0x18a: 0x19, 0x18b: 0x71, 0x18c: 0x72, + 0x1ab: 0x73, + 0x1b3: 0x74, 0x1b5: 0x75, 0x1b7: 0x76, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x77, 0x1c1: 0x1a, 0x1c2: 0x1b, 0x1c3: 0x1c, 0x1c4: 0x78, 0x1c5: 0x79, + 0x1c9: 0x7a, 0x1cc: 0x7b, 0x1cd: 0x7c, + // Block 0x8, offset 0x200 + 0x219: 0x7d, 0x21a: 0x7e, 0x21b: 0x7f, + 0x220: 0x80, 0x223: 0x81, 0x224: 0x82, 0x225: 0x83, 0x226: 0x84, 0x227: 0x85, + 0x22a: 0x86, 0x22b: 0x87, 0x22f: 0x88, + 0x230: 0x89, 0x231: 0x8a, 0x232: 0x8b, 0x233: 0x8c, 0x234: 0x8d, 0x235: 0x8e, 0x236: 0x8f, 0x237: 0x89, + 0x238: 0x8a, 0x239: 0x8b, 0x23a: 0x8c, 0x23b: 0x8d, 0x23c: 0x8e, 0x23d: 0x8f, 0x23e: 0x89, 0x23f: 0x8a, + // Block 0x9, offset 0x240 + 0x240: 0x8b, 0x241: 0x8c, 0x242: 0x8d, 0x243: 0x8e, 0x244: 0x8f, 0x245: 0x89, 0x246: 0x8a, 0x247: 0x8b, + 0x248: 0x8c, 0x249: 0x8d, 0x24a: 0x8e, 0x24b: 0x8f, 0x24c: 0x89, 0x24d: 0x8a, 0x24e: 0x8b, 0x24f: 0x8c, + 0x250: 0x8d, 0x251: 0x8e, 0x252: 0x8f, 0x253: 0x89, 0x254: 0x8a, 0x255: 0x8b, 0x256: 0x8c, 0x257: 0x8d, + 0x258: 0x8e, 0x259: 0x8f, 0x25a: 0x89, 0x25b: 0x8a, 0x25c: 0x8b, 0x25d: 0x8c, 0x25e: 0x8d, 0x25f: 0x8e, + 0x260: 0x8f, 0x261: 0x89, 0x262: 0x8a, 0x263: 0x8b, 0x264: 0x8c, 0x265: 0x8d, 0x266: 0x8e, 0x267: 0x8f, + 0x268: 0x89, 0x269: 0x8a, 0x26a: 0x8b, 0x26b: 0x8c, 0x26c: 0x8d, 0x26d: 0x8e, 0x26e: 0x8f, 0x26f: 0x89, + 0x270: 0x8a, 0x271: 0x8b, 0x272: 0x8c, 0x273: 0x8d, 0x274: 0x8e, 0x275: 0x8f, 0x276: 0x89, 0x277: 0x8a, + 0x278: 0x8b, 0x279: 0x8c, 0x27a: 0x8d, 0x27b: 0x8e, 0x27c: 0x8f, 0x27d: 0x89, 0x27e: 0x8a, 0x27f: 0x8b, + // Block 0xa, offset 0x280 + 0x280: 0x8c, 0x281: 0x8d, 0x282: 0x8e, 0x283: 0x8f, 0x284: 0x89, 0x285: 0x8a, 0x286: 0x8b, 0x287: 0x8c, + 0x288: 0x8d, 0x289: 0x8e, 0x28a: 0x8f, 0x28b: 0x89, 0x28c: 0x8a, 0x28d: 0x8b, 0x28e: 0x8c, 0x28f: 0x8d, + 0x290: 0x8e, 0x291: 0x8f, 0x292: 0x89, 0x293: 0x8a, 0x294: 0x8b, 0x295: 0x8c, 0x296: 0x8d, 0x297: 0x8e, + 0x298: 0x8f, 0x299: 0x89, 0x29a: 0x8a, 0x29b: 0x8b, 0x29c: 0x8c, 0x29d: 0x8d, 0x29e: 0x8e, 0x29f: 0x8f, + 0x2a0: 0x89, 0x2a1: 0x8a, 0x2a2: 0x8b, 0x2a3: 0x8c, 0x2a4: 0x8d, 0x2a5: 0x8e, 0x2a6: 0x8f, 0x2a7: 0x89, + 0x2a8: 0x8a, 0x2a9: 0x8b, 0x2aa: 0x8c, 0x2ab: 0x8d, 0x2ac: 0x8e, 0x2ad: 0x8f, 0x2ae: 0x89, 0x2af: 0x8a, + 0x2b0: 0x8b, 0x2b1: 0x8c, 0x2b2: 0x8d, 0x2b3: 0x8e, 0x2b4: 0x8f, 0x2b5: 0x89, 0x2b6: 0x8a, 0x2b7: 0x8b, + 0x2b8: 0x8c, 0x2b9: 0x8d, 0x2ba: 0x8e, 0x2bb: 0x8f, 0x2bc: 0x89, 0x2bd: 0x8a, 0x2be: 0x8b, 0x2bf: 0x8c, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x8d, 0x2c1: 0x8e, 0x2c2: 0x8f, 0x2c3: 0x89, 0x2c4: 0x8a, 0x2c5: 0x8b, 0x2c6: 0x8c, 0x2c7: 0x8d, + 0x2c8: 0x8e, 0x2c9: 0x8f, 0x2ca: 0x89, 0x2cb: 0x8a, 0x2cc: 0x8b, 0x2cd: 0x8c, 0x2ce: 0x8d, 0x2cf: 0x8e, + 0x2d0: 0x8f, 0x2d1: 0x89, 0x2d2: 0x8a, 0x2d3: 0x8b, 0x2d4: 0x8c, 0x2d5: 0x8d, 0x2d6: 0x8e, 0x2d7: 0x8f, + 0x2d8: 0x89, 0x2d9: 0x8a, 0x2da: 0x8b, 0x2db: 0x8c, 0x2dc: 0x8d, 0x2dd: 0x8e, 0x2de: 0x90, + // Block 0xc, offset 0x300 + 0x324: 0x1d, 0x325: 0x1e, 0x326: 0x1f, 0x327: 0x20, + 0x328: 0x21, 0x329: 0x22, 0x32a: 0x23, 0x32b: 0x24, 0x32c: 0x91, 0x32d: 0x92, 0x32e: 0x93, + 0x331: 0x94, 0x332: 0x95, 0x333: 0x96, 0x334: 0x97, + 0x338: 0x98, 0x339: 0x99, 0x33a: 0x9a, 0x33b: 0x9b, 0x33e: 0x9c, 0x33f: 0x9d, + // Block 0xd, offset 0x340 + 0x347: 0x9e, + 0x34b: 0x9f, 0x34d: 0xa0, + 0x368: 0xa1, 0x36b: 0xa2, + 0x374: 0xa3, + 0x37a: 0xa4, 0x37b: 0xa5, 0x37d: 0xa6, 0x37e: 0xa7, + // Block 0xe, offset 0x380 + 0x381: 0xa8, 0x382: 0xa9, 0x384: 0xaa, 0x385: 0x84, 0x387: 0xab, + 0x388: 0xac, 0x38b: 0xad, 0x38c: 0xae, 0x38d: 0xaf, + 0x391: 0xb0, 0x392: 0xb1, 0x393: 0xb2, 0x396: 0xb3, 0x397: 0xb4, + 0x398: 0x75, 0x39a: 0xb5, 0x39c: 0xb6, + 0x3a0: 0xb7, 0x3a4: 0xb8, 0x3a5: 0xb9, 0x3a7: 0xba, + 0x3a8: 0xbb, 0x3a9: 0xbc, 0x3aa: 0xbd, + 0x3b0: 0x75, 0x3b5: 0xbe, 0x3b6: 0xbf, + 0x3bd: 0xc0, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xc1, 0x3ec: 0xc2, + 0x3ff: 0xc3, + // Block 0x10, offset 0x400 + 0x432: 0xc4, + // Block 0x11, offset 0x440 + 0x445: 0xc5, 0x446: 0xc6, 0x447: 0xc7, + 0x449: 0xc8, + // Block 0x12, offset 0x480 + 0x480: 0xc9, 0x482: 0xca, 0x484: 0xc2, + 0x48a: 0xcb, 0x48b: 0xcc, + 0x493: 0xcd, + 0x4a3: 0xce, 0x4a5: 0xcf, + // Block 0x13, offset 0x4c0 + 0x4c8: 0xd0, + // Block 0x14, offset 0x500 + 0x520: 0x25, 0x521: 0x26, 0x522: 0x27, 0x523: 0x28, 0x524: 0x29, 0x525: 0x2a, 0x526: 0x2b, 0x527: 0x2c, + 0x528: 0x2d, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfcSparseOffset: 163 entries, 326 bytes +var nfcSparseOffset = []uint16{0x0, 0x5, 0x9, 0xb, 0xd, 0x18, 0x28, 0x2a, 0x2f, 0x3a, 0x49, 0x56, 0x5e, 0x63, 0x68, 0x6a, 0x6e, 0x76, 0x7d, 0x80, 0x88, 0x8c, 0x90, 0x92, 0x94, 0x9d, 0xa1, 0xa8, 0xad, 0xb0, 0xba, 0xbd, 0xc4, 0xcc, 0xcf, 0xd1, 0xd4, 0xd6, 0xdb, 0xec, 0xf8, 0xfa, 0x100, 0x102, 0x104, 0x106, 0x108, 0x10a, 0x10c, 0x10f, 0x112, 0x114, 0x117, 0x11a, 0x11e, 0x124, 0x12b, 0x134, 0x136, 0x139, 0x13b, 0x146, 0x14a, 0x158, 0x15b, 0x161, 0x167, 0x172, 0x176, 0x178, 0x17a, 0x17c, 0x17e, 0x180, 0x186, 0x18a, 0x18c, 0x18e, 0x196, 0x19a, 0x19d, 0x19f, 0x1a1, 0x1a4, 0x1a7, 0x1a9, 0x1ab, 0x1ad, 0x1af, 0x1b5, 0x1b8, 0x1ba, 0x1c1, 0x1c7, 0x1cd, 0x1d5, 0x1db, 0x1e1, 0x1e7, 0x1eb, 0x1f9, 0x202, 0x205, 0x208, 0x20a, 0x20d, 0x20f, 0x213, 0x218, 0x21a, 0x21c, 0x221, 0x227, 0x229, 0x22b, 0x22d, 0x233, 0x236, 0x238, 0x23a, 0x23c, 0x242, 0x246, 0x24a, 0x252, 0x259, 0x25c, 0x25f, 0x261, 0x264, 0x26c, 0x270, 0x277, 0x27a, 0x280, 0x282, 0x285, 0x287, 0x28a, 0x28f, 0x291, 0x293, 0x295, 0x297, 0x299, 0x29c, 0x29e, 0x2a0, 0x2a2, 0x2a4, 0x2a6, 0x2a8, 0x2b5, 0x2bf, 0x2c1, 0x2c3, 0x2c9, 0x2cb, 0x2cd, 0x2cf, 0x2d3, 0x2d5, 0x2d8} + +// nfcSparseValues: 730 entries, 2920 bytes +var nfcSparseValues = [730]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0000, lo: 0x04}, + {value: 0xa100, lo: 0xa8, hi: 0xa8}, + {value: 0x8100, lo: 0xaf, hi: 0xaf}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb8, hi: 0xb8}, + // Block 0x1, offset 0x5 + {value: 0x0091, lo: 0x03}, + {value: 0x4823, lo: 0xa0, hi: 0xa1}, + {value: 0x4855, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x9 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + // Block 0x3, offset 0xb + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x98, hi: 0x9d}, + // Block 0x4, offset 0xd + {value: 0x0006, lo: 0x0a}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x85, hi: 0x85}, + {value: 0xa000, lo: 0x89, hi: 0x89}, + {value: 0x4981, lo: 0x8a, hi: 0x8a}, + {value: 0x499f, lo: 0x8b, hi: 0x8b}, + {value: 0x3808, lo: 0x8c, hi: 0x8c}, + {value: 0x3820, lo: 0x8d, hi: 0x8d}, + {value: 0x49b7, lo: 0x8e, hi: 0x8e}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x383e, lo: 0x93, hi: 0x94}, + // Block 0x5, offset 0x18 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x38e6, lo: 0x90, hi: 0x90}, + {value: 0x38f2, lo: 0x91, hi: 0x91}, + {value: 0x38e0, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3958, lo: 0x97, hi: 0x97}, + {value: 0x3922, lo: 0x9c, hi: 0x9c}, + {value: 0x390a, lo: 0x9d, hi: 0x9d}, + {value: 0x3934, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x395e, lo: 0xb6, hi: 0xb6}, + {value: 0x3964, lo: 0xb7, hi: 0xb7}, + // Block 0x6, offset 0x28 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x83, hi: 0x87}, + // Block 0x7, offset 0x2a + {value: 0x0001, lo: 0x04}, + {value: 0x8114, lo: 0x81, hi: 0x82}, + {value: 0x8133, lo: 0x84, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + {value: 0x810e, lo: 0x87, hi: 0x87}, + // Block 0x8, offset 0x2f + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x97}, + {value: 0x811a, lo: 0x98, hi: 0x98}, + {value: 0x811b, lo: 0x99, hi: 0x99}, + {value: 0x811c, lo: 0x9a, hi: 0x9a}, + {value: 0x3982, lo: 0xa2, hi: 0xa2}, + {value: 0x3988, lo: 0xa3, hi: 0xa3}, + {value: 0x3994, lo: 0xa4, hi: 0xa4}, + {value: 0x398e, lo: 0xa5, hi: 0xa5}, + {value: 0x399a, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x9, offset 0x3a + {value: 0x0000, lo: 0x0e}, + {value: 0x39ac, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x39a0, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x39a6, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8133, lo: 0x96, hi: 0x9c}, + {value: 0x8133, lo: 0x9f, hi: 0xa2}, + {value: 0x812e, lo: 0xa3, hi: 0xa3}, + {value: 0x8133, lo: 0xa4, hi: 0xa4}, + {value: 0x8133, lo: 0xa7, hi: 0xa8}, + {value: 0x812e, lo: 0xaa, hi: 0xaa}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + // Block 0xa, offset 0x49 + {value: 0x0000, lo: 0x0c}, + {value: 0x8120, lo: 0x91, hi: 0x91}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x812e, lo: 0xb1, hi: 0xb1}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb5, hi: 0xb6}, + {value: 0x812e, lo: 0xb7, hi: 0xb9}, + {value: 0x8133, lo: 0xba, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbc}, + {value: 0x8133, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbe, hi: 0xbe}, + {value: 0x8133, lo: 0xbf, hi: 0xbf}, + // Block 0xb, offset 0x56 + {value: 0x0005, lo: 0x07}, + {value: 0x8133, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x812e, lo: 0x82, hi: 0x83}, + {value: 0x812e, lo: 0x84, hi: 0x85}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x812e, lo: 0x88, hi: 0x89}, + {value: 0x8133, lo: 0x8a, hi: 0x8a}, + // Block 0xc, offset 0x5e + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0xab, hi: 0xb1}, + {value: 0x812e, lo: 0xb2, hi: 0xb2}, + {value: 0x8133, lo: 0xb3, hi: 0xb3}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0xd, offset 0x63 + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0x96, hi: 0x99}, + {value: 0x8133, lo: 0x9b, hi: 0xa3}, + {value: 0x8133, lo: 0xa5, hi: 0xa7}, + {value: 0x8133, lo: 0xa9, hi: 0xad}, + // Block 0xe, offset 0x68 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + // Block 0xf, offset 0x6a + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0x98, hi: 0x98}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + {value: 0x8133, lo: 0x9c, hi: 0x9f}, + // Block 0x10, offset 0x6e + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x4019, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x4021, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x4029, lo: 0xb4, hi: 0xb4}, + {value: 0x9903, lo: 0xbc, hi: 0xbc}, + // Block 0x11, offset 0x76 + {value: 0x0008, lo: 0x06}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x91, hi: 0x91}, + {value: 0x812e, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x93, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x94}, + {value: 0x465d, lo: 0x98, hi: 0x9f}, + // Block 0x12, offset 0x7d + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x80 + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2dd5, lo: 0x8b, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x469d, lo: 0x9c, hi: 0x9d}, + {value: 0x46ad, lo: 0x9f, hi: 0x9f}, + {value: 0x8133, lo: 0xbe, hi: 0xbe}, + // Block 0x14, offset 0x88 + {value: 0x0000, lo: 0x03}, + {value: 0x46d5, lo: 0xb3, hi: 0xb3}, + {value: 0x46dd, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x15, offset 0x8c + {value: 0x0008, lo: 0x03}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x46b5, lo: 0x99, hi: 0x9b}, + {value: 0x46cd, lo: 0x9e, hi: 0x9e}, + // Block 0x16, offset 0x90 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x17, offset 0x92 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + // Block 0x18, offset 0x94 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ded, lo: 0x88, hi: 0x88}, + {value: 0x2de5, lo: 0x8b, hi: 0x8b}, + {value: 0x2df5, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x46e5, lo: 0x9c, hi: 0x9c}, + {value: 0x46ed, lo: 0x9d, hi: 0x9d}, + // Block 0x19, offset 0x9d + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2dfd, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1a, offset 0xa1 + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e05, lo: 0x8a, hi: 0x8a}, + {value: 0x2e15, lo: 0x8b, hi: 0x8b}, + {value: 0x2e0d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1b, offset 0xa8 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x4031, lo: 0x88, hi: 0x88}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8121, lo: 0x95, hi: 0x96}, + // Block 0x1c, offset 0xad + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1d, offset 0xb0 + {value: 0x0000, lo: 0x09}, + {value: 0x2e1d, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2e25, lo: 0x87, hi: 0x87}, + {value: 0x2e2d, lo: 0x88, hi: 0x88}, + {value: 0x3091, lo: 0x8a, hi: 0x8a}, + {value: 0x2f19, lo: 0x8b, hi: 0x8b}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1e, offset 0xba + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1f, offset 0xbd + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e35, lo: 0x8a, hi: 0x8a}, + {value: 0x2e45, lo: 0x8b, hi: 0x8b}, + {value: 0x2e3d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x20, offset 0xc4 + {value: 0x6ab3, lo: 0x07}, + {value: 0x9905, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4039, lo: 0x9a, hi: 0x9a}, + {value: 0x3099, lo: 0x9c, hi: 0x9c}, + {value: 0x2f24, lo: 0x9d, hi: 0x9d}, + {value: 0x2e4d, lo: 0x9e, hi: 0x9f}, + // Block 0x21, offset 0xcc + {value: 0x0000, lo: 0x02}, + {value: 0x8123, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x22, offset 0xcf + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0x88, hi: 0x8b}, + // Block 0x23, offset 0xd1 + {value: 0x0000, lo: 0x02}, + {value: 0x8125, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x24, offset 0xd4 + {value: 0x0000, lo: 0x01}, + {value: 0x8126, lo: 0x88, hi: 0x8b}, + // Block 0x25, offset 0xd6 + {value: 0x0000, lo: 0x04}, + {value: 0x812e, lo: 0x98, hi: 0x99}, + {value: 0x812e, lo: 0xb5, hi: 0xb5}, + {value: 0x812e, lo: 0xb7, hi: 0xb7}, + {value: 0x812c, lo: 0xb9, hi: 0xb9}, + // Block 0x26, offset 0xdb + {value: 0x0000, lo: 0x10}, + {value: 0x2774, lo: 0x83, hi: 0x83}, + {value: 0x277b, lo: 0x8d, hi: 0x8d}, + {value: 0x2782, lo: 0x92, hi: 0x92}, + {value: 0x2789, lo: 0x97, hi: 0x97}, + {value: 0x2790, lo: 0x9c, hi: 0x9c}, + {value: 0x276d, lo: 0xa9, hi: 0xa9}, + {value: 0x8127, lo: 0xb1, hi: 0xb1}, + {value: 0x8128, lo: 0xb2, hi: 0xb2}, + {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, + {value: 0x8129, lo: 0xb4, hi: 0xb4}, + {value: 0x4bce, lo: 0xb5, hi: 0xb5}, + {value: 0x46f5, lo: 0xb6, hi: 0xb6}, + {value: 0x8200, lo: 0xb7, hi: 0xb7}, + {value: 0x46fd, lo: 0xb8, hi: 0xb8}, + {value: 0x8200, lo: 0xb9, hi: 0xb9}, + {value: 0x8128, lo: 0xba, hi: 0xbd}, + // Block 0x27, offset 0xec + {value: 0x0000, lo: 0x0b}, + {value: 0x8128, lo: 0x80, hi: 0x80}, + {value: 0x4bd7, lo: 0x81, hi: 0x81}, + {value: 0x8133, lo: 0x82, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0x86, hi: 0x87}, + {value: 0x279e, lo: 0x93, hi: 0x93}, + {value: 0x27a5, lo: 0x9d, hi: 0x9d}, + {value: 0x27ac, lo: 0xa2, hi: 0xa2}, + {value: 0x27b3, lo: 0xa7, hi: 0xa7}, + {value: 0x27ba, lo: 0xac, hi: 0xac}, + {value: 0x2797, lo: 0xb9, hi: 0xb9}, + // Block 0x28, offset 0xf8 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x86, hi: 0x86}, + // Block 0x29, offset 0xfa + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2e55, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x2a, offset 0x100 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + // Block 0x2b, offset 0x102 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x104 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x106 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x108 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x10a + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x10c + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x94, hi: 0x95}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x10f + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x112 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x114 + {value: 0x0004, lo: 0x02}, + {value: 0x812f, lo: 0xb9, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x117 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x97, hi: 0x97}, + {value: 0x812e, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x11a + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + {value: 0x8133, lo: 0xb5, hi: 0xbc}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x11e + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + {value: 0x812e, lo: 0xb5, hi: 0xba}, + {value: 0x8133, lo: 0xbb, hi: 0xbc}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x37, offset 0x124 + {value: 0x0000, lo: 0x06}, + {value: 0x812e, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8a}, + {value: 0x8133, lo: 0x8b, hi: 0x8e}, + // Block 0x38, offset 0x12b + {value: 0x0000, lo: 0x08}, + {value: 0x2e9d, lo: 0x80, hi: 0x80}, + {value: 0x2ea5, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2ead, lo: 0x83, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xab, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xac}, + {value: 0x8133, lo: 0xad, hi: 0xb3}, + // Block 0x39, offset 0x134 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xaa, hi: 0xab}, + // Block 0x3a, offset 0x136 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xa6, hi: 0xa6}, + {value: 0x8105, lo: 0xb2, hi: 0xb3}, + // Block 0x3b, offset 0x139 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x3c, offset 0x13b + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812e, lo: 0x95, hi: 0x99}, + {value: 0x8133, lo: 0x9a, hi: 0x9b}, + {value: 0x812e, lo: 0x9c, hi: 0x9f}, + {value: 0x8133, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x8133, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb8, hi: 0xb9}, + // Block 0x3d, offset 0x146 + {value: 0x0004, lo: 0x03}, + {value: 0x052a, lo: 0x80, hi: 0x81}, + {value: 0x8100, lo: 0x97, hi: 0x97}, + {value: 0x8100, lo: 0xbe, hi: 0xbe}, + // Block 0x3e, offset 0x14a + {value: 0x0000, lo: 0x0d}, + {value: 0x8133, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8133, lo: 0x9b, hi: 0x9c}, + {value: 0x8133, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8133, lo: 0xa7, hi: 0xa7}, + {value: 0x812e, lo: 0xa8, hi: 0xa8}, + {value: 0x8133, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xaf}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + // Block 0x3f, offset 0x158 + {value: 0x43bc, lo: 0x02}, + {value: 0x023c, lo: 0xa6, hi: 0xa6}, + {value: 0x0057, lo: 0xaa, hi: 0xab}, + // Block 0x40, offset 0x15b + {value: 0x0007, lo: 0x05}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3cfa, lo: 0x9a, hi: 0x9b}, + {value: 0x3d08, lo: 0xae, hi: 0xae}, + // Block 0x41, offset 0x161 + {value: 0x000e, lo: 0x05}, + {value: 0x3d0f, lo: 0x8d, hi: 0x8e}, + {value: 0x3d16, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x42, offset 0x167 + {value: 0x62c7, lo: 0x0a}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3d24, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3d2b, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3d32, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3d39, lo: 0xa4, hi: 0xa5}, + {value: 0x3d40, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x43, offset 0x172 + {value: 0x0007, lo: 0x03}, + {value: 0x3da9, lo: 0xa0, hi: 0xa1}, + {value: 0x3dd3, lo: 0xa2, hi: 0xa3}, + {value: 0x3dfd, lo: 0xaa, hi: 0xad}, + // Block 0x44, offset 0x176 + {value: 0x0004, lo: 0x01}, + {value: 0x0586, lo: 0xa9, hi: 0xaa}, + // Block 0x45, offset 0x178 + {value: 0x0000, lo: 0x01}, + {value: 0x461e, lo: 0x9c, hi: 0x9c}, + // Block 0x46, offset 0x17a + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xaf, hi: 0xb1}, + // Block 0x47, offset 0x17c + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x48, offset 0x17e + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x180 + {value: 0x0000, lo: 0x05}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x8134, lo: 0xac, hi: 0xac}, + {value: 0x812f, lo: 0xad, hi: 0xad}, + {value: 0x8130, lo: 0xae, hi: 0xaf}, + // Block 0x4a, offset 0x186 + {value: 0x0000, lo: 0x03}, + {value: 0x4be0, lo: 0xb3, hi: 0xb3}, + {value: 0x4be0, lo: 0xb5, hi: 0xb6}, + {value: 0x4be0, lo: 0xba, hi: 0xbf}, + // Block 0x4b, offset 0x18a + {value: 0x0000, lo: 0x01}, + {value: 0x4be0, lo: 0x8f, hi: 0xa3}, + // Block 0x4c, offset 0x18c + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xae, hi: 0xbe}, + // Block 0x4d, offset 0x18e + {value: 0x0000, lo: 0x07}, + {value: 0x8100, lo: 0x84, hi: 0x84}, + {value: 0x8100, lo: 0x87, hi: 0x87}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + {value: 0x8100, lo: 0x9e, hi: 0x9e}, + {value: 0x8100, lo: 0xa1, hi: 0xa1}, + {value: 0x8100, lo: 0xb2, hi: 0xb2}, + {value: 0x8100, lo: 0xbb, hi: 0xbb}, + // Block 0x4e, offset 0x196 + {value: 0x0000, lo: 0x03}, + {value: 0x8100, lo: 0x80, hi: 0x80}, + {value: 0x8100, lo: 0x8b, hi: 0x8b}, + {value: 0x8100, lo: 0x8e, hi: 0x8e}, + // Block 0x4f, offset 0x19a + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + {value: 0x8133, lo: 0xb4, hi: 0xbd}, + // Block 0x50, offset 0x19d + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9e, hi: 0x9f}, + // Block 0x51, offset 0x19f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb1}, + // Block 0x52, offset 0x1a1 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xac, hi: 0xac}, + // Block 0x53, offset 0x1a4 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xa0, hi: 0xb1}, + // Block 0x54, offset 0x1a7 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xab, hi: 0xad}, + // Block 0x55, offset 0x1a9 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x93, hi: 0x93}, + // Block 0x56, offset 0x1ab + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb3, hi: 0xb3}, + // Block 0x57, offset 0x1ad + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + // Block 0x58, offset 0x1af + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb7, hi: 0xb8}, + {value: 0x8133, lo: 0xbe, hi: 0xbf}, + // Block 0x59, offset 0x1b5 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + // Block 0x5a, offset 0x1b8 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xad, hi: 0xad}, + // Block 0x5b, offset 0x1ba + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x5c, offset 0x1c1 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x5d, offset 0x1c7 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x5e, offset 0x1cd + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x5f, offset 0x1d5 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x60, offset 0x1db + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x61, offset 0x1e1 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x62, offset 0x1e7 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x63, offset 0x1eb + {value: 0x0006, lo: 0x0d}, + {value: 0x44d1, lo: 0x9d, hi: 0x9d}, + {value: 0x8116, lo: 0x9e, hi: 0x9e}, + {value: 0x4543, lo: 0x9f, hi: 0x9f}, + {value: 0x4531, lo: 0xaa, hi: 0xab}, + {value: 0x4635, lo: 0xac, hi: 0xac}, + {value: 0x463d, lo: 0xad, hi: 0xad}, + {value: 0x4489, lo: 0xae, hi: 0xb1}, + {value: 0x44a7, lo: 0xb2, hi: 0xb4}, + {value: 0x44bf, lo: 0xb5, hi: 0xb6}, + {value: 0x44cb, lo: 0xb8, hi: 0xb8}, + {value: 0x44d7, lo: 0xb9, hi: 0xbb}, + {value: 0x44ef, lo: 0xbc, hi: 0xbc}, + {value: 0x44f5, lo: 0xbe, hi: 0xbe}, + // Block 0x64, offset 0x1f9 + {value: 0x0006, lo: 0x08}, + {value: 0x44fb, lo: 0x80, hi: 0x81}, + {value: 0x4507, lo: 0x83, hi: 0x84}, + {value: 0x4519, lo: 0x86, hi: 0x89}, + {value: 0x453d, lo: 0x8a, hi: 0x8a}, + {value: 0x44b9, lo: 0x8b, hi: 0x8b}, + {value: 0x44a1, lo: 0x8c, hi: 0x8c}, + {value: 0x44e9, lo: 0x8d, hi: 0x8d}, + {value: 0x4513, lo: 0x8e, hi: 0x8e}, + // Block 0x65, offset 0x202 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0xa4, hi: 0xa5}, + {value: 0x8100, lo: 0xb0, hi: 0xb1}, + // Block 0x66, offset 0x205 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x9b, hi: 0x9d}, + {value: 0x8200, lo: 0x9e, hi: 0xa3}, + // Block 0x67, offset 0x208 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + // Block 0x68, offset 0x20a + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x99, hi: 0x99}, + {value: 0x8200, lo: 0xb2, hi: 0xb4}, + // Block 0x69, offset 0x20d + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xbc, hi: 0xbd}, + // Block 0x6a, offset 0x20f + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0xa0, hi: 0xa6}, + {value: 0x812e, lo: 0xa7, hi: 0xad}, + {value: 0x8133, lo: 0xae, hi: 0xaf}, + // Block 0x6b, offset 0x213 + {value: 0x0000, lo: 0x04}, + {value: 0x8100, lo: 0x89, hi: 0x8c}, + {value: 0x8100, lo: 0xb0, hi: 0xb2}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb6, hi: 0xbf}, + // Block 0x6c, offset 0x218 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x81, hi: 0x8c}, + // Block 0x6d, offset 0x21a + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xb5, hi: 0xba}, + // Block 0x6e, offset 0x21c + {value: 0x0000, lo: 0x04}, + {value: 0x4be0, lo: 0x9e, hi: 0x9f}, + {value: 0x4be0, lo: 0xa3, hi: 0xa3}, + {value: 0x4be0, lo: 0xa5, hi: 0xa6}, + {value: 0x4be0, lo: 0xaa, hi: 0xaf}, + // Block 0x6f, offset 0x221 + {value: 0x0000, lo: 0x05}, + {value: 0x4be0, lo: 0x82, hi: 0x87}, + {value: 0x4be0, lo: 0x8a, hi: 0x8f}, + {value: 0x4be0, lo: 0x92, hi: 0x97}, + {value: 0x4be0, lo: 0x9a, hi: 0x9c}, + {value: 0x8100, lo: 0xa3, hi: 0xa3}, + // Block 0x70, offset 0x227 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0x71, offset 0x229 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xa0, hi: 0xa0}, + // Block 0x72, offset 0x22b + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb6, hi: 0xba}, + // Block 0x73, offset 0x22d + {value: 0x002d, lo: 0x05}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + {value: 0x8133, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x74, offset 0x233 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xa5, hi: 0xa5}, + {value: 0x812e, lo: 0xa6, hi: 0xa6}, + // Block 0x75, offset 0x236 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa4, hi: 0xa7}, + // Block 0x76, offset 0x238 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + // Block 0x77, offset 0x23a + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbf}, + // Block 0x78, offset 0x23c + {value: 0x0000, lo: 0x05}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x8133, lo: 0x88, hi: 0x8a}, + {value: 0x812e, lo: 0x8b, hi: 0x8b}, + {value: 0x8133, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x8d, hi: 0x90}, + // Block 0x79, offset 0x242 + {value: 0x0005, lo: 0x03}, + {value: 0x8133, lo: 0x82, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + // Block 0x7a, offset 0x246 + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xb0, hi: 0xb0}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x24a + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4379, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4383, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x438d, lo: 0xab, hi: 0xab}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x7c, offset 0x252 + {value: 0x0000, lo: 0x06}, + {value: 0x8133, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2eb5, lo: 0xae, hi: 0xae}, + {value: 0x2ebf, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8105, lo: 0xb3, hi: 0xb4}, + // Block 0x7d, offset 0x259 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0x7e, offset 0x25c + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb5, hi: 0xb5}, + {value: 0x8103, lo: 0xb6, hi: 0xb6}, + // Block 0x7f, offset 0x25f + {value: 0x0002, lo: 0x01}, + {value: 0x8103, lo: 0xa9, hi: 0xaa}, + // Block 0x80, offset 0x261 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x81, offset 0x264 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ec9, lo: 0x8b, hi: 0x8b}, + {value: 0x2ed3, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8133, lo: 0xa6, hi: 0xac}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + // Block 0x82, offset 0x26c + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x86, hi: 0x86}, + {value: 0x8133, lo: 0x9e, hi: 0x9e}, + // Block 0x83, offset 0x270 + {value: 0x6a23, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2ee7, lo: 0xbb, hi: 0xbb}, + {value: 0x2edd, lo: 0xbc, hi: 0xbd}, + {value: 0x2ef1, lo: 0xbe, hi: 0xbe}, + // Block 0x84, offset 0x277 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x85, offset 0x27a + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2efb, lo: 0xba, hi: 0xba}, + {value: 0x2f05, lo: 0xbb, hi: 0xbb}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x86, offset 0x280 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x80, hi: 0x80}, + // Block 0x87, offset 0x282 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x88, offset 0x285 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xab, hi: 0xab}, + // Block 0x89, offset 0x287 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb9, hi: 0xb9}, + {value: 0x8103, lo: 0xba, hi: 0xba}, + // Block 0x8a, offset 0x28a + {value: 0x0000, lo: 0x04}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb5, hi: 0xb5}, + {value: 0x2f0f, lo: 0xb8, hi: 0xb8}, + {value: 0x8105, lo: 0xbd, hi: 0xbe}, + // Block 0x8b, offset 0x28f + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x8c, offset 0x291 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + // Block 0x8d, offset 0x293 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x8e, offset 0x295 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x87, hi: 0x87}, + // Block 0x8f, offset 0x297 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x99, hi: 0x99}, + // Block 0x90, offset 0x299 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0x82, hi: 0x82}, + {value: 0x8105, lo: 0x84, hi: 0x85}, + // Block 0x91, offset 0x29c + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x97, hi: 0x97}, + // Block 0x92, offset 0x29e + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x81, hi: 0x82}, + // Block 0x93, offset 0x2a0 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x94, offset 0x2a2 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb6}, + // Block 0x95, offset 0x2a4 + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb0, hi: 0xb1}, + // Block 0x96, offset 0x2a6 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x97, offset 0x2a8 + {value: 0x0000, lo: 0x0c}, + {value: 0x470d, lo: 0x9e, hi: 0x9e}, + {value: 0x4717, lo: 0x9f, hi: 0x9f}, + {value: 0x474b, lo: 0xa0, hi: 0xa0}, + {value: 0x4759, lo: 0xa1, hi: 0xa1}, + {value: 0x4767, lo: 0xa2, hi: 0xa2}, + {value: 0x4775, lo: 0xa3, hi: 0xa3}, + {value: 0x4783, lo: 0xa4, hi: 0xa4}, + {value: 0x812c, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8131, lo: 0xad, hi: 0xad}, + {value: 0x812c, lo: 0xae, hi: 0xb2}, + {value: 0x812e, lo: 0xbb, hi: 0xbf}, + // Block 0x98, offset 0x2b5 + {value: 0x0000, lo: 0x09}, + {value: 0x812e, lo: 0x80, hi: 0x82}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8b}, + {value: 0x8133, lo: 0xaa, hi: 0xad}, + {value: 0x4721, lo: 0xbb, hi: 0xbb}, + {value: 0x472b, lo: 0xbc, hi: 0xbc}, + {value: 0x4791, lo: 0xbd, hi: 0xbd}, + {value: 0x47ad, lo: 0xbe, hi: 0xbe}, + {value: 0x479f, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x2bf + {value: 0x0000, lo: 0x01}, + {value: 0x47bb, lo: 0x80, hi: 0x80}, + // Block 0x9a, offset 0x2c1 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x82, hi: 0x84}, + // Block 0x9b, offset 0x2c3 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0x80, hi: 0x86}, + {value: 0x8133, lo: 0x88, hi: 0x98}, + {value: 0x8133, lo: 0x9b, hi: 0xa1}, + {value: 0x8133, lo: 0xa3, hi: 0xa4}, + {value: 0x8133, lo: 0xa6, hi: 0xaa}, + // Block 0x9c, offset 0x2c9 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + // Block 0x9d, offset 0x2cb + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xae, hi: 0xae}, + // Block 0x9e, offset 0x2cd + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xac, hi: 0xaf}, + // Block 0x9f, offset 0x2cf + {value: 0x0000, lo: 0x03}, + {value: 0x8134, lo: 0xac, hi: 0xad}, + {value: 0x812e, lo: 0xae, hi: 0xae}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + // Block 0xa0, offset 0x2d3 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x90, hi: 0x96}, + // Block 0xa1, offset 0x2d5 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x84, hi: 0x89}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0xa2, offset 0x2d8 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x93, hi: 0x93}, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfkcTrie. Total size: 19260 bytes (18.81 KiB). Checksum: 1a0bbc4c8c24da49. +type nfkcTrie struct{} + +func newNfkcTrie(i int) *nfkcTrie { + return &nfkcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfkcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 95: + return uint16(nfkcValues[n<<6+uint32(b)]) + default: + n -= 95 + return uint16(nfkcSparse.lookup(n, b)) + } +} + +// nfkcValues: 97 blocks, 6208 entries, 12416 bytes +// The third block is the zero block. +var nfkcValues = [6208]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd, + 0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c, + 0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245, + 0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e, + 0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376, + 0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6, + 0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434, + 0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891, + 0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0, + 0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614, + 0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa, + // Block 0x4, offset 0x100 + 0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9, + 0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407, + 0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416, + 0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443, + 0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a, + 0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493, + 0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf, + 0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7, + 0x130: 0x31cd, 0x132: 0x1a8a, 0x133: 0x1b17, 0x134: 0x31f5, 0x135: 0x3501, + 0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d, + 0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, 0x13f: 0x1cdc, + // Block 0x5, offset 0x140 + 0x140: 0x1d64, 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259, + 0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, 0x149: 0x1d8c, + 0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d, + 0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4, + 0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce, + 0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb, + 0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7, + 0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623, + 0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669, + 0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8, + 0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0x00a7, + // Block 0x6, offset 0x180 + 0x184: 0x2f2f, 0x185: 0x2f35, + 0x186: 0x2f3b, 0x187: 0x1a9f, 0x188: 0x1aa2, 0x189: 0x1b38, 0x18a: 0x1ab7, 0x18b: 0x1aba, + 0x18c: 0x1b6e, 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281, + 0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09, + 0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91, + 0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706, + 0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510, + 0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e, + 0x1b0: 0x3506, 0x1b1: 0x1a6f, 0x1b2: 0x1a72, 0x1b3: 0x1aff, 0x1b4: 0x3169, 0x1b5: 0x3475, + 0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87, + 0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457, + 0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed, + 0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba, + 0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637, + 0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6, + 0x1de: 0x319b, 0x1df: 0x34a7, + 0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c, + 0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa, + 0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0, + // Block 0x8, offset 0x200 + 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, + 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, + 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, + 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, + 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, + 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, + 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, + 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, + 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, + 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, + // Block 0x9, offset 0x240 + 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, + 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, + 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, + 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, + 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, + 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, + 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, + 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, + 0x274: 0x01ee, + 0x27a: 0x43e6, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x439b, 0x285: 0x45bc, + 0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766, + 0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea, + 0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c1: 0xa000, 0x2c5: 0xa000, + 0x2c9: 0xa000, 0x2ca: 0x4981, 0x2cb: 0x499f, + 0x2cc: 0x3808, 0x2cd: 0x3820, 0x2ce: 0x49b7, 0x2d0: 0x0242, 0x2d1: 0x0254, + 0x2d2: 0x0230, 0x2d3: 0x444d, 0x2d4: 0x4453, 0x2d5: 0x027e, 0x2d6: 0x026c, + 0x2f0: 0x025a, 0x2f1: 0x026f, 0x2f2: 0x0272, 0x2f4: 0x020c, 0x2f5: 0x024b, + 0x2f9: 0x022a, + // Block 0xc, offset 0x300 + 0x300: 0x3862, 0x301: 0x386e, 0x303: 0x385c, + 0x306: 0xa000, 0x307: 0x384a, + 0x30c: 0x389e, 0x30d: 0x3886, 0x30e: 0x38b0, 0x310: 0xa000, + 0x313: 0xa000, 0x315: 0xa000, 0x316: 0xa000, 0x317: 0xa000, + 0x318: 0xa000, 0x319: 0x3892, 0x31a: 0xa000, + 0x31e: 0xa000, 0x323: 0xa000, + 0x327: 0xa000, + 0x32b: 0xa000, 0x32d: 0xa000, + 0x330: 0xa000, 0x333: 0xa000, 0x335: 0xa000, + 0x336: 0xa000, 0x337: 0xa000, 0x338: 0xa000, 0x339: 0x3916, 0x33a: 0xa000, + 0x33e: 0xa000, + // Block 0xd, offset 0x340 + 0x341: 0x3874, 0x342: 0x38f8, + 0x350: 0x3850, 0x351: 0x38d4, + 0x352: 0x3856, 0x353: 0x38da, 0x356: 0x3868, 0x357: 0x38ec, + 0x358: 0xa000, 0x359: 0xa000, 0x35a: 0x396a, 0x35b: 0x3970, 0x35c: 0x387a, 0x35d: 0x38fe, + 0x35e: 0x3880, 0x35f: 0x3904, 0x362: 0x388c, 0x363: 0x3910, + 0x364: 0x3898, 0x365: 0x391c, 0x366: 0x38a4, 0x367: 0x3928, 0x368: 0xa000, 0x369: 0xa000, + 0x36a: 0x3976, 0x36b: 0x397c, 0x36c: 0x38ce, 0x36d: 0x3952, 0x36e: 0x38aa, 0x36f: 0x392e, + 0x370: 0x38b6, 0x371: 0x393a, 0x372: 0x38bc, 0x373: 0x3940, 0x374: 0x38c2, 0x375: 0x3946, + 0x378: 0x38c8, 0x379: 0x394c, + // Block 0xe, offset 0x380 + 0x387: 0x1e91, + 0x391: 0x812e, + 0x392: 0x8133, 0x393: 0x8133, 0x394: 0x8133, 0x395: 0x8133, 0x396: 0x812e, 0x397: 0x8133, + 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x812f, 0x39b: 0x812e, 0x39c: 0x8133, 0x39d: 0x8133, + 0x39e: 0x8133, 0x39f: 0x8133, 0x3a0: 0x8133, 0x3a1: 0x8133, 0x3a2: 0x812e, 0x3a3: 0x812e, + 0x3a4: 0x812e, 0x3a5: 0x812e, 0x3a6: 0x812e, 0x3a7: 0x812e, 0x3a8: 0x8133, 0x3a9: 0x8133, + 0x3aa: 0x812e, 0x3ab: 0x8133, 0x3ac: 0x8133, 0x3ad: 0x812f, 0x3ae: 0x8132, 0x3af: 0x8133, + 0x3b0: 0x8106, 0x3b1: 0x8107, 0x3b2: 0x8108, 0x3b3: 0x8109, 0x3b4: 0x810a, 0x3b5: 0x810b, + 0x3b6: 0x810c, 0x3b7: 0x810d, 0x3b8: 0x810e, 0x3b9: 0x810f, 0x3ba: 0x810f, 0x3bb: 0x8110, + 0x3bc: 0x8111, 0x3bd: 0x8112, 0x3bf: 0x8113, + // Block 0xf, offset 0x3c0 + 0x3c8: 0xa000, 0x3ca: 0xa000, 0x3cb: 0x8117, + 0x3cc: 0x8118, 0x3cd: 0x8119, 0x3ce: 0x811a, 0x3cf: 0x811b, 0x3d0: 0x811c, 0x3d1: 0x811d, + 0x3d2: 0x811e, 0x3d3: 0x9933, 0x3d4: 0x9933, 0x3d5: 0x992e, 0x3d6: 0x812e, 0x3d7: 0x8133, + 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x812e, 0x3dd: 0x8133, + 0x3de: 0x8133, 0x3df: 0x812e, + 0x3f0: 0x811f, 0x3f5: 0x1eb4, + 0x3f6: 0x2143, 0x3f7: 0x217f, 0x3f8: 0x217a, + // Block 0x10, offset 0x400 + 0x40a: 0x8133, 0x40b: 0x8133, + 0x40c: 0x8133, 0x40d: 0x8133, 0x40e: 0x8133, 0x40f: 0x812e, 0x410: 0x812e, 0x411: 0x812e, + 0x412: 0x812e, 0x413: 0x812e, 0x414: 0x8133, 0x415: 0x8133, 0x416: 0x8133, 0x417: 0x8133, + 0x418: 0x8133, 0x419: 0x8133, 0x41a: 0x8133, 0x41b: 0x8133, 0x41c: 0x8133, 0x41d: 0x8133, + 0x41e: 0x8133, 0x41f: 0x8133, 0x420: 0x8133, 0x421: 0x8133, 0x423: 0x812e, + 0x424: 0x8133, 0x425: 0x8133, 0x426: 0x812e, 0x427: 0x8133, 0x428: 0x8133, 0x429: 0x812e, + 0x42a: 0x8133, 0x42b: 0x8133, 0x42c: 0x8133, 0x42d: 0x812e, 0x42e: 0x812e, 0x42f: 0x812e, + 0x430: 0x8117, 0x431: 0x8118, 0x432: 0x8119, 0x433: 0x8133, 0x434: 0x8133, 0x435: 0x8133, + 0x436: 0x812e, 0x437: 0x8133, 0x438: 0x8133, 0x439: 0x812e, 0x43a: 0x812e, 0x43b: 0x8133, + 0x43c: 0x8133, 0x43d: 0x8133, 0x43e: 0x8133, 0x43f: 0x8133, + // Block 0x11, offset 0x440 + 0x445: 0xa000, + 0x446: 0x2e5d, 0x447: 0xa000, 0x448: 0x2e65, 0x449: 0xa000, 0x44a: 0x2e6d, 0x44b: 0xa000, + 0x44c: 0x2e75, 0x44d: 0xa000, 0x44e: 0x2e7d, 0x451: 0xa000, + 0x452: 0x2e85, + 0x474: 0x8103, 0x475: 0x9900, + 0x47a: 0xa000, 0x47b: 0x2e8d, + 0x47c: 0xa000, 0x47d: 0x2e95, 0x47e: 0xa000, 0x47f: 0xa000, + // Block 0x12, offset 0x480 + 0x480: 0x0069, 0x481: 0x006b, 0x482: 0x006f, 0x483: 0x0083, 0x484: 0x0104, 0x485: 0x0107, + 0x486: 0x0506, 0x487: 0x0085, 0x488: 0x0089, 0x489: 0x008b, 0x48a: 0x011f, 0x48b: 0x0122, + 0x48c: 0x0125, 0x48d: 0x008f, 0x48f: 0x0097, 0x490: 0x009b, 0x491: 0x00e6, + 0x492: 0x009f, 0x493: 0x0110, 0x494: 0x050a, 0x495: 0x050e, 0x496: 0x00a1, 0x497: 0x00a9, + 0x498: 0x00ab, 0x499: 0x0516, 0x49a: 0x015b, 0x49b: 0x00ad, 0x49c: 0x051a, 0x49d: 0x0242, + 0x49e: 0x0245, 0x49f: 0x0248, 0x4a0: 0x027e, 0x4a1: 0x0281, 0x4a2: 0x0093, 0x4a3: 0x00a5, + 0x4a4: 0x00ab, 0x4a5: 0x00ad, 0x4a6: 0x0242, 0x4a7: 0x0245, 0x4a8: 0x026f, 0x4a9: 0x027e, + 0x4aa: 0x0281, + 0x4b8: 0x02b4, + // Block 0x13, offset 0x4c0 + 0x4db: 0x010a, 0x4dc: 0x0087, 0x4dd: 0x0113, + 0x4de: 0x00d7, 0x4df: 0x0125, 0x4e0: 0x008d, 0x4e1: 0x012b, 0x4e2: 0x0131, 0x4e3: 0x013d, + 0x4e4: 0x0146, 0x4e5: 0x0149, 0x4e6: 0x014c, 0x4e7: 0x051e, 0x4e8: 0x01c7, 0x4e9: 0x0155, + 0x4ea: 0x0522, 0x4eb: 0x01ca, 0x4ec: 0x0161, 0x4ed: 0x015e, 0x4ee: 0x0164, 0x4ef: 0x0167, + 0x4f0: 0x016a, 0x4f1: 0x016d, 0x4f2: 0x0176, 0x4f3: 0x018e, 0x4f4: 0x0191, 0x4f5: 0x00f2, + 0x4f6: 0x019a, 0x4f7: 0x019d, 0x4f8: 0x0512, 0x4f9: 0x01a0, 0x4fa: 0x01a3, 0x4fb: 0x00b5, + 0x4fc: 0x01af, 0x4fd: 0x01b2, 0x4fe: 0x01b5, 0x4ff: 0x0254, + // Block 0x14, offset 0x500 + 0x500: 0x8133, 0x501: 0x8133, 0x502: 0x812e, 0x503: 0x8133, 0x504: 0x8133, 0x505: 0x8133, + 0x506: 0x8133, 0x507: 0x8133, 0x508: 0x8133, 0x509: 0x8133, 0x50a: 0x812e, 0x50b: 0x8133, + 0x50c: 0x8133, 0x50d: 0x8136, 0x50e: 0x812b, 0x50f: 0x812e, 0x510: 0x812a, 0x511: 0x8133, + 0x512: 0x8133, 0x513: 0x8133, 0x514: 0x8133, 0x515: 0x8133, 0x516: 0x8133, 0x517: 0x8133, + 0x518: 0x8133, 0x519: 0x8133, 0x51a: 0x8133, 0x51b: 0x8133, 0x51c: 0x8133, 0x51d: 0x8133, + 0x51e: 0x8133, 0x51f: 0x8133, 0x520: 0x8133, 0x521: 0x8133, 0x522: 0x8133, 0x523: 0x8133, + 0x524: 0x8133, 0x525: 0x8133, 0x526: 0x8133, 0x527: 0x8133, 0x528: 0x8133, 0x529: 0x8133, + 0x52a: 0x8133, 0x52b: 0x8133, 0x52c: 0x8133, 0x52d: 0x8133, 0x52e: 0x8133, 0x52f: 0x8133, + 0x530: 0x8133, 0x531: 0x8133, 0x532: 0x8133, 0x533: 0x8133, 0x534: 0x8133, 0x535: 0x8133, + 0x536: 0x8134, 0x537: 0x8132, 0x538: 0x8132, 0x539: 0x812e, 0x53a: 0x812d, 0x53b: 0x8133, + 0x53c: 0x8135, 0x53d: 0x812e, 0x53e: 0x8133, 0x53f: 0x812e, + // Block 0x15, offset 0x540 + 0x540: 0x30d8, 0x541: 0x33e4, 0x542: 0x30e2, 0x543: 0x33ee, 0x544: 0x30e7, 0x545: 0x33f3, + 0x546: 0x30ec, 0x547: 0x33f8, 0x548: 0x3a0d, 0x549: 0x3b9c, 0x54a: 0x3105, 0x54b: 0x3411, + 0x54c: 0x310f, 0x54d: 0x341b, 0x54e: 0x311e, 0x54f: 0x342a, 0x550: 0x3114, 0x551: 0x3420, + 0x552: 0x3119, 0x553: 0x3425, 0x554: 0x3a30, 0x555: 0x3bbf, 0x556: 0x3a37, 0x557: 0x3bc6, + 0x558: 0x315a, 0x559: 0x3466, 0x55a: 0x315f, 0x55b: 0x346b, 0x55c: 0x3a45, 0x55d: 0x3bd4, + 0x55e: 0x3164, 0x55f: 0x3470, 0x560: 0x3173, 0x561: 0x347f, 0x562: 0x3191, 0x563: 0x349d, + 0x564: 0x31a0, 0x565: 0x34ac, 0x566: 0x3196, 0x567: 0x34a2, 0x568: 0x31a5, 0x569: 0x34b1, + 0x56a: 0x31aa, 0x56b: 0x34b6, 0x56c: 0x31f0, 0x56d: 0x34fc, 0x56e: 0x3a4c, 0x56f: 0x3bdb, + 0x570: 0x31fa, 0x571: 0x350b, 0x572: 0x3204, 0x573: 0x3515, 0x574: 0x320e, 0x575: 0x351f, + 0x576: 0x4805, 0x577: 0x4896, 0x578: 0x3a53, 0x579: 0x3be2, 0x57a: 0x3227, 0x57b: 0x3538, + 0x57c: 0x3222, 0x57d: 0x3533, 0x57e: 0x322c, 0x57f: 0x353d, + // Block 0x16, offset 0x580 + 0x580: 0x3231, 0x581: 0x3542, 0x582: 0x3236, 0x583: 0x3547, 0x584: 0x324a, 0x585: 0x355b, + 0x586: 0x3254, 0x587: 0x3565, 0x588: 0x3263, 0x589: 0x3574, 0x58a: 0x325e, 0x58b: 0x356f, + 0x58c: 0x3a76, 0x58d: 0x3c05, 0x58e: 0x3a84, 0x58f: 0x3c13, 0x590: 0x3a8b, 0x591: 0x3c1a, + 0x592: 0x3a92, 0x593: 0x3c21, 0x594: 0x3290, 0x595: 0x35a1, 0x596: 0x3295, 0x597: 0x35a6, + 0x598: 0x329f, 0x599: 0x35b0, 0x59a: 0x4832, 0x59b: 0x48c3, 0x59c: 0x3ad8, 0x59d: 0x3c67, + 0x59e: 0x32b8, 0x59f: 0x35c9, 0x5a0: 0x32c2, 0x5a1: 0x35d3, 0x5a2: 0x4841, 0x5a3: 0x48d2, + 0x5a4: 0x3adf, 0x5a5: 0x3c6e, 0x5a6: 0x3ae6, 0x5a7: 0x3c75, 0x5a8: 0x3aed, 0x5a9: 0x3c7c, + 0x5aa: 0x32d1, 0x5ab: 0x35e2, 0x5ac: 0x32db, 0x5ad: 0x35f1, 0x5ae: 0x32ef, 0x5af: 0x3605, + 0x5b0: 0x32ea, 0x5b1: 0x3600, 0x5b2: 0x332b, 0x5b3: 0x3641, 0x5b4: 0x333a, 0x5b5: 0x3650, + 0x5b6: 0x3335, 0x5b7: 0x364b, 0x5b8: 0x3af4, 0x5b9: 0x3c83, 0x5ba: 0x3afb, 0x5bb: 0x3c8a, + 0x5bc: 0x333f, 0x5bd: 0x3655, 0x5be: 0x3344, 0x5bf: 0x365a, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x3349, 0x5c1: 0x365f, 0x5c2: 0x334e, 0x5c3: 0x3664, 0x5c4: 0x335d, 0x5c5: 0x3673, + 0x5c6: 0x3358, 0x5c7: 0x366e, 0x5c8: 0x3362, 0x5c9: 0x367d, 0x5ca: 0x3367, 0x5cb: 0x3682, + 0x5cc: 0x336c, 0x5cd: 0x3687, 0x5ce: 0x338a, 0x5cf: 0x36a5, 0x5d0: 0x33a3, 0x5d1: 0x36c3, + 0x5d2: 0x33b2, 0x5d3: 0x36d2, 0x5d4: 0x33b7, 0x5d5: 0x36d7, 0x5d6: 0x34bb, 0x5d7: 0x35e7, + 0x5d8: 0x3678, 0x5d9: 0x36b4, 0x5da: 0x1d10, 0x5db: 0x4418, + 0x5e0: 0x47e2, 0x5e1: 0x4873, 0x5e2: 0x30c4, 0x5e3: 0x33d0, + 0x5e4: 0x39b9, 0x5e5: 0x3b48, 0x5e6: 0x39b2, 0x5e7: 0x3b41, 0x5e8: 0x39c7, 0x5e9: 0x3b56, + 0x5ea: 0x39c0, 0x5eb: 0x3b4f, 0x5ec: 0x39ff, 0x5ed: 0x3b8e, 0x5ee: 0x39d5, 0x5ef: 0x3b64, + 0x5f0: 0x39ce, 0x5f1: 0x3b5d, 0x5f2: 0x39e3, 0x5f3: 0x3b72, 0x5f4: 0x39dc, 0x5f5: 0x3b6b, + 0x5f6: 0x3a06, 0x5f7: 0x3b95, 0x5f8: 0x47f6, 0x5f9: 0x4887, 0x5fa: 0x3141, 0x5fb: 0x344d, + 0x5fc: 0x312d, 0x5fd: 0x3439, 0x5fe: 0x3a1b, 0x5ff: 0x3baa, + // Block 0x18, offset 0x600 + 0x600: 0x3a14, 0x601: 0x3ba3, 0x602: 0x3a29, 0x603: 0x3bb8, 0x604: 0x3a22, 0x605: 0x3bb1, + 0x606: 0x3a3e, 0x607: 0x3bcd, 0x608: 0x31d2, 0x609: 0x34de, 0x60a: 0x31e6, 0x60b: 0x34f2, + 0x60c: 0x4828, 0x60d: 0x48b9, 0x60e: 0x3277, 0x60f: 0x3588, 0x610: 0x3a61, 0x611: 0x3bf0, + 0x612: 0x3a5a, 0x613: 0x3be9, 0x614: 0x3a6f, 0x615: 0x3bfe, 0x616: 0x3a68, 0x617: 0x3bf7, + 0x618: 0x3aca, 0x619: 0x3c59, 0x61a: 0x3aae, 0x61b: 0x3c3d, 0x61c: 0x3aa7, 0x61d: 0x3c36, + 0x61e: 0x3abc, 0x61f: 0x3c4b, 0x620: 0x3ab5, 0x621: 0x3c44, 0x622: 0x3ac3, 0x623: 0x3c52, + 0x624: 0x3326, 0x625: 0x363c, 0x626: 0x3308, 0x627: 0x361e, 0x628: 0x3b25, 0x629: 0x3cb4, + 0x62a: 0x3b1e, 0x62b: 0x3cad, 0x62c: 0x3b33, 0x62d: 0x3cc2, 0x62e: 0x3b2c, 0x62f: 0x3cbb, + 0x630: 0x3b3a, 0x631: 0x3cc9, 0x632: 0x3371, 0x633: 0x368c, 0x634: 0x3399, 0x635: 0x36b9, + 0x636: 0x3394, 0x637: 0x36af, 0x638: 0x3380, 0x639: 0x369b, + // Block 0x19, offset 0x640 + 0x640: 0x4945, 0x641: 0x494b, 0x642: 0x4a5f, 0x643: 0x4a77, 0x644: 0x4a67, 0x645: 0x4a7f, + 0x646: 0x4a6f, 0x647: 0x4a87, 0x648: 0x48eb, 0x649: 0x48f1, 0x64a: 0x49cf, 0x64b: 0x49e7, + 0x64c: 0x49d7, 0x64d: 0x49ef, 0x64e: 0x49df, 0x64f: 0x49f7, 0x650: 0x4957, 0x651: 0x495d, + 0x652: 0x3ef9, 0x653: 0x3f09, 0x654: 0x3f01, 0x655: 0x3f11, + 0x658: 0x48f7, 0x659: 0x48fd, 0x65a: 0x3e29, 0x65b: 0x3e39, 0x65c: 0x3e31, 0x65d: 0x3e41, + 0x660: 0x496f, 0x661: 0x4975, 0x662: 0x4a8f, 0x663: 0x4aa7, + 0x664: 0x4a97, 0x665: 0x4aaf, 0x666: 0x4a9f, 0x667: 0x4ab7, 0x668: 0x4903, 0x669: 0x4909, + 0x66a: 0x49ff, 0x66b: 0x4a17, 0x66c: 0x4a07, 0x66d: 0x4a1f, 0x66e: 0x4a0f, 0x66f: 0x4a27, + 0x670: 0x4987, 0x671: 0x498d, 0x672: 0x3f59, 0x673: 0x3f71, 0x674: 0x3f61, 0x675: 0x3f79, + 0x676: 0x3f69, 0x677: 0x3f81, 0x678: 0x490f, 0x679: 0x4915, 0x67a: 0x3e59, 0x67b: 0x3e71, + 0x67c: 0x3e61, 0x67d: 0x3e79, 0x67e: 0x3e69, 0x67f: 0x3e81, + // Block 0x1a, offset 0x680 + 0x680: 0x4993, 0x681: 0x4999, 0x682: 0x3f89, 0x683: 0x3f99, 0x684: 0x3f91, 0x685: 0x3fa1, + 0x688: 0x491b, 0x689: 0x4921, 0x68a: 0x3e89, 0x68b: 0x3e99, + 0x68c: 0x3e91, 0x68d: 0x3ea1, 0x690: 0x49a5, 0x691: 0x49ab, + 0x692: 0x3fc1, 0x693: 0x3fd9, 0x694: 0x3fc9, 0x695: 0x3fe1, 0x696: 0x3fd1, 0x697: 0x3fe9, + 0x699: 0x4927, 0x69b: 0x3ea9, 0x69d: 0x3eb1, + 0x69f: 0x3eb9, 0x6a0: 0x49bd, 0x6a1: 0x49c3, 0x6a2: 0x4abf, 0x6a3: 0x4ad7, + 0x6a4: 0x4ac7, 0x6a5: 0x4adf, 0x6a6: 0x4acf, 0x6a7: 0x4ae7, 0x6a8: 0x492d, 0x6a9: 0x4933, + 0x6aa: 0x4a2f, 0x6ab: 0x4a47, 0x6ac: 0x4a37, 0x6ad: 0x4a4f, 0x6ae: 0x4a3f, 0x6af: 0x4a57, + 0x6b0: 0x4939, 0x6b1: 0x445f, 0x6b2: 0x37d2, 0x6b3: 0x4465, 0x6b4: 0x4963, 0x6b5: 0x446b, + 0x6b6: 0x37e4, 0x6b7: 0x4471, 0x6b8: 0x3802, 0x6b9: 0x4477, 0x6ba: 0x381a, 0x6bb: 0x447d, + 0x6bc: 0x49b1, 0x6bd: 0x4483, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3ee1, 0x6c1: 0x3ee9, 0x6c2: 0x42c5, 0x6c3: 0x42e3, 0x6c4: 0x42cf, 0x6c5: 0x42ed, + 0x6c6: 0x42d9, 0x6c7: 0x42f7, 0x6c8: 0x3e19, 0x6c9: 0x3e21, 0x6ca: 0x4211, 0x6cb: 0x422f, + 0x6cc: 0x421b, 0x6cd: 0x4239, 0x6ce: 0x4225, 0x6cf: 0x4243, 0x6d0: 0x3f29, 0x6d1: 0x3f31, + 0x6d2: 0x4301, 0x6d3: 0x431f, 0x6d4: 0x430b, 0x6d5: 0x4329, 0x6d6: 0x4315, 0x6d7: 0x4333, + 0x6d8: 0x3e49, 0x6d9: 0x3e51, 0x6da: 0x424d, 0x6db: 0x426b, 0x6dc: 0x4257, 0x6dd: 0x4275, + 0x6de: 0x4261, 0x6df: 0x427f, 0x6e0: 0x4001, 0x6e1: 0x4009, 0x6e2: 0x433d, 0x6e3: 0x435b, + 0x6e4: 0x4347, 0x6e5: 0x4365, 0x6e6: 0x4351, 0x6e7: 0x436f, 0x6e8: 0x3ec1, 0x6e9: 0x3ec9, + 0x6ea: 0x4289, 0x6eb: 0x42a7, 0x6ec: 0x4293, 0x6ed: 0x42b1, 0x6ee: 0x429d, 0x6ef: 0x42bb, + 0x6f0: 0x37c6, 0x6f1: 0x37c0, 0x6f2: 0x3ed1, 0x6f3: 0x37cc, 0x6f4: 0x3ed9, + 0x6f6: 0x4951, 0x6f7: 0x3ef1, 0x6f8: 0x3736, 0x6f9: 0x3730, 0x6fa: 0x3724, 0x6fb: 0x442f, + 0x6fc: 0x373c, 0x6fd: 0x43c8, 0x6fe: 0x0257, 0x6ff: 0x43c8, + // Block 0x1c, offset 0x700 + 0x700: 0x43e1, 0x701: 0x45c3, 0x702: 0x3f19, 0x703: 0x37de, 0x704: 0x3f21, + 0x706: 0x497b, 0x707: 0x3f39, 0x708: 0x3742, 0x709: 0x4435, 0x70a: 0x374e, 0x70b: 0x443b, + 0x70c: 0x375a, 0x70d: 0x45ca, 0x70e: 0x45d1, 0x70f: 0x45d8, 0x710: 0x37f6, 0x711: 0x37f0, + 0x712: 0x3f41, 0x713: 0x4625, 0x716: 0x37fc, 0x717: 0x3f51, + 0x718: 0x3772, 0x719: 0x376c, 0x71a: 0x3760, 0x71b: 0x4441, 0x71d: 0x45df, + 0x71e: 0x45e6, 0x71f: 0x45ed, 0x720: 0x382c, 0x721: 0x3826, 0x722: 0x3fa9, 0x723: 0x462d, + 0x724: 0x380e, 0x725: 0x3814, 0x726: 0x3832, 0x727: 0x3fb9, 0x728: 0x37a2, 0x729: 0x379c, + 0x72a: 0x3790, 0x72b: 0x444d, 0x72c: 0x378a, 0x72d: 0x45b5, 0x72e: 0x45bc, 0x72f: 0x0081, + 0x732: 0x3ff1, 0x733: 0x3838, 0x734: 0x3ff9, + 0x736: 0x49c9, 0x737: 0x4011, 0x738: 0x377e, 0x739: 0x4447, 0x73a: 0x37ae, 0x73b: 0x4459, + 0x73c: 0x37ba, 0x73d: 0x439b, 0x73e: 0x43cd, + // Block 0x1d, offset 0x740 + 0x740: 0x1d08, 0x741: 0x1d0c, 0x742: 0x0047, 0x743: 0x1d84, 0x745: 0x1d18, + 0x746: 0x1d1c, 0x747: 0x00ef, 0x749: 0x1d88, 0x74a: 0x008f, 0x74b: 0x0051, + 0x74c: 0x0051, 0x74d: 0x0051, 0x74e: 0x0091, 0x74f: 0x00e0, 0x750: 0x0053, 0x751: 0x0053, + 0x752: 0x0059, 0x753: 0x0099, 0x755: 0x005d, 0x756: 0x1abd, + 0x759: 0x0061, 0x75a: 0x0063, 0x75b: 0x0065, 0x75c: 0x0065, 0x75d: 0x0065, + 0x760: 0x1acf, 0x761: 0x1cf8, 0x762: 0x1ad8, + 0x764: 0x0075, 0x766: 0x023c, 0x768: 0x0075, + 0x76a: 0x0057, 0x76b: 0x4413, 0x76c: 0x0045, 0x76d: 0x0047, 0x76f: 0x008b, + 0x770: 0x004b, 0x771: 0x004d, 0x773: 0x005b, 0x774: 0x009f, 0x775: 0x0308, + 0x776: 0x030b, 0x777: 0x030e, 0x778: 0x0311, 0x779: 0x0093, 0x77b: 0x1cc8, + 0x77c: 0x026c, 0x77d: 0x0245, 0x77e: 0x01fd, 0x77f: 0x0224, + // Block 0x1e, offset 0x780 + 0x780: 0x055a, 0x785: 0x0049, + 0x786: 0x0089, 0x787: 0x008b, 0x788: 0x0093, 0x789: 0x0095, + 0x790: 0x235e, 0x791: 0x236a, + 0x792: 0x241e, 0x793: 0x2346, 0x794: 0x23ca, 0x795: 0x2352, 0x796: 0x23d0, 0x797: 0x23e8, + 0x798: 0x23f4, 0x799: 0x2358, 0x79a: 0x23fa, 0x79b: 0x2364, 0x79c: 0x23ee, 0x79d: 0x2400, + 0x79e: 0x2406, 0x79f: 0x1dec, 0x7a0: 0x0053, 0x7a1: 0x1a87, 0x7a2: 0x1cd4, 0x7a3: 0x1a90, + 0x7a4: 0x006d, 0x7a5: 0x1adb, 0x7a6: 0x1d00, 0x7a7: 0x1e78, 0x7a8: 0x1a93, 0x7a9: 0x0071, + 0x7aa: 0x1ae7, 0x7ab: 0x1d04, 0x7ac: 0x0059, 0x7ad: 0x0047, 0x7ae: 0x0049, 0x7af: 0x005b, + 0x7b0: 0x0093, 0x7b1: 0x1b14, 0x7b2: 0x1d48, 0x7b3: 0x1b1d, 0x7b4: 0x00ad, 0x7b5: 0x1b92, + 0x7b6: 0x1d7c, 0x7b7: 0x1e8c, 0x7b8: 0x1b20, 0x7b9: 0x00b1, 0x7ba: 0x1b95, 0x7bb: 0x1d80, + 0x7bc: 0x0099, 0x7bd: 0x0087, 0x7be: 0x0089, 0x7bf: 0x009b, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x3d47, 0x7c3: 0xa000, 0x7c4: 0x3d4e, 0x7c5: 0xa000, + 0x7c7: 0x3d55, 0x7c8: 0xa000, 0x7c9: 0x3d5c, + 0x7cd: 0xa000, + 0x7e0: 0x30a6, 0x7e1: 0xa000, 0x7e2: 0x3d6a, + 0x7e4: 0xa000, 0x7e5: 0xa000, + 0x7ed: 0x3d63, 0x7ee: 0x30a1, 0x7ef: 0x30ab, + 0x7f0: 0x3d71, 0x7f1: 0x3d78, 0x7f2: 0xa000, 0x7f3: 0xa000, 0x7f4: 0x3d7f, 0x7f5: 0x3d86, + 0x7f6: 0xa000, 0x7f7: 0xa000, 0x7f8: 0x3d8d, 0x7f9: 0x3d94, 0x7fa: 0xa000, 0x7fb: 0xa000, + 0x7fc: 0xa000, 0x7fd: 0xa000, + // Block 0x20, offset 0x800 + 0x800: 0x3d9b, 0x801: 0x3da2, 0x802: 0xa000, 0x803: 0xa000, 0x804: 0x3db7, 0x805: 0x3dbe, + 0x806: 0xa000, 0x807: 0xa000, 0x808: 0x3dc5, 0x809: 0x3dcc, + 0x811: 0xa000, + 0x812: 0xa000, + 0x822: 0xa000, + 0x828: 0xa000, 0x829: 0xa000, + 0x82b: 0xa000, 0x82c: 0x3de1, 0x82d: 0x3de8, 0x82e: 0x3def, 0x82f: 0x3df6, + 0x832: 0xa000, 0x833: 0xa000, 0x834: 0xa000, 0x835: 0xa000, + // Block 0x21, offset 0x840 + 0x860: 0x0023, 0x861: 0x0025, 0x862: 0x0027, 0x863: 0x0029, + 0x864: 0x002b, 0x865: 0x002d, 0x866: 0x002f, 0x867: 0x0031, 0x868: 0x0033, 0x869: 0x19af, + 0x86a: 0x19b2, 0x86b: 0x19b5, 0x86c: 0x19b8, 0x86d: 0x19bb, 0x86e: 0x19be, 0x86f: 0x19c1, + 0x870: 0x19c4, 0x871: 0x19c7, 0x872: 0x19ca, 0x873: 0x19d3, 0x874: 0x1b98, 0x875: 0x1b9c, + 0x876: 0x1ba0, 0x877: 0x1ba4, 0x878: 0x1ba8, 0x879: 0x1bac, 0x87a: 0x1bb0, 0x87b: 0x1bb4, + 0x87c: 0x1bb8, 0x87d: 0x1db0, 0x87e: 0x1db5, 0x87f: 0x1dba, + // Block 0x22, offset 0x880 + 0x880: 0x1dbf, 0x881: 0x1dc4, 0x882: 0x1dc9, 0x883: 0x1dce, 0x884: 0x1dd3, 0x885: 0x1dd8, + 0x886: 0x1ddd, 0x887: 0x1de2, 0x888: 0x19ac, 0x889: 0x19d0, 0x88a: 0x19f4, 0x88b: 0x1a18, + 0x88c: 0x1a3c, 0x88d: 0x1a45, 0x88e: 0x1a4b, 0x88f: 0x1a51, 0x890: 0x1a57, 0x891: 0x1c90, + 0x892: 0x1c94, 0x893: 0x1c98, 0x894: 0x1c9c, 0x895: 0x1ca0, 0x896: 0x1ca4, 0x897: 0x1ca8, + 0x898: 0x1cac, 0x899: 0x1cb0, 0x89a: 0x1cb4, 0x89b: 0x1cb8, 0x89c: 0x1c24, 0x89d: 0x1c28, + 0x89e: 0x1c2c, 0x89f: 0x1c30, 0x8a0: 0x1c34, 0x8a1: 0x1c38, 0x8a2: 0x1c3c, 0x8a3: 0x1c40, + 0x8a4: 0x1c44, 0x8a5: 0x1c48, 0x8a6: 0x1c4c, 0x8a7: 0x1c50, 0x8a8: 0x1c54, 0x8a9: 0x1c58, + 0x8aa: 0x1c5c, 0x8ab: 0x1c60, 0x8ac: 0x1c64, 0x8ad: 0x1c68, 0x8ae: 0x1c6c, 0x8af: 0x1c70, + 0x8b0: 0x1c74, 0x8b1: 0x1c78, 0x8b2: 0x1c7c, 0x8b3: 0x1c80, 0x8b4: 0x1c84, 0x8b5: 0x1c88, + 0x8b6: 0x0043, 0x8b7: 0x0045, 0x8b8: 0x0047, 0x8b9: 0x0049, 0x8ba: 0x004b, 0x8bb: 0x004d, + 0x8bc: 0x004f, 0x8bd: 0x0051, 0x8be: 0x0053, 0x8bf: 0x0055, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x07ba, 0x8c1: 0x07de, 0x8c2: 0x07ea, 0x8c3: 0x07fa, 0x8c4: 0x0802, 0x8c5: 0x080e, + 0x8c6: 0x0816, 0x8c7: 0x081e, 0x8c8: 0x082a, 0x8c9: 0x087e, 0x8ca: 0x0896, 0x8cb: 0x08a6, + 0x8cc: 0x08b6, 0x8cd: 0x08c6, 0x8ce: 0x08d6, 0x8cf: 0x08f6, 0x8d0: 0x08fa, 0x8d1: 0x08fe, + 0x8d2: 0x0932, 0x8d3: 0x095a, 0x8d4: 0x096a, 0x8d5: 0x0972, 0x8d6: 0x0976, 0x8d7: 0x0982, + 0x8d8: 0x099e, 0x8d9: 0x09a2, 0x8da: 0x09ba, 0x8db: 0x09be, 0x8dc: 0x09c6, 0x8dd: 0x09d6, + 0x8de: 0x0a72, 0x8df: 0x0a86, 0x8e0: 0x0ac6, 0x8e1: 0x0ada, 0x8e2: 0x0ae2, 0x8e3: 0x0ae6, + 0x8e4: 0x0af6, 0x8e5: 0x0b12, 0x8e6: 0x0b3e, 0x8e7: 0x0b4a, 0x8e8: 0x0b6a, 0x8e9: 0x0b76, + 0x8ea: 0x0b7a, 0x8eb: 0x0b7e, 0x8ec: 0x0b96, 0x8ed: 0x0b9a, 0x8ee: 0x0bc6, 0x8ef: 0x0bd2, + 0x8f0: 0x0bda, 0x8f1: 0x0be2, 0x8f2: 0x0bf2, 0x8f3: 0x0bfa, 0x8f4: 0x0c02, 0x8f5: 0x0c2e, + 0x8f6: 0x0c32, 0x8f7: 0x0c3a, 0x8f8: 0x0c3e, 0x8f9: 0x0c46, 0x8fa: 0x0c4e, 0x8fb: 0x0c5e, + 0x8fc: 0x0c7a, 0x8fd: 0x0cf2, 0x8fe: 0x0d06, 0x8ff: 0x0d0a, + // Block 0x24, offset 0x900 + 0x900: 0x0d8a, 0x901: 0x0d8e, 0x902: 0x0da2, 0x903: 0x0da6, 0x904: 0x0dae, 0x905: 0x0db6, + 0x906: 0x0dbe, 0x907: 0x0dca, 0x908: 0x0df2, 0x909: 0x0e02, 0x90a: 0x0e16, 0x90b: 0x0e86, + 0x90c: 0x0e92, 0x90d: 0x0ea2, 0x90e: 0x0eae, 0x90f: 0x0eba, 0x910: 0x0ec2, 0x911: 0x0ec6, + 0x912: 0x0eca, 0x913: 0x0ece, 0x914: 0x0ed2, 0x915: 0x0f8a, 0x916: 0x0fd2, 0x917: 0x0fde, + 0x918: 0x0fe2, 0x919: 0x0fe6, 0x91a: 0x0fea, 0x91b: 0x0ff2, 0x91c: 0x0ff6, 0x91d: 0x100a, + 0x91e: 0x1026, 0x91f: 0x102e, 0x920: 0x106e, 0x921: 0x1072, 0x922: 0x107a, 0x923: 0x107e, + 0x924: 0x1086, 0x925: 0x108a, 0x926: 0x10ae, 0x927: 0x10b2, 0x928: 0x10ce, 0x929: 0x10d2, + 0x92a: 0x10d6, 0x92b: 0x10da, 0x92c: 0x10ee, 0x92d: 0x1112, 0x92e: 0x1116, 0x92f: 0x111a, + 0x930: 0x113e, 0x931: 0x117e, 0x932: 0x1182, 0x933: 0x11a2, 0x934: 0x11b2, 0x935: 0x11ba, + 0x936: 0x11da, 0x937: 0x11fe, 0x938: 0x1242, 0x939: 0x124a, 0x93a: 0x125e, 0x93b: 0x126a, + 0x93c: 0x1272, 0x93d: 0x127a, 0x93e: 0x127e, 0x93f: 0x1282, + // Block 0x25, offset 0x940 + 0x940: 0x129a, 0x941: 0x129e, 0x942: 0x12ba, 0x943: 0x12c2, 0x944: 0x12ca, 0x945: 0x12ce, + 0x946: 0x12da, 0x947: 0x12e2, 0x948: 0x12e6, 0x949: 0x12ea, 0x94a: 0x12f2, 0x94b: 0x12f6, + 0x94c: 0x1396, 0x94d: 0x13aa, 0x94e: 0x13de, 0x94f: 0x13e2, 0x950: 0x13ea, 0x951: 0x1416, + 0x952: 0x141e, 0x953: 0x1426, 0x954: 0x142e, 0x955: 0x146a, 0x956: 0x146e, 0x957: 0x1476, + 0x958: 0x147a, 0x959: 0x147e, 0x95a: 0x14aa, 0x95b: 0x14ae, 0x95c: 0x14b6, 0x95d: 0x14ca, + 0x95e: 0x14ce, 0x95f: 0x14ea, 0x960: 0x14f2, 0x961: 0x14f6, 0x962: 0x151a, 0x963: 0x153a, + 0x964: 0x154e, 0x965: 0x1552, 0x966: 0x155a, 0x967: 0x1586, 0x968: 0x158a, 0x969: 0x159a, + 0x96a: 0x15be, 0x96b: 0x15ca, 0x96c: 0x15da, 0x96d: 0x15f2, 0x96e: 0x15fa, 0x96f: 0x15fe, + 0x970: 0x1602, 0x971: 0x1606, 0x972: 0x1612, 0x973: 0x1616, 0x974: 0x161e, 0x975: 0x163a, + 0x976: 0x163e, 0x977: 0x1642, 0x978: 0x165a, 0x979: 0x165e, 0x97a: 0x1666, 0x97b: 0x167a, + 0x97c: 0x167e, 0x97d: 0x1682, 0x97e: 0x168a, 0x97f: 0x168e, + // Block 0x26, offset 0x980 + 0x986: 0xa000, 0x98b: 0xa000, + 0x98c: 0x4049, 0x98d: 0xa000, 0x98e: 0x4051, 0x98f: 0xa000, 0x990: 0x4059, 0x991: 0xa000, + 0x992: 0x4061, 0x993: 0xa000, 0x994: 0x4069, 0x995: 0xa000, 0x996: 0x4071, 0x997: 0xa000, + 0x998: 0x4079, 0x999: 0xa000, 0x99a: 0x4081, 0x99b: 0xa000, 0x99c: 0x4089, 0x99d: 0xa000, + 0x99e: 0x4091, 0x99f: 0xa000, 0x9a0: 0x4099, 0x9a1: 0xa000, 0x9a2: 0x40a1, + 0x9a4: 0xa000, 0x9a5: 0x40a9, 0x9a6: 0xa000, 0x9a7: 0x40b1, 0x9a8: 0xa000, 0x9a9: 0x40b9, + 0x9af: 0xa000, + 0x9b0: 0x40c1, 0x9b1: 0x40c9, 0x9b2: 0xa000, 0x9b3: 0x40d1, 0x9b4: 0x40d9, 0x9b5: 0xa000, + 0x9b6: 0x40e1, 0x9b7: 0x40e9, 0x9b8: 0xa000, 0x9b9: 0x40f1, 0x9ba: 0x40f9, 0x9bb: 0xa000, + 0x9bc: 0x4101, 0x9bd: 0x4109, + // Block 0x27, offset 0x9c0 + 0x9d4: 0x4041, + 0x9d9: 0x9904, 0x9da: 0x9904, 0x9db: 0x441d, 0x9dc: 0x4423, 0x9dd: 0xa000, + 0x9de: 0x4111, 0x9df: 0x27e4, + 0x9e6: 0xa000, + 0x9eb: 0xa000, 0x9ec: 0x4121, 0x9ed: 0xa000, 0x9ee: 0x4129, 0x9ef: 0xa000, + 0x9f0: 0x4131, 0x9f1: 0xa000, 0x9f2: 0x4139, 0x9f3: 0xa000, 0x9f4: 0x4141, 0x9f5: 0xa000, + 0x9f6: 0x4149, 0x9f7: 0xa000, 0x9f8: 0x4151, 0x9f9: 0xa000, 0x9fa: 0x4159, 0x9fb: 0xa000, + 0x9fc: 0x4161, 0x9fd: 0xa000, 0x9fe: 0x4169, 0x9ff: 0xa000, + // Block 0x28, offset 0xa00 + 0xa00: 0x4171, 0xa01: 0xa000, 0xa02: 0x4179, 0xa04: 0xa000, 0xa05: 0x4181, + 0xa06: 0xa000, 0xa07: 0x4189, 0xa08: 0xa000, 0xa09: 0x4191, + 0xa0f: 0xa000, 0xa10: 0x4199, 0xa11: 0x41a1, + 0xa12: 0xa000, 0xa13: 0x41a9, 0xa14: 0x41b1, 0xa15: 0xa000, 0xa16: 0x41b9, 0xa17: 0x41c1, + 0xa18: 0xa000, 0xa19: 0x41c9, 0xa1a: 0x41d1, 0xa1b: 0xa000, 0xa1c: 0x41d9, 0xa1d: 0x41e1, + 0xa2f: 0xa000, + 0xa30: 0xa000, 0xa31: 0xa000, 0xa32: 0xa000, 0xa34: 0x4119, + 0xa37: 0x41e9, 0xa38: 0x41f1, 0xa39: 0x41f9, 0xa3a: 0x4201, + 0xa3d: 0xa000, 0xa3e: 0x4209, 0xa3f: 0x27f9, + // Block 0x29, offset 0xa40 + 0xa40: 0x045a, 0xa41: 0x041e, 0xa42: 0x0422, 0xa43: 0x0426, 0xa44: 0x046e, 0xa45: 0x042a, + 0xa46: 0x042e, 0xa47: 0x0432, 0xa48: 0x0436, 0xa49: 0x043a, 0xa4a: 0x043e, 0xa4b: 0x0442, + 0xa4c: 0x0446, 0xa4d: 0x044a, 0xa4e: 0x044e, 0xa4f: 0x4afe, 0xa50: 0x4b04, 0xa51: 0x4b0a, + 0xa52: 0x4b10, 0xa53: 0x4b16, 0xa54: 0x4b1c, 0xa55: 0x4b22, 0xa56: 0x4b28, 0xa57: 0x4b2e, + 0xa58: 0x4b34, 0xa59: 0x4b3a, 0xa5a: 0x4b40, 0xa5b: 0x4b46, 0xa5c: 0x4b4c, 0xa5d: 0x4b52, + 0xa5e: 0x4b58, 0xa5f: 0x4b5e, 0xa60: 0x4b64, 0xa61: 0x4b6a, 0xa62: 0x4b70, 0xa63: 0x4b76, + 0xa64: 0x04b6, 0xa65: 0x0452, 0xa66: 0x0456, 0xa67: 0x04da, 0xa68: 0x04de, 0xa69: 0x04e2, + 0xa6a: 0x04e6, 0xa6b: 0x04ea, 0xa6c: 0x04ee, 0xa6d: 0x04f2, 0xa6e: 0x045e, 0xa6f: 0x04f6, + 0xa70: 0x04fa, 0xa71: 0x0462, 0xa72: 0x0466, 0xa73: 0x046a, 0xa74: 0x0472, 0xa75: 0x0476, + 0xa76: 0x047a, 0xa77: 0x047e, 0xa78: 0x0482, 0xa79: 0x0486, 0xa7a: 0x048a, 0xa7b: 0x048e, + 0xa7c: 0x0492, 0xa7d: 0x0496, 0xa7e: 0x049a, 0xa7f: 0x049e, + // Block 0x2a, offset 0xa80 + 0xa80: 0x04a2, 0xa81: 0x04a6, 0xa82: 0x04fe, 0xa83: 0x0502, 0xa84: 0x04aa, 0xa85: 0x04ae, + 0xa86: 0x04b2, 0xa87: 0x04ba, 0xa88: 0x04be, 0xa89: 0x04c2, 0xa8a: 0x04c6, 0xa8b: 0x04ca, + 0xa8c: 0x04ce, 0xa8d: 0x04d2, 0xa8e: 0x04d6, + 0xa92: 0x07ba, 0xa93: 0x0816, 0xa94: 0x07c6, 0xa95: 0x0a76, 0xa96: 0x07ca, 0xa97: 0x07e2, + 0xa98: 0x07ce, 0xa99: 0x108e, 0xa9a: 0x0802, 0xa9b: 0x07d6, 0xa9c: 0x07be, 0xa9d: 0x0afa, + 0xa9e: 0x0a8a, 0xa9f: 0x082a, + // Block 0x2b, offset 0xac0 + 0xac0: 0x2184, 0xac1: 0x218a, 0xac2: 0x2190, 0xac3: 0x2196, 0xac4: 0x219c, 0xac5: 0x21a2, + 0xac6: 0x21a8, 0xac7: 0x21ae, 0xac8: 0x21b4, 0xac9: 0x21ba, 0xaca: 0x21c0, 0xacb: 0x21c6, + 0xacc: 0x21cc, 0xacd: 0x21d2, 0xace: 0x285d, 0xacf: 0x2866, 0xad0: 0x286f, 0xad1: 0x2878, + 0xad2: 0x2881, 0xad3: 0x288a, 0xad4: 0x2893, 0xad5: 0x289c, 0xad6: 0x28a5, 0xad7: 0x28b7, + 0xad8: 0x28c0, 0xad9: 0x28c9, 0xada: 0x28d2, 0xadb: 0x28db, 0xadc: 0x28ae, 0xadd: 0x2ce3, + 0xade: 0x2c24, 0xae0: 0x21d8, 0xae1: 0x21f0, 0xae2: 0x21e4, 0xae3: 0x2238, + 0xae4: 0x21f6, 0xae5: 0x2214, 0xae6: 0x21de, 0xae7: 0x220e, 0xae8: 0x21ea, 0xae9: 0x2220, + 0xaea: 0x2250, 0xaeb: 0x226e, 0xaec: 0x2268, 0xaed: 0x225c, 0xaee: 0x22aa, 0xaef: 0x223e, + 0xaf0: 0x224a, 0xaf1: 0x2262, 0xaf2: 0x2256, 0xaf3: 0x2280, 0xaf4: 0x222c, 0xaf5: 0x2274, + 0xaf6: 0x229e, 0xaf7: 0x2286, 0xaf8: 0x221a, 0xaf9: 0x21fc, 0xafa: 0x2232, 0xafb: 0x2244, + 0xafc: 0x227a, 0xafd: 0x2202, 0xafe: 0x22a4, 0xaff: 0x2226, + // Block 0x2c, offset 0xb00 + 0xb00: 0x228c, 0xb01: 0x2208, 0xb02: 0x2292, 0xb03: 0x2298, 0xb04: 0x0a2a, 0xb05: 0x0bfe, + 0xb06: 0x0da2, 0xb07: 0x11c2, + 0xb10: 0x1cf4, 0xb11: 0x19d6, + 0xb12: 0x19d9, 0xb13: 0x19dc, 0xb14: 0x19df, 0xb15: 0x19e2, 0xb16: 0x19e5, 0xb17: 0x19e8, + 0xb18: 0x19eb, 0xb19: 0x19ee, 0xb1a: 0x19f7, 0xb1b: 0x19fa, 0xb1c: 0x19fd, 0xb1d: 0x1a00, + 0xb1e: 0x1a03, 0xb1f: 0x1a06, 0xb20: 0x0406, 0xb21: 0x040e, 0xb22: 0x0412, 0xb23: 0x041a, + 0xb24: 0x041e, 0xb25: 0x0422, 0xb26: 0x042a, 0xb27: 0x0432, 0xb28: 0x0436, 0xb29: 0x043e, + 0xb2a: 0x0442, 0xb2b: 0x0446, 0xb2c: 0x044a, 0xb2d: 0x044e, 0xb2e: 0x2f59, 0xb2f: 0x2f61, + 0xb30: 0x2f69, 0xb31: 0x2f71, 0xb32: 0x2f79, 0xb33: 0x2f81, 0xb34: 0x2f89, 0xb35: 0x2f91, + 0xb36: 0x2fa1, 0xb37: 0x2fa9, 0xb38: 0x2fb1, 0xb39: 0x2fb9, 0xb3a: 0x2fc1, 0xb3b: 0x2fc9, + 0xb3c: 0x3014, 0xb3d: 0x2fdc, 0xb3e: 0x2f99, + // Block 0x2d, offset 0xb40 + 0xb40: 0x07ba, 0xb41: 0x0816, 0xb42: 0x07c6, 0xb43: 0x0a76, 0xb44: 0x081a, 0xb45: 0x08aa, + 0xb46: 0x07c2, 0xb47: 0x08a6, 0xb48: 0x0806, 0xb49: 0x0982, 0xb4a: 0x0e02, 0xb4b: 0x0f8a, + 0xb4c: 0x0ed2, 0xb4d: 0x0e16, 0xb4e: 0x155a, 0xb4f: 0x0a86, 0xb50: 0x0dca, 0xb51: 0x0e46, + 0xb52: 0x0e06, 0xb53: 0x1146, 0xb54: 0x09f6, 0xb55: 0x0ffe, 0xb56: 0x1482, 0xb57: 0x115a, + 0xb58: 0x093e, 0xb59: 0x118a, 0xb5a: 0x1096, 0xb5b: 0x0b12, 0xb5c: 0x150a, 0xb5d: 0x087a, + 0xb5e: 0x09a6, 0xb5f: 0x0ef2, 0xb60: 0x1622, 0xb61: 0x083e, 0xb62: 0x08ce, 0xb63: 0x0e96, + 0xb64: 0x07ca, 0xb65: 0x07e2, 0xb66: 0x07ce, 0xb67: 0x0bd6, 0xb68: 0x09ea, 0xb69: 0x097a, + 0xb6a: 0x0b52, 0xb6b: 0x0b46, 0xb6c: 0x10e6, 0xb6d: 0x083a, 0xb6e: 0x1496, 0xb6f: 0x0996, + 0xb70: 0x0aee, 0xb71: 0x1a09, 0xb72: 0x1a0c, 0xb73: 0x1a0f, 0xb74: 0x1a12, 0xb75: 0x1a1b, + 0xb76: 0x1a1e, 0xb77: 0x1a21, 0xb78: 0x1a24, 0xb79: 0x1a27, 0xb7a: 0x1a2a, 0xb7b: 0x1a2d, + 0xb7c: 0x1a30, 0xb7d: 0x1a33, 0xb7e: 0x1a36, 0xb7f: 0x1a3f, + // Block 0x2e, offset 0xb80 + 0xb80: 0x1df6, 0xb81: 0x1e05, 0xb82: 0x1e14, 0xb83: 0x1e23, 0xb84: 0x1e32, 0xb85: 0x1e41, + 0xb86: 0x1e50, 0xb87: 0x1e5f, 0xb88: 0x1e6e, 0xb89: 0x22bc, 0xb8a: 0x22ce, 0xb8b: 0x22e0, + 0xb8c: 0x1a81, 0xb8d: 0x1d34, 0xb8e: 0x1b02, 0xb8f: 0x1cd8, 0xb90: 0x05c6, 0xb91: 0x05ce, + 0xb92: 0x05d6, 0xb93: 0x05de, 0xb94: 0x05e6, 0xb95: 0x05ea, 0xb96: 0x05ee, 0xb97: 0x05f2, + 0xb98: 0x05f6, 0xb99: 0x05fa, 0xb9a: 0x05fe, 0xb9b: 0x0602, 0xb9c: 0x0606, 0xb9d: 0x060a, + 0xb9e: 0x060e, 0xb9f: 0x0612, 0xba0: 0x0616, 0xba1: 0x061e, 0xba2: 0x0622, 0xba3: 0x0626, + 0xba4: 0x062a, 0xba5: 0x062e, 0xba6: 0x0632, 0xba7: 0x0636, 0xba8: 0x063a, 0xba9: 0x063e, + 0xbaa: 0x0642, 0xbab: 0x0646, 0xbac: 0x064a, 0xbad: 0x064e, 0xbae: 0x0652, 0xbaf: 0x0656, + 0xbb0: 0x065a, 0xbb1: 0x065e, 0xbb2: 0x0662, 0xbb3: 0x066a, 0xbb4: 0x0672, 0xbb5: 0x067a, + 0xbb6: 0x067e, 0xbb7: 0x0682, 0xbb8: 0x0686, 0xbb9: 0x068a, 0xbba: 0x068e, 0xbbb: 0x0692, + 0xbbc: 0x0696, 0xbbd: 0x069a, 0xbbe: 0x069e, 0xbbf: 0x282a, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x2c43, 0xbc1: 0x2adf, 0xbc2: 0x2c53, 0xbc3: 0x29b7, 0xbc4: 0x3025, 0xbc5: 0x29c1, + 0xbc6: 0x29cb, 0xbc7: 0x3069, 0xbc8: 0x2aec, 0xbc9: 0x29d5, 0xbca: 0x29df, 0xbcb: 0x29e9, + 0xbcc: 0x2b13, 0xbcd: 0x2b20, 0xbce: 0x2af9, 0xbcf: 0x2b06, 0xbd0: 0x2fea, 0xbd1: 0x2b2d, + 0xbd2: 0x2b3a, 0xbd3: 0x2cf5, 0xbd4: 0x27eb, 0xbd5: 0x2d08, 0xbd6: 0x2d1b, 0xbd7: 0x2c63, + 0xbd8: 0x2b47, 0xbd9: 0x2d2e, 0xbda: 0x2d41, 0xbdb: 0x2b54, 0xbdc: 0x29f3, 0xbdd: 0x29fd, + 0xbde: 0x2ff8, 0xbdf: 0x2b61, 0xbe0: 0x2c73, 0xbe1: 0x3036, 0xbe2: 0x2a07, 0xbe3: 0x2a11, + 0xbe4: 0x2b6e, 0xbe5: 0x2a1b, 0xbe6: 0x2a25, 0xbe7: 0x2800, 0xbe8: 0x2807, 0xbe9: 0x2a2f, + 0xbea: 0x2a39, 0xbeb: 0x2d54, 0xbec: 0x2b7b, 0xbed: 0x2c83, 0xbee: 0x2d67, 0xbef: 0x2b88, + 0xbf0: 0x2a4d, 0xbf1: 0x2a43, 0xbf2: 0x307d, 0xbf3: 0x2b95, 0xbf4: 0x2d7a, 0xbf5: 0x2a57, + 0xbf6: 0x2c93, 0xbf7: 0x2a61, 0xbf8: 0x2baf, 0xbf9: 0x2a6b, 0xbfa: 0x2bbc, 0xbfb: 0x3047, + 0xbfc: 0x2ba2, 0xbfd: 0x2ca3, 0xbfe: 0x2bc9, 0xbff: 0x280e, + // Block 0x30, offset 0xc00 + 0xc00: 0x3058, 0xc01: 0x2a75, 0xc02: 0x2a7f, 0xc03: 0x2bd6, 0xc04: 0x2a89, 0xc05: 0x2a93, + 0xc06: 0x2a9d, 0xc07: 0x2cb3, 0xc08: 0x2be3, 0xc09: 0x2815, 0xc0a: 0x2d8d, 0xc0b: 0x2fd1, + 0xc0c: 0x2cc3, 0xc0d: 0x2bf0, 0xc0e: 0x3006, 0xc0f: 0x2aa7, 0xc10: 0x2ab1, 0xc11: 0x2bfd, + 0xc12: 0x281c, 0xc13: 0x2c0a, 0xc14: 0x2cd3, 0xc15: 0x2823, 0xc16: 0x2da0, 0xc17: 0x2abb, + 0xc18: 0x1de7, 0xc19: 0x1dfb, 0xc1a: 0x1e0a, 0xc1b: 0x1e19, 0xc1c: 0x1e28, 0xc1d: 0x1e37, + 0xc1e: 0x1e46, 0xc1f: 0x1e55, 0xc20: 0x1e64, 0xc21: 0x1e73, 0xc22: 0x22c2, 0xc23: 0x22d4, + 0xc24: 0x22e6, 0xc25: 0x22f2, 0xc26: 0x22fe, 0xc27: 0x230a, 0xc28: 0x2316, 0xc29: 0x2322, + 0xc2a: 0x232e, 0xc2b: 0x233a, 0xc2c: 0x2376, 0xc2d: 0x2382, 0xc2e: 0x238e, 0xc2f: 0x239a, + 0xc30: 0x23a6, 0xc31: 0x1d44, 0xc32: 0x1af6, 0xc33: 0x1a63, 0xc34: 0x1d14, 0xc35: 0x1b77, + 0xc36: 0x1b86, 0xc37: 0x1afc, 0xc38: 0x1d2c, 0xc39: 0x1d30, 0xc3a: 0x1a8d, 0xc3b: 0x2838, + 0xc3c: 0x2846, 0xc3d: 0x2831, 0xc3e: 0x283f, 0xc3f: 0x2c17, + // Block 0x31, offset 0xc40 + 0xc40: 0x1b7a, 0xc41: 0x1b62, 0xc42: 0x1d90, 0xc43: 0x1b4a, 0xc44: 0x1b23, 0xc45: 0x1a96, + 0xc46: 0x1aa5, 0xc47: 0x1a75, 0xc48: 0x1d20, 0xc49: 0x1e82, 0xc4a: 0x1b7d, 0xc4b: 0x1b65, + 0xc4c: 0x1d94, 0xc4d: 0x1da0, 0xc4e: 0x1b56, 0xc4f: 0x1b2c, 0xc50: 0x1a84, 0xc51: 0x1d4c, + 0xc52: 0x1ce0, 0xc53: 0x1ccc, 0xc54: 0x1cfc, 0xc55: 0x1da4, 0xc56: 0x1b59, 0xc57: 0x1af9, + 0xc58: 0x1b2f, 0xc59: 0x1b0e, 0xc5a: 0x1b71, 0xc5b: 0x1da8, 0xc5c: 0x1b5c, 0xc5d: 0x1af0, + 0xc5e: 0x1b32, 0xc5f: 0x1d6c, 0xc60: 0x1d24, 0xc61: 0x1b44, 0xc62: 0x1d54, 0xc63: 0x1d70, + 0xc64: 0x1d28, 0xc65: 0x1b47, 0xc66: 0x1d58, 0xc67: 0x2418, 0xc68: 0x242c, 0xc69: 0x1ac6, + 0xc6a: 0x1d50, 0xc6b: 0x1ce4, 0xc6c: 0x1cd0, 0xc6d: 0x1d78, 0xc6e: 0x284d, 0xc6f: 0x28e4, + 0xc70: 0x1b89, 0xc71: 0x1b74, 0xc72: 0x1dac, 0xc73: 0x1b5f, 0xc74: 0x1b80, 0xc75: 0x1b68, + 0xc76: 0x1d98, 0xc77: 0x1b4d, 0xc78: 0x1b26, 0xc79: 0x1ab1, 0xc7a: 0x1b83, 0xc7b: 0x1b6b, + 0xc7c: 0x1d9c, 0xc7d: 0x1b50, 0xc7e: 0x1b29, 0xc7f: 0x1ab4, + // Block 0x32, offset 0xc80 + 0xc80: 0x1d5c, 0xc81: 0x1ce8, 0xc82: 0x1e7d, 0xc83: 0x1a66, 0xc84: 0x1aea, 0xc85: 0x1aed, + 0xc86: 0x2425, 0xc87: 0x1cc4, 0xc88: 0x1af3, 0xc89: 0x1a78, 0xc8a: 0x1b11, 0xc8b: 0x1a7b, + 0xc8c: 0x1b1a, 0xc8d: 0x1a99, 0xc8e: 0x1a9c, 0xc8f: 0x1b35, 0xc90: 0x1b3b, 0xc91: 0x1b3e, + 0xc92: 0x1d60, 0xc93: 0x1b41, 0xc94: 0x1b53, 0xc95: 0x1d68, 0xc96: 0x1d74, 0xc97: 0x1ac0, + 0xc98: 0x1e87, 0xc99: 0x1cec, 0xc9a: 0x1ac3, 0xc9b: 0x1b8c, 0xc9c: 0x1ad5, 0xc9d: 0x1ae4, + 0xc9e: 0x2412, 0xc9f: 0x240c, 0xca0: 0x1df1, 0xca1: 0x1e00, 0xca2: 0x1e0f, 0xca3: 0x1e1e, + 0xca4: 0x1e2d, 0xca5: 0x1e3c, 0xca6: 0x1e4b, 0xca7: 0x1e5a, 0xca8: 0x1e69, 0xca9: 0x22b6, + 0xcaa: 0x22c8, 0xcab: 0x22da, 0xcac: 0x22ec, 0xcad: 0x22f8, 0xcae: 0x2304, 0xcaf: 0x2310, + 0xcb0: 0x231c, 0xcb1: 0x2328, 0xcb2: 0x2334, 0xcb3: 0x2370, 0xcb4: 0x237c, 0xcb5: 0x2388, + 0xcb6: 0x2394, 0xcb7: 0x23a0, 0xcb8: 0x23ac, 0xcb9: 0x23b2, 0xcba: 0x23b8, 0xcbb: 0x23be, + 0xcbc: 0x23c4, 0xcbd: 0x23d6, 0xcbe: 0x23dc, 0xcbf: 0x1d40, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x1472, 0xcc1: 0x0df6, 0xcc2: 0x14ce, 0xcc3: 0x149a, 0xcc4: 0x0f52, 0xcc5: 0x07e6, + 0xcc6: 0x09da, 0xcc7: 0x1726, 0xcc8: 0x1726, 0xcc9: 0x0b06, 0xcca: 0x155a, 0xccb: 0x0a3e, + 0xccc: 0x0b02, 0xccd: 0x0cea, 0xcce: 0x10ca, 0xccf: 0x125a, 0xcd0: 0x1392, 0xcd1: 0x13ce, + 0xcd2: 0x1402, 0xcd3: 0x1516, 0xcd4: 0x0e6e, 0xcd5: 0x0efa, 0xcd6: 0x0fa6, 0xcd7: 0x103e, + 0xcd8: 0x135a, 0xcd9: 0x1542, 0xcda: 0x166e, 0xcdb: 0x080a, 0xcdc: 0x09ae, 0xcdd: 0x0e82, + 0xcde: 0x0fca, 0xcdf: 0x138e, 0xce0: 0x16be, 0xce1: 0x0bae, 0xce2: 0x0f72, 0xce3: 0x137e, + 0xce4: 0x1412, 0xce5: 0x0d1e, 0xce6: 0x12b6, 0xce7: 0x13da, 0xce8: 0x0c1a, 0xce9: 0x0e0a, + 0xcea: 0x0f12, 0xceb: 0x1016, 0xcec: 0x1522, 0xced: 0x084a, 0xcee: 0x08e2, 0xcef: 0x094e, + 0xcf0: 0x0d86, 0xcf1: 0x0e7a, 0xcf2: 0x0fc6, 0xcf3: 0x10ea, 0xcf4: 0x1272, 0xcf5: 0x1386, + 0xcf6: 0x139e, 0xcf7: 0x14c2, 0xcf8: 0x15ea, 0xcf9: 0x169e, 0xcfa: 0x16ba, 0xcfb: 0x1126, + 0xcfc: 0x1166, 0xcfd: 0x121e, 0xcfe: 0x133e, 0xcff: 0x1576, + // Block 0x34, offset 0xd00 + 0xd00: 0x16c6, 0xd01: 0x1446, 0xd02: 0x0ac2, 0xd03: 0x0c36, 0xd04: 0x11d6, 0xd05: 0x1296, + 0xd06: 0x0ffa, 0xd07: 0x112e, 0xd08: 0x1492, 0xd09: 0x15e2, 0xd0a: 0x0abe, 0xd0b: 0x0b8a, + 0xd0c: 0x0e72, 0xd0d: 0x0f26, 0xd0e: 0x0f5a, 0xd0f: 0x120e, 0xd10: 0x1236, 0xd11: 0x15a2, + 0xd12: 0x094a, 0xd13: 0x12a2, 0xd14: 0x08ee, 0xd15: 0x08ea, 0xd16: 0x1192, 0xd17: 0x1222, + 0xd18: 0x1356, 0xd19: 0x15aa, 0xd1a: 0x1462, 0xd1b: 0x0d22, 0xd1c: 0x0e6e, 0xd1d: 0x1452, + 0xd1e: 0x07f2, 0xd1f: 0x0b5e, 0xd20: 0x0c8e, 0xd21: 0x102a, 0xd22: 0x10aa, 0xd23: 0x096e, + 0xd24: 0x1136, 0xd25: 0x085a, 0xd26: 0x0c72, 0xd27: 0x07d2, 0xd28: 0x0ee6, 0xd29: 0x0d9e, + 0xd2a: 0x120a, 0xd2b: 0x09c2, 0xd2c: 0x0aae, 0xd2d: 0x10f6, 0xd2e: 0x135e, 0xd2f: 0x1436, + 0xd30: 0x0eb2, 0xd31: 0x14f2, 0xd32: 0x0ede, 0xd33: 0x0d32, 0xd34: 0x1316, 0xd35: 0x0d52, + 0xd36: 0x10a6, 0xd37: 0x0826, 0xd38: 0x08a2, 0xd39: 0x08e6, 0xd3a: 0x0e4e, 0xd3b: 0x11f6, + 0xd3c: 0x12ee, 0xd3d: 0x1442, 0xd3e: 0x1556, 0xd3f: 0x0956, + // Block 0x35, offset 0xd40 + 0xd40: 0x0a0a, 0xd41: 0x0b12, 0xd42: 0x0c2a, 0xd43: 0x0dba, 0xd44: 0x0f76, 0xd45: 0x113a, + 0xd46: 0x1592, 0xd47: 0x1676, 0xd48: 0x16ca, 0xd49: 0x16e2, 0xd4a: 0x0932, 0xd4b: 0x0dee, + 0xd4c: 0x0e9e, 0xd4d: 0x14e6, 0xd4e: 0x0bf6, 0xd4f: 0x0cd2, 0xd50: 0x0cee, 0xd51: 0x0d7e, + 0xd52: 0x0f66, 0xd53: 0x0fb2, 0xd54: 0x1062, 0xd55: 0x1186, 0xd56: 0x122a, 0xd57: 0x128e, + 0xd58: 0x14d6, 0xd59: 0x1366, 0xd5a: 0x14fe, 0xd5b: 0x157a, 0xd5c: 0x090a, 0xd5d: 0x0936, + 0xd5e: 0x0a1e, 0xd5f: 0x0fa2, 0xd60: 0x13ee, 0xd61: 0x1436, 0xd62: 0x0c16, 0xd63: 0x0c86, + 0xd64: 0x0d4a, 0xd65: 0x0eaa, 0xd66: 0x11d2, 0xd67: 0x101e, 0xd68: 0x0836, 0xd69: 0x0a7a, + 0xd6a: 0x0b5e, 0xd6b: 0x0bc2, 0xd6c: 0x0c92, 0xd6d: 0x103a, 0xd6e: 0x1056, 0xd6f: 0x1266, + 0xd70: 0x1286, 0xd71: 0x155e, 0xd72: 0x15de, 0xd73: 0x15ee, 0xd74: 0x162a, 0xd75: 0x084e, + 0xd76: 0x117a, 0xd77: 0x154a, 0xd78: 0x15c6, 0xd79: 0x0caa, 0xd7a: 0x0812, 0xd7b: 0x0872, + 0xd7c: 0x0b62, 0xd7d: 0x0b82, 0xd7e: 0x0daa, 0xd7f: 0x0e6e, + // Block 0x36, offset 0xd80 + 0xd80: 0x0fbe, 0xd81: 0x10c6, 0xd82: 0x1372, 0xd83: 0x1512, 0xd84: 0x171e, 0xd85: 0x0dde, + 0xd86: 0x159e, 0xd87: 0x092e, 0xd88: 0x0e2a, 0xd89: 0x0e36, 0xd8a: 0x0f0a, 0xd8b: 0x0f42, + 0xd8c: 0x1046, 0xd8d: 0x10a2, 0xd8e: 0x1122, 0xd8f: 0x1206, 0xd90: 0x1636, 0xd91: 0x08aa, + 0xd92: 0x0cfe, 0xd93: 0x15ae, 0xd94: 0x0862, 0xd95: 0x0ba6, 0xd96: 0x0f2a, 0xd97: 0x14da, + 0xd98: 0x0c62, 0xd99: 0x0cb2, 0xd9a: 0x0e3e, 0xd9b: 0x102a, 0xd9c: 0x15b6, 0xd9d: 0x0912, + 0xd9e: 0x09fa, 0xd9f: 0x0b92, 0xda0: 0x0dce, 0xda1: 0x0e1a, 0xda2: 0x0e5a, 0xda3: 0x0eee, + 0xda4: 0x1042, 0xda5: 0x10b6, 0xda6: 0x1252, 0xda7: 0x13f2, 0xda8: 0x13fe, 0xda9: 0x1552, + 0xdaa: 0x15d2, 0xdab: 0x097e, 0xdac: 0x0f46, 0xdad: 0x09fe, 0xdae: 0x0fc2, 0xdaf: 0x1066, + 0xdb0: 0x1382, 0xdb1: 0x15ba, 0xdb2: 0x16a6, 0xdb3: 0x16ce, 0xdb4: 0x0e32, 0xdb5: 0x0f22, + 0xdb6: 0x12be, 0xdb7: 0x11b2, 0xdb8: 0x11be, 0xdb9: 0x11e2, 0xdba: 0x1012, 0xdbb: 0x0f9a, + 0xdbc: 0x145e, 0xdbd: 0x082e, 0xdbe: 0x1326, 0xdbf: 0x0916, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x0906, 0xdc1: 0x0c06, 0xdc2: 0x0d26, 0xdc3: 0x11ee, 0xdc4: 0x0b4e, 0xdc5: 0x0efe, + 0xdc6: 0x0dea, 0xdc7: 0x14e2, 0xdc8: 0x13e2, 0xdc9: 0x15a6, 0xdca: 0x141e, 0xdcb: 0x0c22, + 0xdcc: 0x0882, 0xdcd: 0x0a56, 0xdd0: 0x0aaa, + 0xdd2: 0x0dda, 0xdd5: 0x08f2, 0xdd6: 0x101a, 0xdd7: 0x10de, + 0xdd8: 0x1142, 0xdd9: 0x115e, 0xdda: 0x1162, 0xddb: 0x1176, 0xddc: 0x15f6, 0xddd: 0x11e6, + 0xdde: 0x126a, 0xde0: 0x138a, 0xde2: 0x144e, + 0xde5: 0x1502, 0xde6: 0x152e, + 0xdea: 0x164a, 0xdeb: 0x164e, 0xdec: 0x1652, 0xded: 0x16b6, 0xdee: 0x1526, 0xdef: 0x15c2, + 0xdf0: 0x0852, 0xdf1: 0x0876, 0xdf2: 0x088a, 0xdf3: 0x0946, 0xdf4: 0x0952, 0xdf5: 0x0992, + 0xdf6: 0x0a46, 0xdf7: 0x0a62, 0xdf8: 0x0a6a, 0xdf9: 0x0aa6, 0xdfa: 0x0ab2, 0xdfb: 0x0b8e, + 0xdfc: 0x0b96, 0xdfd: 0x0c9e, 0xdfe: 0x0cc6, 0xdff: 0x0cce, + // Block 0x38, offset 0xe00 + 0xe00: 0x0ce6, 0xe01: 0x0d92, 0xe02: 0x0dc2, 0xe03: 0x0de2, 0xe04: 0x0e52, 0xe05: 0x0f16, + 0xe06: 0x0f32, 0xe07: 0x0f62, 0xe08: 0x0fb6, 0xe09: 0x0fd6, 0xe0a: 0x104a, 0xe0b: 0x112a, + 0xe0c: 0x1146, 0xe0d: 0x114e, 0xe0e: 0x114a, 0xe0f: 0x1152, 0xe10: 0x1156, 0xe11: 0x115a, + 0xe12: 0x116e, 0xe13: 0x1172, 0xe14: 0x1196, 0xe15: 0x11aa, 0xe16: 0x11c6, 0xe17: 0x122a, + 0xe18: 0x1232, 0xe19: 0x123a, 0xe1a: 0x124e, 0xe1b: 0x1276, 0xe1c: 0x12c6, 0xe1d: 0x12fa, + 0xe1e: 0x12fa, 0xe1f: 0x1362, 0xe20: 0x140a, 0xe21: 0x1422, 0xe22: 0x1456, 0xe23: 0x145a, + 0xe24: 0x149e, 0xe25: 0x14a2, 0xe26: 0x14fa, 0xe27: 0x1502, 0xe28: 0x15d6, 0xe29: 0x161a, + 0xe2a: 0x1632, 0xe2b: 0x0c96, 0xe2c: 0x184b, 0xe2d: 0x12de, + 0xe30: 0x07da, 0xe31: 0x08de, 0xe32: 0x089e, 0xe33: 0x0846, 0xe34: 0x0886, 0xe35: 0x08b2, + 0xe36: 0x0942, 0xe37: 0x095e, 0xe38: 0x0a46, 0xe39: 0x0a32, 0xe3a: 0x0a42, 0xe3b: 0x0a5e, + 0xe3c: 0x0aaa, 0xe3d: 0x0aba, 0xe3e: 0x0afe, 0xe3f: 0x0b0a, + // Block 0x39, offset 0xe40 + 0xe40: 0x0b26, 0xe41: 0x0b36, 0xe42: 0x0c1e, 0xe43: 0x0c26, 0xe44: 0x0c56, 0xe45: 0x0c76, + 0xe46: 0x0ca6, 0xe47: 0x0cbe, 0xe48: 0x0cae, 0xe49: 0x0cce, 0xe4a: 0x0cc2, 0xe4b: 0x0ce6, + 0xe4c: 0x0d02, 0xe4d: 0x0d5a, 0xe4e: 0x0d66, 0xe4f: 0x0d6e, 0xe50: 0x0d96, 0xe51: 0x0dda, + 0xe52: 0x0e0a, 0xe53: 0x0e0e, 0xe54: 0x0e22, 0xe55: 0x0ea2, 0xe56: 0x0eb2, 0xe57: 0x0f0a, + 0xe58: 0x0f56, 0xe59: 0x0f4e, 0xe5a: 0x0f62, 0xe5b: 0x0f7e, 0xe5c: 0x0fb6, 0xe5d: 0x110e, + 0xe5e: 0x0fda, 0xe5f: 0x100e, 0xe60: 0x101a, 0xe61: 0x105a, 0xe62: 0x1076, 0xe63: 0x109a, + 0xe64: 0x10be, 0xe65: 0x10c2, 0xe66: 0x10de, 0xe67: 0x10e2, 0xe68: 0x10f2, 0xe69: 0x1106, + 0xe6a: 0x1102, 0xe6b: 0x1132, 0xe6c: 0x11ae, 0xe6d: 0x11c6, 0xe6e: 0x11de, 0xe6f: 0x1216, + 0xe70: 0x122a, 0xe71: 0x1246, 0xe72: 0x1276, 0xe73: 0x132a, 0xe74: 0x1352, 0xe75: 0x13c6, + 0xe76: 0x140e, 0xe77: 0x141a, 0xe78: 0x1422, 0xe79: 0x143a, 0xe7a: 0x144e, 0xe7b: 0x143e, + 0xe7c: 0x1456, 0xe7d: 0x1452, 0xe7e: 0x144a, 0xe7f: 0x145a, + // Block 0x3a, offset 0xe80 + 0xe80: 0x1466, 0xe81: 0x14a2, 0xe82: 0x14de, 0xe83: 0x150e, 0xe84: 0x1546, 0xe85: 0x1566, + 0xe86: 0x15b2, 0xe87: 0x15d6, 0xe88: 0x15f6, 0xe89: 0x160a, 0xe8a: 0x161a, 0xe8b: 0x1626, + 0xe8c: 0x1632, 0xe8d: 0x1686, 0xe8e: 0x1726, 0xe8f: 0x17e2, 0xe90: 0x17dd, 0xe91: 0x180f, + 0xe92: 0x0702, 0xe93: 0x072a, 0xe94: 0x072e, 0xe95: 0x1891, 0xe96: 0x18be, 0xe97: 0x1936, + 0xe98: 0x1712, 0xe99: 0x1722, + // Block 0x3b, offset 0xec0 + 0xec0: 0x1b05, 0xec1: 0x1b08, 0xec2: 0x1b0b, 0xec3: 0x1d38, 0xec4: 0x1d3c, 0xec5: 0x1b8f, + 0xec6: 0x1b8f, + 0xed3: 0x1ea5, 0xed4: 0x1e96, 0xed5: 0x1e9b, 0xed6: 0x1eaa, 0xed7: 0x1ea0, + 0xedd: 0x44d1, + 0xede: 0x8116, 0xedf: 0x4543, 0xee0: 0x0320, 0xee1: 0x0308, 0xee2: 0x0311, 0xee3: 0x0314, + 0xee4: 0x0317, 0xee5: 0x031a, 0xee6: 0x031d, 0xee7: 0x0323, 0xee8: 0x0326, 0xee9: 0x0017, + 0xeea: 0x4531, 0xeeb: 0x4537, 0xeec: 0x4635, 0xeed: 0x463d, 0xeee: 0x4489, 0xeef: 0x448f, + 0xef0: 0x4495, 0xef1: 0x449b, 0xef2: 0x44a7, 0xef3: 0x44ad, 0xef4: 0x44b3, 0xef5: 0x44bf, + 0xef6: 0x44c5, 0xef8: 0x44cb, 0xef9: 0x44d7, 0xefa: 0x44dd, 0xefb: 0x44e3, + 0xefc: 0x44ef, 0xefe: 0x44f5, + // Block 0x3c, offset 0xf00 + 0xf00: 0x44fb, 0xf01: 0x4501, 0xf03: 0x4507, 0xf04: 0x450d, + 0xf06: 0x4519, 0xf07: 0x451f, 0xf08: 0x4525, 0xf09: 0x452b, 0xf0a: 0x453d, 0xf0b: 0x44b9, + 0xf0c: 0x44a1, 0xf0d: 0x44e9, 0xf0e: 0x4513, 0xf0f: 0x1eaf, 0xf10: 0x038c, 0xf11: 0x038c, + 0xf12: 0x0395, 0xf13: 0x0395, 0xf14: 0x0395, 0xf15: 0x0395, 0xf16: 0x0398, 0xf17: 0x0398, + 0xf18: 0x0398, 0xf19: 0x0398, 0xf1a: 0x039e, 0xf1b: 0x039e, 0xf1c: 0x039e, 0xf1d: 0x039e, + 0xf1e: 0x0392, 0xf1f: 0x0392, 0xf20: 0x0392, 0xf21: 0x0392, 0xf22: 0x039b, 0xf23: 0x039b, + 0xf24: 0x039b, 0xf25: 0x039b, 0xf26: 0x038f, 0xf27: 0x038f, 0xf28: 0x038f, 0xf29: 0x038f, + 0xf2a: 0x03c2, 0xf2b: 0x03c2, 0xf2c: 0x03c2, 0xf2d: 0x03c2, 0xf2e: 0x03c5, 0xf2f: 0x03c5, + 0xf30: 0x03c5, 0xf31: 0x03c5, 0xf32: 0x03a4, 0xf33: 0x03a4, 0xf34: 0x03a4, 0xf35: 0x03a4, + 0xf36: 0x03a1, 0xf37: 0x03a1, 0xf38: 0x03a1, 0xf39: 0x03a1, 0xf3a: 0x03a7, 0xf3b: 0x03a7, + 0xf3c: 0x03a7, 0xf3d: 0x03a7, 0xf3e: 0x03aa, 0xf3f: 0x03aa, + // Block 0x3d, offset 0xf40 + 0xf40: 0x03aa, 0xf41: 0x03aa, 0xf42: 0x03b3, 0xf43: 0x03b3, 0xf44: 0x03b0, 0xf45: 0x03b0, + 0xf46: 0x03b6, 0xf47: 0x03b6, 0xf48: 0x03ad, 0xf49: 0x03ad, 0xf4a: 0x03bc, 0xf4b: 0x03bc, + 0xf4c: 0x03b9, 0xf4d: 0x03b9, 0xf4e: 0x03c8, 0xf4f: 0x03c8, 0xf50: 0x03c8, 0xf51: 0x03c8, + 0xf52: 0x03ce, 0xf53: 0x03ce, 0xf54: 0x03ce, 0xf55: 0x03ce, 0xf56: 0x03d4, 0xf57: 0x03d4, + 0xf58: 0x03d4, 0xf59: 0x03d4, 0xf5a: 0x03d1, 0xf5b: 0x03d1, 0xf5c: 0x03d1, 0xf5d: 0x03d1, + 0xf5e: 0x03d7, 0xf5f: 0x03d7, 0xf60: 0x03da, 0xf61: 0x03da, 0xf62: 0x03da, 0xf63: 0x03da, + 0xf64: 0x45af, 0xf65: 0x45af, 0xf66: 0x03e0, 0xf67: 0x03e0, 0xf68: 0x03e0, 0xf69: 0x03e0, + 0xf6a: 0x03dd, 0xf6b: 0x03dd, 0xf6c: 0x03dd, 0xf6d: 0x03dd, 0xf6e: 0x03fb, 0xf6f: 0x03fb, + 0xf70: 0x45a9, 0xf71: 0x45a9, + // Block 0x3e, offset 0xf80 + 0xf93: 0x03cb, 0xf94: 0x03cb, 0xf95: 0x03cb, 0xf96: 0x03cb, 0xf97: 0x03e9, + 0xf98: 0x03e9, 0xf99: 0x03e6, 0xf9a: 0x03e6, 0xf9b: 0x03ec, 0xf9c: 0x03ec, 0xf9d: 0x217f, + 0xf9e: 0x03f2, 0xf9f: 0x03f2, 0xfa0: 0x03e3, 0xfa1: 0x03e3, 0xfa2: 0x03ef, 0xfa3: 0x03ef, + 0xfa4: 0x03f8, 0xfa5: 0x03f8, 0xfa6: 0x03f8, 0xfa7: 0x03f8, 0xfa8: 0x0380, 0xfa9: 0x0380, + 0xfaa: 0x26da, 0xfab: 0x26da, 0xfac: 0x274a, 0xfad: 0x274a, 0xfae: 0x2719, 0xfaf: 0x2719, + 0xfb0: 0x2735, 0xfb1: 0x2735, 0xfb2: 0x272e, 0xfb3: 0x272e, 0xfb4: 0x273c, 0xfb5: 0x273c, + 0xfb6: 0x2743, 0xfb7: 0x2743, 0xfb8: 0x2743, 0xfb9: 0x2720, 0xfba: 0x2720, 0xfbb: 0x2720, + 0xfbc: 0x03f5, 0xfbd: 0x03f5, 0xfbe: 0x03f5, 0xfbf: 0x03f5, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x26e1, 0xfc1: 0x26e8, 0xfc2: 0x2704, 0xfc3: 0x2720, 0xfc4: 0x2727, 0xfc5: 0x1eb9, + 0xfc6: 0x1ebe, 0xfc7: 0x1ec3, 0xfc8: 0x1ed2, 0xfc9: 0x1ee1, 0xfca: 0x1ee6, 0xfcb: 0x1eeb, + 0xfcc: 0x1ef0, 0xfcd: 0x1ef5, 0xfce: 0x1f04, 0xfcf: 0x1f13, 0xfd0: 0x1f18, 0xfd1: 0x1f1d, + 0xfd2: 0x1f2c, 0xfd3: 0x1f3b, 0xfd4: 0x1f40, 0xfd5: 0x1f45, 0xfd6: 0x1f4a, 0xfd7: 0x1f59, + 0xfd8: 0x1f5e, 0xfd9: 0x1f6d, 0xfda: 0x1f72, 0xfdb: 0x1f77, 0xfdc: 0x1f86, 0xfdd: 0x1f8b, + 0xfde: 0x1f90, 0xfdf: 0x1f9a, 0xfe0: 0x1fd6, 0xfe1: 0x1fe5, 0xfe2: 0x1ff4, 0xfe3: 0x1ff9, + 0xfe4: 0x1ffe, 0xfe5: 0x2008, 0xfe6: 0x2017, 0xfe7: 0x201c, 0xfe8: 0x202b, 0xfe9: 0x2030, + 0xfea: 0x2035, 0xfeb: 0x2044, 0xfec: 0x2049, 0xfed: 0x2058, 0xfee: 0x205d, 0xfef: 0x2062, + 0xff0: 0x2067, 0xff1: 0x206c, 0xff2: 0x2071, 0xff3: 0x2076, 0xff4: 0x207b, 0xff5: 0x2080, + 0xff6: 0x2085, 0xff7: 0x208a, 0xff8: 0x208f, 0xff9: 0x2094, 0xffa: 0x2099, 0xffb: 0x209e, + 0xffc: 0x20a3, 0xffd: 0x20a8, 0xffe: 0x20ad, 0xfff: 0x20b7, + // Block 0x40, offset 0x1000 + 0x1000: 0x20bc, 0x1001: 0x20c1, 0x1002: 0x20c6, 0x1003: 0x20d0, 0x1004: 0x20d5, 0x1005: 0x20df, + 0x1006: 0x20e4, 0x1007: 0x20e9, 0x1008: 0x20ee, 0x1009: 0x20f3, 0x100a: 0x20f8, 0x100b: 0x20fd, + 0x100c: 0x2102, 0x100d: 0x2107, 0x100e: 0x2116, 0x100f: 0x2125, 0x1010: 0x212a, 0x1011: 0x212f, + 0x1012: 0x2134, 0x1013: 0x2139, 0x1014: 0x213e, 0x1015: 0x2148, 0x1016: 0x214d, 0x1017: 0x2152, + 0x1018: 0x2161, 0x1019: 0x2170, 0x101a: 0x2175, 0x101b: 0x4561, 0x101c: 0x4567, 0x101d: 0x459d, + 0x101e: 0x45f4, 0x101f: 0x45fb, 0x1020: 0x4602, 0x1021: 0x4609, 0x1022: 0x4610, 0x1023: 0x4617, + 0x1024: 0x26f6, 0x1025: 0x26fd, 0x1026: 0x2704, 0x1027: 0x270b, 0x1028: 0x2720, 0x1029: 0x2727, + 0x102a: 0x1ec8, 0x102b: 0x1ecd, 0x102c: 0x1ed2, 0x102d: 0x1ed7, 0x102e: 0x1ee1, 0x102f: 0x1ee6, + 0x1030: 0x1efa, 0x1031: 0x1eff, 0x1032: 0x1f04, 0x1033: 0x1f09, 0x1034: 0x1f13, 0x1035: 0x1f18, + 0x1036: 0x1f22, 0x1037: 0x1f27, 0x1038: 0x1f2c, 0x1039: 0x1f31, 0x103a: 0x1f3b, 0x103b: 0x1f40, + 0x103c: 0x206c, 0x103d: 0x2071, 0x103e: 0x2080, 0x103f: 0x2085, + // Block 0x41, offset 0x1040 + 0x1040: 0x208a, 0x1041: 0x209e, 0x1042: 0x20a3, 0x1043: 0x20a8, 0x1044: 0x20ad, 0x1045: 0x20c6, + 0x1046: 0x20d0, 0x1047: 0x20d5, 0x1048: 0x20da, 0x1049: 0x20ee, 0x104a: 0x210c, 0x104b: 0x2111, + 0x104c: 0x2116, 0x104d: 0x211b, 0x104e: 0x2125, 0x104f: 0x212a, 0x1050: 0x459d, 0x1051: 0x2157, + 0x1052: 0x215c, 0x1053: 0x2161, 0x1054: 0x2166, 0x1055: 0x2170, 0x1056: 0x2175, 0x1057: 0x26e1, + 0x1058: 0x26e8, 0x1059: 0x26ef, 0x105a: 0x2704, 0x105b: 0x2712, 0x105c: 0x1eb9, 0x105d: 0x1ebe, + 0x105e: 0x1ec3, 0x105f: 0x1ed2, 0x1060: 0x1edc, 0x1061: 0x1eeb, 0x1062: 0x1ef0, 0x1063: 0x1ef5, + 0x1064: 0x1f04, 0x1065: 0x1f0e, 0x1066: 0x1f2c, 0x1067: 0x1f45, 0x1068: 0x1f4a, 0x1069: 0x1f59, + 0x106a: 0x1f5e, 0x106b: 0x1f6d, 0x106c: 0x1f77, 0x106d: 0x1f86, 0x106e: 0x1f8b, 0x106f: 0x1f90, + 0x1070: 0x1f9a, 0x1071: 0x1fd6, 0x1072: 0x1fdb, 0x1073: 0x1fe5, 0x1074: 0x1ff4, 0x1075: 0x1ff9, + 0x1076: 0x1ffe, 0x1077: 0x2008, 0x1078: 0x2017, 0x1079: 0x202b, 0x107a: 0x2030, 0x107b: 0x2035, + 0x107c: 0x2044, 0x107d: 0x2049, 0x107e: 0x2058, 0x107f: 0x205d, + // Block 0x42, offset 0x1080 + 0x1080: 0x2062, 0x1081: 0x2067, 0x1082: 0x2076, 0x1083: 0x207b, 0x1084: 0x208f, 0x1085: 0x2094, + 0x1086: 0x2099, 0x1087: 0x209e, 0x1088: 0x20a3, 0x1089: 0x20b7, 0x108a: 0x20bc, 0x108b: 0x20c1, + 0x108c: 0x20c6, 0x108d: 0x20cb, 0x108e: 0x20df, 0x108f: 0x20e4, 0x1090: 0x20e9, 0x1091: 0x20ee, + 0x1092: 0x20fd, 0x1093: 0x2102, 0x1094: 0x2107, 0x1095: 0x2116, 0x1096: 0x2120, 0x1097: 0x212f, + 0x1098: 0x2134, 0x1099: 0x4591, 0x109a: 0x2148, 0x109b: 0x214d, 0x109c: 0x2152, 0x109d: 0x2161, + 0x109e: 0x216b, 0x109f: 0x2704, 0x10a0: 0x2712, 0x10a1: 0x1ed2, 0x10a2: 0x1edc, 0x10a3: 0x1f04, + 0x10a4: 0x1f0e, 0x10a5: 0x1f2c, 0x10a6: 0x1f36, 0x10a7: 0x1f9a, 0x10a8: 0x1f9f, 0x10a9: 0x1fc2, + 0x10aa: 0x1fc7, 0x10ab: 0x209e, 0x10ac: 0x20a3, 0x10ad: 0x20c6, 0x10ae: 0x2116, 0x10af: 0x2120, + 0x10b0: 0x2161, 0x10b1: 0x216b, 0x10b2: 0x4645, 0x10b3: 0x464d, 0x10b4: 0x4655, 0x10b5: 0x2021, + 0x10b6: 0x2026, 0x10b7: 0x203a, 0x10b8: 0x203f, 0x10b9: 0x204e, 0x10ba: 0x2053, 0x10bb: 0x1fa4, + 0x10bc: 0x1fa9, 0x10bd: 0x1fcc, 0x10be: 0x1fd1, 0x10bf: 0x1f63, + // Block 0x43, offset 0x10c0 + 0x10c0: 0x1f68, 0x10c1: 0x1f4f, 0x10c2: 0x1f54, 0x10c3: 0x1f7c, 0x10c4: 0x1f81, 0x10c5: 0x1fea, + 0x10c6: 0x1fef, 0x10c7: 0x200d, 0x10c8: 0x2012, 0x10c9: 0x1fae, 0x10ca: 0x1fb3, 0x10cb: 0x1fb8, + 0x10cc: 0x1fc2, 0x10cd: 0x1fbd, 0x10ce: 0x1f95, 0x10cf: 0x1fe0, 0x10d0: 0x2003, 0x10d1: 0x2021, + 0x10d2: 0x2026, 0x10d3: 0x203a, 0x10d4: 0x203f, 0x10d5: 0x204e, 0x10d6: 0x2053, 0x10d7: 0x1fa4, + 0x10d8: 0x1fa9, 0x10d9: 0x1fcc, 0x10da: 0x1fd1, 0x10db: 0x1f63, 0x10dc: 0x1f68, 0x10dd: 0x1f4f, + 0x10de: 0x1f54, 0x10df: 0x1f7c, 0x10e0: 0x1f81, 0x10e1: 0x1fea, 0x10e2: 0x1fef, 0x10e3: 0x200d, + 0x10e4: 0x2012, 0x10e5: 0x1fae, 0x10e6: 0x1fb3, 0x10e7: 0x1fb8, 0x10e8: 0x1fc2, 0x10e9: 0x1fbd, + 0x10ea: 0x1f95, 0x10eb: 0x1fe0, 0x10ec: 0x2003, 0x10ed: 0x1fae, 0x10ee: 0x1fb3, 0x10ef: 0x1fb8, + 0x10f0: 0x1fc2, 0x10f1: 0x1f9f, 0x10f2: 0x1fc7, 0x10f3: 0x201c, 0x10f4: 0x1f86, 0x10f5: 0x1f8b, + 0x10f6: 0x1f90, 0x10f7: 0x1fae, 0x10f8: 0x1fb3, 0x10f9: 0x1fb8, 0x10fa: 0x201c, 0x10fb: 0x202b, + 0x10fc: 0x4549, 0x10fd: 0x4549, + // Block 0x44, offset 0x1100 + 0x1110: 0x2441, 0x1111: 0x2456, + 0x1112: 0x2456, 0x1113: 0x245d, 0x1114: 0x2464, 0x1115: 0x2479, 0x1116: 0x2480, 0x1117: 0x2487, + 0x1118: 0x24aa, 0x1119: 0x24aa, 0x111a: 0x24cd, 0x111b: 0x24c6, 0x111c: 0x24e2, 0x111d: 0x24d4, + 0x111e: 0x24db, 0x111f: 0x24fe, 0x1120: 0x24fe, 0x1121: 0x24f7, 0x1122: 0x2505, 0x1123: 0x2505, + 0x1124: 0x252f, 0x1125: 0x252f, 0x1126: 0x254b, 0x1127: 0x2513, 0x1128: 0x2513, 0x1129: 0x250c, + 0x112a: 0x2521, 0x112b: 0x2521, 0x112c: 0x2528, 0x112d: 0x2528, 0x112e: 0x2552, 0x112f: 0x2560, + 0x1130: 0x2560, 0x1131: 0x2567, 0x1132: 0x2567, 0x1133: 0x256e, 0x1134: 0x2575, 0x1135: 0x257c, + 0x1136: 0x2583, 0x1137: 0x2583, 0x1138: 0x258a, 0x1139: 0x2598, 0x113a: 0x25a6, 0x113b: 0x259f, + 0x113c: 0x25ad, 0x113d: 0x25ad, 0x113e: 0x25c2, 0x113f: 0x25c9, + // Block 0x45, offset 0x1140 + 0x1140: 0x25fa, 0x1141: 0x2608, 0x1142: 0x2601, 0x1143: 0x25e5, 0x1144: 0x25e5, 0x1145: 0x260f, + 0x1146: 0x260f, 0x1147: 0x2616, 0x1148: 0x2616, 0x1149: 0x2640, 0x114a: 0x2647, 0x114b: 0x264e, + 0x114c: 0x2624, 0x114d: 0x2632, 0x114e: 0x2655, 0x114f: 0x265c, + 0x1152: 0x262b, 0x1153: 0x26b0, 0x1154: 0x26b7, 0x1155: 0x268d, 0x1156: 0x2694, 0x1157: 0x2678, + 0x1158: 0x2678, 0x1159: 0x267f, 0x115a: 0x26a9, 0x115b: 0x26a2, 0x115c: 0x26cc, 0x115d: 0x26cc, + 0x115e: 0x243a, 0x115f: 0x244f, 0x1160: 0x2448, 0x1161: 0x2472, 0x1162: 0x246b, 0x1163: 0x2495, + 0x1164: 0x248e, 0x1165: 0x24b8, 0x1166: 0x249c, 0x1167: 0x24b1, 0x1168: 0x24e9, 0x1169: 0x2536, + 0x116a: 0x251a, 0x116b: 0x2559, 0x116c: 0x25f3, 0x116d: 0x261d, 0x116e: 0x26c5, 0x116f: 0x26be, + 0x1170: 0x26d3, 0x1171: 0x266a, 0x1172: 0x25d0, 0x1173: 0x269b, 0x1174: 0x25c2, 0x1175: 0x25fa, + 0x1176: 0x2591, 0x1177: 0x25de, 0x1178: 0x2671, 0x1179: 0x2663, 0x117a: 0x25ec, 0x117b: 0x25d7, + 0x117c: 0x25ec, 0x117d: 0x2671, 0x117e: 0x24a3, 0x117f: 0x24bf, + // Block 0x46, offset 0x1180 + 0x1180: 0x2639, 0x1181: 0x25b4, 0x1182: 0x2433, 0x1183: 0x25d7, 0x1184: 0x257c, 0x1185: 0x254b, + 0x1186: 0x24f0, 0x1187: 0x2686, + 0x11b0: 0x2544, 0x11b1: 0x25bb, 0x11b2: 0x28f6, 0x11b3: 0x28ed, 0x11b4: 0x2923, 0x11b5: 0x2911, + 0x11b6: 0x28ff, 0x11b7: 0x291a, 0x11b8: 0x292c, 0x11b9: 0x253d, 0x11ba: 0x2db3, 0x11bb: 0x2c33, + 0x11bc: 0x2908, + // Block 0x47, offset 0x11c0 + 0x11d0: 0x0019, 0x11d1: 0x057e, + 0x11d2: 0x0582, 0x11d3: 0x0035, 0x11d4: 0x0037, 0x11d5: 0x0003, 0x11d6: 0x003f, 0x11d7: 0x05ba, + 0x11d8: 0x05be, 0x11d9: 0x1c8c, + 0x11e0: 0x8133, 0x11e1: 0x8133, 0x11e2: 0x8133, 0x11e3: 0x8133, + 0x11e4: 0x8133, 0x11e5: 0x8133, 0x11e6: 0x8133, 0x11e7: 0x812e, 0x11e8: 0x812e, 0x11e9: 0x812e, + 0x11ea: 0x812e, 0x11eb: 0x812e, 0x11ec: 0x812e, 0x11ed: 0x812e, 0x11ee: 0x8133, 0x11ef: 0x8133, + 0x11f0: 0x19a0, 0x11f1: 0x053a, 0x11f2: 0x0536, 0x11f3: 0x007f, 0x11f4: 0x007f, 0x11f5: 0x0011, + 0x11f6: 0x0013, 0x11f7: 0x00b7, 0x11f8: 0x00bb, 0x11f9: 0x05b2, 0x11fa: 0x05b6, 0x11fb: 0x05a6, + 0x11fc: 0x05aa, 0x11fd: 0x058e, 0x11fe: 0x0592, 0x11ff: 0x0586, + // Block 0x48, offset 0x1200 + 0x1200: 0x058a, 0x1201: 0x0596, 0x1202: 0x059a, 0x1203: 0x059e, 0x1204: 0x05a2, + 0x1207: 0x0077, 0x1208: 0x007b, 0x1209: 0x43aa, 0x120a: 0x43aa, 0x120b: 0x43aa, + 0x120c: 0x43aa, 0x120d: 0x007f, 0x120e: 0x007f, 0x120f: 0x007f, 0x1210: 0x0019, 0x1211: 0x057e, + 0x1212: 0x001d, 0x1214: 0x0037, 0x1215: 0x0035, 0x1216: 0x003f, 0x1217: 0x0003, + 0x1218: 0x053a, 0x1219: 0x0011, 0x121a: 0x0013, 0x121b: 0x00b7, 0x121c: 0x00bb, 0x121d: 0x05b2, + 0x121e: 0x05b6, 0x121f: 0x0007, 0x1220: 0x000d, 0x1221: 0x0015, 0x1222: 0x0017, 0x1223: 0x001b, + 0x1224: 0x0039, 0x1225: 0x003d, 0x1226: 0x003b, 0x1228: 0x0079, 0x1229: 0x0009, + 0x122a: 0x000b, 0x122b: 0x0041, + 0x1230: 0x43eb, 0x1231: 0x456d, 0x1232: 0x43f0, 0x1234: 0x43f5, + 0x1236: 0x43fa, 0x1237: 0x4573, 0x1238: 0x43ff, 0x1239: 0x4579, 0x123a: 0x4404, 0x123b: 0x457f, + 0x123c: 0x4409, 0x123d: 0x4585, 0x123e: 0x440e, 0x123f: 0x458b, + // Block 0x49, offset 0x1240 + 0x1240: 0x0329, 0x1241: 0x454f, 0x1242: 0x454f, 0x1243: 0x4555, 0x1244: 0x4555, 0x1245: 0x4597, + 0x1246: 0x4597, 0x1247: 0x455b, 0x1248: 0x455b, 0x1249: 0x45a3, 0x124a: 0x45a3, 0x124b: 0x45a3, + 0x124c: 0x45a3, 0x124d: 0x032c, 0x124e: 0x032c, 0x124f: 0x032f, 0x1250: 0x032f, 0x1251: 0x032f, + 0x1252: 0x032f, 0x1253: 0x0332, 0x1254: 0x0332, 0x1255: 0x0335, 0x1256: 0x0335, 0x1257: 0x0335, + 0x1258: 0x0335, 0x1259: 0x0338, 0x125a: 0x0338, 0x125b: 0x0338, 0x125c: 0x0338, 0x125d: 0x033b, + 0x125e: 0x033b, 0x125f: 0x033b, 0x1260: 0x033b, 0x1261: 0x033e, 0x1262: 0x033e, 0x1263: 0x033e, + 0x1264: 0x033e, 0x1265: 0x0341, 0x1266: 0x0341, 0x1267: 0x0341, 0x1268: 0x0341, 0x1269: 0x0344, + 0x126a: 0x0344, 0x126b: 0x0347, 0x126c: 0x0347, 0x126d: 0x034a, 0x126e: 0x034a, 0x126f: 0x034d, + 0x1270: 0x034d, 0x1271: 0x0350, 0x1272: 0x0350, 0x1273: 0x0350, 0x1274: 0x0350, 0x1275: 0x0353, + 0x1276: 0x0353, 0x1277: 0x0353, 0x1278: 0x0353, 0x1279: 0x0356, 0x127a: 0x0356, 0x127b: 0x0356, + 0x127c: 0x0356, 0x127d: 0x0359, 0x127e: 0x0359, 0x127f: 0x0359, + // Block 0x4a, offset 0x1280 + 0x1280: 0x0359, 0x1281: 0x035c, 0x1282: 0x035c, 0x1283: 0x035c, 0x1284: 0x035c, 0x1285: 0x035f, + 0x1286: 0x035f, 0x1287: 0x035f, 0x1288: 0x035f, 0x1289: 0x0362, 0x128a: 0x0362, 0x128b: 0x0362, + 0x128c: 0x0362, 0x128d: 0x0365, 0x128e: 0x0365, 0x128f: 0x0365, 0x1290: 0x0365, 0x1291: 0x0368, + 0x1292: 0x0368, 0x1293: 0x0368, 0x1294: 0x0368, 0x1295: 0x036b, 0x1296: 0x036b, 0x1297: 0x036b, + 0x1298: 0x036b, 0x1299: 0x036e, 0x129a: 0x036e, 0x129b: 0x036e, 0x129c: 0x036e, 0x129d: 0x0371, + 0x129e: 0x0371, 0x129f: 0x0371, 0x12a0: 0x0371, 0x12a1: 0x0374, 0x12a2: 0x0374, 0x12a3: 0x0374, + 0x12a4: 0x0374, 0x12a5: 0x0377, 0x12a6: 0x0377, 0x12a7: 0x0377, 0x12a8: 0x0377, 0x12a9: 0x037a, + 0x12aa: 0x037a, 0x12ab: 0x037a, 0x12ac: 0x037a, 0x12ad: 0x037d, 0x12ae: 0x037d, 0x12af: 0x0380, + 0x12b0: 0x0380, 0x12b1: 0x0383, 0x12b2: 0x0383, 0x12b3: 0x0383, 0x12b4: 0x0383, 0x12b5: 0x2f41, + 0x12b6: 0x2f41, 0x12b7: 0x2f49, 0x12b8: 0x2f49, 0x12b9: 0x2f51, 0x12ba: 0x2f51, 0x12bb: 0x20b2, + 0x12bc: 0x20b2, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x0081, 0x12c1: 0x0083, 0x12c2: 0x0085, 0x12c3: 0x0087, 0x12c4: 0x0089, 0x12c5: 0x008b, + 0x12c6: 0x008d, 0x12c7: 0x008f, 0x12c8: 0x0091, 0x12c9: 0x0093, 0x12ca: 0x0095, 0x12cb: 0x0097, + 0x12cc: 0x0099, 0x12cd: 0x009b, 0x12ce: 0x009d, 0x12cf: 0x009f, 0x12d0: 0x00a1, 0x12d1: 0x00a3, + 0x12d2: 0x00a5, 0x12d3: 0x00a7, 0x12d4: 0x00a9, 0x12d5: 0x00ab, 0x12d6: 0x00ad, 0x12d7: 0x00af, + 0x12d8: 0x00b1, 0x12d9: 0x00b3, 0x12da: 0x00b5, 0x12db: 0x00b7, 0x12dc: 0x00b9, 0x12dd: 0x00bb, + 0x12de: 0x00bd, 0x12df: 0x056e, 0x12e0: 0x0572, 0x12e1: 0x0582, 0x12e2: 0x0596, 0x12e3: 0x059a, + 0x12e4: 0x057e, 0x12e5: 0x06a6, 0x12e6: 0x069e, 0x12e7: 0x05c2, 0x12e8: 0x05ca, 0x12e9: 0x05d2, + 0x12ea: 0x05da, 0x12eb: 0x05e2, 0x12ec: 0x0666, 0x12ed: 0x066e, 0x12ee: 0x0676, 0x12ef: 0x061a, + 0x12f0: 0x06aa, 0x12f1: 0x05c6, 0x12f2: 0x05ce, 0x12f3: 0x05d6, 0x12f4: 0x05de, 0x12f5: 0x05e6, + 0x12f6: 0x05ea, 0x12f7: 0x05ee, 0x12f8: 0x05f2, 0x12f9: 0x05f6, 0x12fa: 0x05fa, 0x12fb: 0x05fe, + 0x12fc: 0x0602, 0x12fd: 0x0606, 0x12fe: 0x060a, 0x12ff: 0x060e, + // Block 0x4c, offset 0x1300 + 0x1300: 0x0612, 0x1301: 0x0616, 0x1302: 0x061e, 0x1303: 0x0622, 0x1304: 0x0626, 0x1305: 0x062a, + 0x1306: 0x062e, 0x1307: 0x0632, 0x1308: 0x0636, 0x1309: 0x063a, 0x130a: 0x063e, 0x130b: 0x0642, + 0x130c: 0x0646, 0x130d: 0x064a, 0x130e: 0x064e, 0x130f: 0x0652, 0x1310: 0x0656, 0x1311: 0x065a, + 0x1312: 0x065e, 0x1313: 0x0662, 0x1314: 0x066a, 0x1315: 0x0672, 0x1316: 0x067a, 0x1317: 0x067e, + 0x1318: 0x0682, 0x1319: 0x0686, 0x131a: 0x068a, 0x131b: 0x068e, 0x131c: 0x0692, 0x131d: 0x06a2, + 0x131e: 0x4bb9, 0x131f: 0x4bbf, 0x1320: 0x04b6, 0x1321: 0x0406, 0x1322: 0x040a, 0x1323: 0x4b7c, + 0x1324: 0x040e, 0x1325: 0x4b82, 0x1326: 0x4b88, 0x1327: 0x0412, 0x1328: 0x0416, 0x1329: 0x041a, + 0x132a: 0x4b8e, 0x132b: 0x4b94, 0x132c: 0x4b9a, 0x132d: 0x4ba0, 0x132e: 0x4ba6, 0x132f: 0x4bac, + 0x1330: 0x045a, 0x1331: 0x041e, 0x1332: 0x0422, 0x1333: 0x0426, 0x1334: 0x046e, 0x1335: 0x042a, + 0x1336: 0x042e, 0x1337: 0x0432, 0x1338: 0x0436, 0x1339: 0x043a, 0x133a: 0x043e, 0x133b: 0x0442, + 0x133c: 0x0446, 0x133d: 0x044a, 0x133e: 0x044e, + // Block 0x4d, offset 0x1340 + 0x1342: 0x4afe, 0x1343: 0x4b04, 0x1344: 0x4b0a, 0x1345: 0x4b10, + 0x1346: 0x4b16, 0x1347: 0x4b1c, 0x134a: 0x4b22, 0x134b: 0x4b28, + 0x134c: 0x4b2e, 0x134d: 0x4b34, 0x134e: 0x4b3a, 0x134f: 0x4b40, + 0x1352: 0x4b46, 0x1353: 0x4b4c, 0x1354: 0x4b52, 0x1355: 0x4b58, 0x1356: 0x4b5e, 0x1357: 0x4b64, + 0x135a: 0x4b6a, 0x135b: 0x4b70, 0x135c: 0x4b76, + 0x1360: 0x00bf, 0x1361: 0x00c2, 0x1362: 0x00cb, 0x1363: 0x43a5, + 0x1364: 0x00c8, 0x1365: 0x00c5, 0x1366: 0x053e, 0x1368: 0x0562, 0x1369: 0x0542, + 0x136a: 0x0546, 0x136b: 0x054a, 0x136c: 0x054e, 0x136d: 0x0566, 0x136e: 0x056a, + // Block 0x4e, offset 0x1380 + 0x1381: 0x01f1, 0x1382: 0x01f4, 0x1383: 0x00d4, 0x1384: 0x01be, 0x1385: 0x010d, + 0x1387: 0x01d3, 0x1388: 0x174e, 0x1389: 0x01d9, 0x138a: 0x01d6, 0x138b: 0x0116, + 0x138c: 0x0119, 0x138d: 0x0526, 0x138e: 0x011c, 0x138f: 0x0128, 0x1390: 0x01e5, 0x1391: 0x013a, + 0x1392: 0x0134, 0x1393: 0x012e, 0x1394: 0x01c1, 0x1395: 0x00e0, 0x1396: 0x01c4, 0x1397: 0x0143, + 0x1398: 0x0194, 0x1399: 0x01e8, 0x139a: 0x01eb, 0x139b: 0x0152, 0x139c: 0x1756, 0x139d: 0x1742, + 0x139e: 0x0158, 0x139f: 0x175b, 0x13a0: 0x01a9, 0x13a1: 0x1760, 0x13a2: 0x00da, 0x13a3: 0x0170, + 0x13a4: 0x0173, 0x13a5: 0x00a3, 0x13a6: 0x017c, 0x13a7: 0x1765, 0x13a8: 0x0182, 0x13a9: 0x0185, + 0x13aa: 0x0188, 0x13ab: 0x01e2, 0x13ac: 0x01dc, 0x13ad: 0x1752, 0x13ae: 0x01df, 0x13af: 0x0197, + 0x13b0: 0x0576, 0x13b2: 0x01ac, 0x13b3: 0x01cd, 0x13b4: 0x01d0, 0x13b5: 0x01bb, + 0x13b6: 0x00f5, 0x13b7: 0x00f8, 0x13b8: 0x00fb, 0x13b9: 0x176a, 0x13ba: 0x176f, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x0063, 0x13c1: 0x0065, 0x13c2: 0x0067, 0x13c3: 0x0069, 0x13c4: 0x006b, 0x13c5: 0x006d, + 0x13c6: 0x006f, 0x13c7: 0x0071, 0x13c8: 0x0073, 0x13c9: 0x0075, 0x13ca: 0x0083, 0x13cb: 0x0085, + 0x13cc: 0x0087, 0x13cd: 0x0089, 0x13ce: 0x008b, 0x13cf: 0x008d, 0x13d0: 0x008f, 0x13d1: 0x0091, + 0x13d2: 0x0093, 0x13d3: 0x0095, 0x13d4: 0x0097, 0x13d5: 0x0099, 0x13d6: 0x009b, 0x13d7: 0x009d, + 0x13d8: 0x009f, 0x13d9: 0x00a1, 0x13da: 0x00a3, 0x13db: 0x00a5, 0x13dc: 0x00a7, 0x13dd: 0x00a9, + 0x13de: 0x00ab, 0x13df: 0x00ad, 0x13e0: 0x00af, 0x13e1: 0x00b1, 0x13e2: 0x00b3, 0x13e3: 0x00b5, + 0x13e4: 0x00e3, 0x13e5: 0x0101, 0x13e8: 0x01f7, 0x13e9: 0x01fa, + 0x13ea: 0x01fd, 0x13eb: 0x0200, 0x13ec: 0x0203, 0x13ed: 0x0206, 0x13ee: 0x0209, 0x13ef: 0x020c, + 0x13f0: 0x020f, 0x13f1: 0x0212, 0x13f2: 0x0215, 0x13f3: 0x0218, 0x13f4: 0x021b, 0x13f5: 0x021e, + 0x13f6: 0x0221, 0x13f7: 0x0224, 0x13f8: 0x0227, 0x13f9: 0x020c, 0x13fa: 0x022a, 0x13fb: 0x022d, + 0x13fc: 0x0230, 0x13fd: 0x0233, 0x13fe: 0x0236, 0x13ff: 0x0239, + // Block 0x50, offset 0x1400 + 0x1400: 0x0281, 0x1401: 0x0284, 0x1402: 0x0287, 0x1403: 0x0552, 0x1404: 0x024b, 0x1405: 0x0254, + 0x1406: 0x025a, 0x1407: 0x027e, 0x1408: 0x026f, 0x1409: 0x026c, 0x140a: 0x028a, 0x140b: 0x028d, + 0x140e: 0x0021, 0x140f: 0x0023, 0x1410: 0x0025, 0x1411: 0x0027, + 0x1412: 0x0029, 0x1413: 0x002b, 0x1414: 0x002d, 0x1415: 0x002f, 0x1416: 0x0031, 0x1417: 0x0033, + 0x1418: 0x0021, 0x1419: 0x0023, 0x141a: 0x0025, 0x141b: 0x0027, 0x141c: 0x0029, 0x141d: 0x002b, + 0x141e: 0x002d, 0x141f: 0x002f, 0x1420: 0x0031, 0x1421: 0x0033, 0x1422: 0x0021, 0x1423: 0x0023, + 0x1424: 0x0025, 0x1425: 0x0027, 0x1426: 0x0029, 0x1427: 0x002b, 0x1428: 0x002d, 0x1429: 0x002f, + 0x142a: 0x0031, 0x142b: 0x0033, 0x142c: 0x0021, 0x142d: 0x0023, 0x142e: 0x0025, 0x142f: 0x0027, + 0x1430: 0x0029, 0x1431: 0x002b, 0x1432: 0x002d, 0x1433: 0x002f, 0x1434: 0x0031, 0x1435: 0x0033, + 0x1436: 0x0021, 0x1437: 0x0023, 0x1438: 0x0025, 0x1439: 0x0027, 0x143a: 0x0029, 0x143b: 0x002b, + 0x143c: 0x002d, 0x143d: 0x002f, 0x143e: 0x0031, 0x143f: 0x0033, + // Block 0x51, offset 0x1440 + 0x1440: 0x8133, 0x1441: 0x8133, 0x1442: 0x8133, 0x1443: 0x8133, 0x1444: 0x8133, 0x1445: 0x8133, + 0x1446: 0x8133, 0x1448: 0x8133, 0x1449: 0x8133, 0x144a: 0x8133, 0x144b: 0x8133, + 0x144c: 0x8133, 0x144d: 0x8133, 0x144e: 0x8133, 0x144f: 0x8133, 0x1450: 0x8133, 0x1451: 0x8133, + 0x1452: 0x8133, 0x1453: 0x8133, 0x1454: 0x8133, 0x1455: 0x8133, 0x1456: 0x8133, 0x1457: 0x8133, + 0x1458: 0x8133, 0x145b: 0x8133, 0x145c: 0x8133, 0x145d: 0x8133, + 0x145e: 0x8133, 0x145f: 0x8133, 0x1460: 0x8133, 0x1461: 0x8133, 0x1463: 0x8133, + 0x1464: 0x8133, 0x1466: 0x8133, 0x1467: 0x8133, 0x1468: 0x8133, 0x1469: 0x8133, + 0x146a: 0x8133, + 0x1470: 0x0290, 0x1471: 0x0293, 0x1472: 0x0296, 0x1473: 0x0299, 0x1474: 0x029c, 0x1475: 0x029f, + 0x1476: 0x02a2, 0x1477: 0x02a5, 0x1478: 0x02a8, 0x1479: 0x02ab, 0x147a: 0x02ae, 0x147b: 0x02b1, + 0x147c: 0x02b7, 0x147d: 0x02ba, 0x147e: 0x02bd, 0x147f: 0x02c0, + // Block 0x52, offset 0x1480 + 0x1480: 0x02c3, 0x1481: 0x02c6, 0x1482: 0x02c9, 0x1483: 0x02cc, 0x1484: 0x02cf, 0x1485: 0x02d2, + 0x1486: 0x02d5, 0x1487: 0x02db, 0x1488: 0x02e1, 0x1489: 0x02e4, 0x148a: 0x1736, 0x148b: 0x0302, + 0x148c: 0x02ea, 0x148d: 0x02ed, 0x148e: 0x0305, 0x148f: 0x02f9, 0x1490: 0x02ff, 0x1491: 0x0290, + 0x1492: 0x0293, 0x1493: 0x0296, 0x1494: 0x0299, 0x1495: 0x029c, 0x1496: 0x029f, 0x1497: 0x02a2, + 0x1498: 0x02a5, 0x1499: 0x02a8, 0x149a: 0x02ab, 0x149b: 0x02ae, 0x149c: 0x02b7, 0x149d: 0x02ba, + 0x149e: 0x02c0, 0x149f: 0x02c6, 0x14a0: 0x02c9, 0x14a1: 0x02cc, 0x14a2: 0x02cf, 0x14a3: 0x02d2, + 0x14a4: 0x02d5, 0x14a5: 0x02d8, 0x14a6: 0x02db, 0x14a7: 0x02f3, 0x14a8: 0x02ea, 0x14a9: 0x02e7, + 0x14aa: 0x02f0, 0x14ab: 0x02f6, 0x14ac: 0x1732, 0x14ad: 0x02fc, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x032c, 0x14c1: 0x032f, 0x14c2: 0x033b, 0x14c3: 0x0344, 0x14c5: 0x037d, + 0x14c6: 0x034d, 0x14c7: 0x033e, 0x14c8: 0x035c, 0x14c9: 0x0383, 0x14ca: 0x036e, 0x14cb: 0x0371, + 0x14cc: 0x0374, 0x14cd: 0x0377, 0x14ce: 0x0350, 0x14cf: 0x0362, 0x14d0: 0x0368, 0x14d1: 0x0356, + 0x14d2: 0x036b, 0x14d3: 0x034a, 0x14d4: 0x0353, 0x14d5: 0x0335, 0x14d6: 0x0338, 0x14d7: 0x0341, + 0x14d8: 0x0347, 0x14d9: 0x0359, 0x14da: 0x035f, 0x14db: 0x0365, 0x14dc: 0x0386, 0x14dd: 0x03d7, + 0x14de: 0x03bf, 0x14df: 0x0389, 0x14e1: 0x032f, 0x14e2: 0x033b, + 0x14e4: 0x037a, 0x14e7: 0x033e, 0x14e9: 0x0383, + 0x14ea: 0x036e, 0x14eb: 0x0371, 0x14ec: 0x0374, 0x14ed: 0x0377, 0x14ee: 0x0350, 0x14ef: 0x0362, + 0x14f0: 0x0368, 0x14f1: 0x0356, 0x14f2: 0x036b, 0x14f4: 0x0353, 0x14f5: 0x0335, + 0x14f6: 0x0338, 0x14f7: 0x0341, 0x14f9: 0x0359, 0x14fb: 0x0365, + // Block 0x54, offset 0x1500 + 0x1502: 0x033b, + 0x1507: 0x033e, 0x1509: 0x0383, 0x150b: 0x0371, + 0x150d: 0x0377, 0x150e: 0x0350, 0x150f: 0x0362, 0x1511: 0x0356, + 0x1512: 0x036b, 0x1514: 0x0353, 0x1517: 0x0341, + 0x1519: 0x0359, 0x151b: 0x0365, 0x151d: 0x03d7, + 0x151f: 0x0389, 0x1521: 0x032f, 0x1522: 0x033b, + 0x1524: 0x037a, 0x1527: 0x033e, 0x1528: 0x035c, 0x1529: 0x0383, + 0x152a: 0x036e, 0x152c: 0x0374, 0x152d: 0x0377, 0x152e: 0x0350, 0x152f: 0x0362, + 0x1530: 0x0368, 0x1531: 0x0356, 0x1532: 0x036b, 0x1534: 0x0353, 0x1535: 0x0335, + 0x1536: 0x0338, 0x1537: 0x0341, 0x1539: 0x0359, 0x153a: 0x035f, 0x153b: 0x0365, + 0x153c: 0x0386, 0x153e: 0x03bf, + // Block 0x55, offset 0x1540 + 0x1540: 0x032c, 0x1541: 0x032f, 0x1542: 0x033b, 0x1543: 0x0344, 0x1544: 0x037a, 0x1545: 0x037d, + 0x1546: 0x034d, 0x1547: 0x033e, 0x1548: 0x035c, 0x1549: 0x0383, 0x154b: 0x0371, + 0x154c: 0x0374, 0x154d: 0x0377, 0x154e: 0x0350, 0x154f: 0x0362, 0x1550: 0x0368, 0x1551: 0x0356, + 0x1552: 0x036b, 0x1553: 0x034a, 0x1554: 0x0353, 0x1555: 0x0335, 0x1556: 0x0338, 0x1557: 0x0341, + 0x1558: 0x0347, 0x1559: 0x0359, 0x155a: 0x035f, 0x155b: 0x0365, + 0x1561: 0x032f, 0x1562: 0x033b, 0x1563: 0x0344, + 0x1565: 0x037d, 0x1566: 0x034d, 0x1567: 0x033e, 0x1568: 0x035c, 0x1569: 0x0383, + 0x156b: 0x0371, 0x156c: 0x0374, 0x156d: 0x0377, 0x156e: 0x0350, 0x156f: 0x0362, + 0x1570: 0x0368, 0x1571: 0x0356, 0x1572: 0x036b, 0x1573: 0x034a, 0x1574: 0x0353, 0x1575: 0x0335, + 0x1576: 0x0338, 0x1577: 0x0341, 0x1578: 0x0347, 0x1579: 0x0359, 0x157a: 0x035f, 0x157b: 0x0365, + // Block 0x56, offset 0x1580 + 0x1580: 0x19a6, 0x1581: 0x19a3, 0x1582: 0x19a9, 0x1583: 0x19cd, 0x1584: 0x19f1, 0x1585: 0x1a15, + 0x1586: 0x1a39, 0x1587: 0x1a42, 0x1588: 0x1a48, 0x1589: 0x1a4e, 0x158a: 0x1a54, + 0x1590: 0x1bbc, 0x1591: 0x1bc0, + 0x1592: 0x1bc4, 0x1593: 0x1bc8, 0x1594: 0x1bcc, 0x1595: 0x1bd0, 0x1596: 0x1bd4, 0x1597: 0x1bd8, + 0x1598: 0x1bdc, 0x1599: 0x1be0, 0x159a: 0x1be4, 0x159b: 0x1be8, 0x159c: 0x1bec, 0x159d: 0x1bf0, + 0x159e: 0x1bf4, 0x159f: 0x1bf8, 0x15a0: 0x1bfc, 0x15a1: 0x1c00, 0x15a2: 0x1c04, 0x15a3: 0x1c08, + 0x15a4: 0x1c0c, 0x15a5: 0x1c10, 0x15a6: 0x1c14, 0x15a7: 0x1c18, 0x15a8: 0x1c1c, 0x15a9: 0x1c20, + 0x15aa: 0x2855, 0x15ab: 0x0047, 0x15ac: 0x0065, 0x15ad: 0x1a69, 0x15ae: 0x1ae1, + 0x15b0: 0x0043, 0x15b1: 0x0045, 0x15b2: 0x0047, 0x15b3: 0x0049, 0x15b4: 0x004b, 0x15b5: 0x004d, + 0x15b6: 0x004f, 0x15b7: 0x0051, 0x15b8: 0x0053, 0x15b9: 0x0055, 0x15ba: 0x0057, 0x15bb: 0x0059, + 0x15bc: 0x005b, 0x15bd: 0x005d, 0x15be: 0x005f, 0x15bf: 0x0061, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x27dd, 0x15c1: 0x27f2, 0x15c2: 0x05fe, + 0x15d0: 0x0d0a, 0x15d1: 0x0b42, + 0x15d2: 0x09ce, 0x15d3: 0x4705, 0x15d4: 0x0816, 0x15d5: 0x0aea, 0x15d6: 0x142a, 0x15d7: 0x0afa, + 0x15d8: 0x0822, 0x15d9: 0x0dd2, 0x15da: 0x0faa, 0x15db: 0x0daa, 0x15dc: 0x0922, 0x15dd: 0x0c66, + 0x15de: 0x08ba, 0x15df: 0x0db2, 0x15e0: 0x090e, 0x15e1: 0x1212, 0x15e2: 0x107e, 0x15e3: 0x1486, + 0x15e4: 0x0ace, 0x15e5: 0x0a06, 0x15e6: 0x0f5e, 0x15e7: 0x0d16, 0x15e8: 0x0d42, 0x15e9: 0x07ba, + 0x15ea: 0x07c6, 0x15eb: 0x1506, 0x15ec: 0x0bd6, 0x15ed: 0x07e2, 0x15ee: 0x09ea, 0x15ef: 0x0d36, + 0x15f0: 0x14ae, 0x15f1: 0x0d0e, 0x15f2: 0x116a, 0x15f3: 0x11a6, 0x15f4: 0x09f2, 0x15f5: 0x0f3e, + 0x15f6: 0x0e06, 0x15f7: 0x0e02, 0x15f8: 0x1092, 0x15f9: 0x0926, 0x15fa: 0x0a52, 0x15fb: 0x153e, + // Block 0x58, offset 0x1600 + 0x1600: 0x07f6, 0x1601: 0x07ee, 0x1602: 0x07fe, 0x1603: 0x1774, 0x1604: 0x0842, 0x1605: 0x0852, + 0x1606: 0x0856, 0x1607: 0x085e, 0x1608: 0x0866, 0x1609: 0x086a, 0x160a: 0x0876, 0x160b: 0x086e, + 0x160c: 0x06ae, 0x160d: 0x1788, 0x160e: 0x088a, 0x160f: 0x088e, 0x1610: 0x0892, 0x1611: 0x08ae, + 0x1612: 0x1779, 0x1613: 0x06b2, 0x1614: 0x089a, 0x1615: 0x08ba, 0x1616: 0x1783, 0x1617: 0x08ca, + 0x1618: 0x08d2, 0x1619: 0x0832, 0x161a: 0x08da, 0x161b: 0x08de, 0x161c: 0x195e, 0x161d: 0x08fa, + 0x161e: 0x0902, 0x161f: 0x06ba, 0x1620: 0x091a, 0x1621: 0x091e, 0x1622: 0x0926, 0x1623: 0x092a, + 0x1624: 0x06be, 0x1625: 0x0942, 0x1626: 0x0946, 0x1627: 0x0952, 0x1628: 0x095e, 0x1629: 0x0962, + 0x162a: 0x0966, 0x162b: 0x096e, 0x162c: 0x098e, 0x162d: 0x0992, 0x162e: 0x099a, 0x162f: 0x09aa, + 0x1630: 0x09b2, 0x1631: 0x09b6, 0x1632: 0x09b6, 0x1633: 0x09b6, 0x1634: 0x1797, 0x1635: 0x0f8e, + 0x1636: 0x09ca, 0x1637: 0x09d2, 0x1638: 0x179c, 0x1639: 0x09de, 0x163a: 0x09e6, 0x163b: 0x09ee, + 0x163c: 0x0a16, 0x163d: 0x0a02, 0x163e: 0x0a0e, 0x163f: 0x0a12, + // Block 0x59, offset 0x1640 + 0x1640: 0x0a1a, 0x1641: 0x0a22, 0x1642: 0x0a26, 0x1643: 0x0a2e, 0x1644: 0x0a36, 0x1645: 0x0a3a, + 0x1646: 0x0a3a, 0x1647: 0x0a42, 0x1648: 0x0a4a, 0x1649: 0x0a4e, 0x164a: 0x0a5a, 0x164b: 0x0a7e, + 0x164c: 0x0a62, 0x164d: 0x0a82, 0x164e: 0x0a66, 0x164f: 0x0a6e, 0x1650: 0x0906, 0x1651: 0x0aca, + 0x1652: 0x0a92, 0x1653: 0x0a96, 0x1654: 0x0a9a, 0x1655: 0x0a8e, 0x1656: 0x0aa2, 0x1657: 0x0a9e, + 0x1658: 0x0ab6, 0x1659: 0x17a1, 0x165a: 0x0ad2, 0x165b: 0x0ad6, 0x165c: 0x0ade, 0x165d: 0x0aea, + 0x165e: 0x0af2, 0x165f: 0x0b0e, 0x1660: 0x17a6, 0x1661: 0x17ab, 0x1662: 0x0b1a, 0x1663: 0x0b1e, + 0x1664: 0x0b22, 0x1665: 0x0b16, 0x1666: 0x0b2a, 0x1667: 0x06c2, 0x1668: 0x06c6, 0x1669: 0x0b32, + 0x166a: 0x0b3a, 0x166b: 0x0b3a, 0x166c: 0x17b0, 0x166d: 0x0b56, 0x166e: 0x0b5a, 0x166f: 0x0b5e, + 0x1670: 0x0b66, 0x1671: 0x17b5, 0x1672: 0x0b6e, 0x1673: 0x0b72, 0x1674: 0x0c4a, 0x1675: 0x0b7a, + 0x1676: 0x06ca, 0x1677: 0x0b86, 0x1678: 0x0b96, 0x1679: 0x0ba2, 0x167a: 0x0b9e, 0x167b: 0x17bf, + 0x167c: 0x0baa, 0x167d: 0x17c4, 0x167e: 0x0bb6, 0x167f: 0x0bb2, + // Block 0x5a, offset 0x1680 + 0x1680: 0x0bba, 0x1681: 0x0bca, 0x1682: 0x0bce, 0x1683: 0x06ce, 0x1684: 0x0bde, 0x1685: 0x0be6, + 0x1686: 0x0bea, 0x1687: 0x0bee, 0x1688: 0x06d2, 0x1689: 0x17c9, 0x168a: 0x06d6, 0x168b: 0x0c0a, + 0x168c: 0x0c0e, 0x168d: 0x0c12, 0x168e: 0x0c1a, 0x168f: 0x1990, 0x1690: 0x0c32, 0x1691: 0x17d3, + 0x1692: 0x17d3, 0x1693: 0x12d2, 0x1694: 0x0c42, 0x1695: 0x0c42, 0x1696: 0x06da, 0x1697: 0x17f6, + 0x1698: 0x18c8, 0x1699: 0x0c52, 0x169a: 0x0c5a, 0x169b: 0x06de, 0x169c: 0x0c6e, 0x169d: 0x0c7e, + 0x169e: 0x0c82, 0x169f: 0x0c8a, 0x16a0: 0x0c9a, 0x16a1: 0x06e6, 0x16a2: 0x06e2, 0x16a3: 0x0c9e, + 0x16a4: 0x17d8, 0x16a5: 0x0ca2, 0x16a6: 0x0cb6, 0x16a7: 0x0cba, 0x16a8: 0x0cbe, 0x16a9: 0x0cba, + 0x16aa: 0x0cca, 0x16ab: 0x0cce, 0x16ac: 0x0cde, 0x16ad: 0x0cd6, 0x16ae: 0x0cda, 0x16af: 0x0ce2, + 0x16b0: 0x0ce6, 0x16b1: 0x0cea, 0x16b2: 0x0cf6, 0x16b3: 0x0cfa, 0x16b4: 0x0d12, 0x16b5: 0x0d1a, + 0x16b6: 0x0d2a, 0x16b7: 0x0d3e, 0x16b8: 0x17e7, 0x16b9: 0x0d3a, 0x16ba: 0x0d2e, 0x16bb: 0x0d46, + 0x16bc: 0x0d4e, 0x16bd: 0x0d62, 0x16be: 0x17ec, 0x16bf: 0x0d6a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x0d5e, 0x16c1: 0x0d56, 0x16c2: 0x06ea, 0x16c3: 0x0d72, 0x16c4: 0x0d7a, 0x16c5: 0x0d82, + 0x16c6: 0x0d76, 0x16c7: 0x06ee, 0x16c8: 0x0d92, 0x16c9: 0x0d9a, 0x16ca: 0x17f1, 0x16cb: 0x0dc6, + 0x16cc: 0x0dfa, 0x16cd: 0x0dd6, 0x16ce: 0x06fa, 0x16cf: 0x0de2, 0x16d0: 0x06f6, 0x16d1: 0x06f2, + 0x16d2: 0x08be, 0x16d3: 0x08c2, 0x16d4: 0x0dfe, 0x16d5: 0x0de6, 0x16d6: 0x12a6, 0x16d7: 0x075e, + 0x16d8: 0x0e0a, 0x16d9: 0x0e0e, 0x16da: 0x0e12, 0x16db: 0x0e26, 0x16dc: 0x0e1e, 0x16dd: 0x180a, + 0x16de: 0x06fe, 0x16df: 0x0e3a, 0x16e0: 0x0e2e, 0x16e1: 0x0e4a, 0x16e2: 0x0e52, 0x16e3: 0x1814, + 0x16e4: 0x0e56, 0x16e5: 0x0e42, 0x16e6: 0x0e5e, 0x16e7: 0x0702, 0x16e8: 0x0e62, 0x16e9: 0x0e66, + 0x16ea: 0x0e6a, 0x16eb: 0x0e76, 0x16ec: 0x1819, 0x16ed: 0x0e7e, 0x16ee: 0x0706, 0x16ef: 0x0e8a, + 0x16f0: 0x181e, 0x16f1: 0x0e8e, 0x16f2: 0x070a, 0x16f3: 0x0e9a, 0x16f4: 0x0ea6, 0x16f5: 0x0eb2, + 0x16f6: 0x0eb6, 0x16f7: 0x1823, 0x16f8: 0x17ba, 0x16f9: 0x1828, 0x16fa: 0x0ed6, 0x16fb: 0x182d, + 0x16fc: 0x0ee2, 0x16fd: 0x0eea, 0x16fe: 0x0eda, 0x16ff: 0x0ef6, + // Block 0x5c, offset 0x1700 + 0x1700: 0x0f06, 0x1701: 0x0f16, 0x1702: 0x0f0a, 0x1703: 0x0f0e, 0x1704: 0x0f1a, 0x1705: 0x0f1e, + 0x1706: 0x1832, 0x1707: 0x0f02, 0x1708: 0x0f36, 0x1709: 0x0f3a, 0x170a: 0x070e, 0x170b: 0x0f4e, + 0x170c: 0x0f4a, 0x170d: 0x1837, 0x170e: 0x0f2e, 0x170f: 0x0f6a, 0x1710: 0x183c, 0x1711: 0x1841, + 0x1712: 0x0f6e, 0x1713: 0x0f82, 0x1714: 0x0f7e, 0x1715: 0x0f7a, 0x1716: 0x0712, 0x1717: 0x0f86, + 0x1718: 0x0f96, 0x1719: 0x0f92, 0x171a: 0x0f9e, 0x171b: 0x177e, 0x171c: 0x0fae, 0x171d: 0x1846, + 0x171e: 0x0fba, 0x171f: 0x1850, 0x1720: 0x0fce, 0x1721: 0x0fda, 0x1722: 0x0fee, 0x1723: 0x1855, + 0x1724: 0x1002, 0x1725: 0x1006, 0x1726: 0x185a, 0x1727: 0x185f, 0x1728: 0x1022, 0x1729: 0x1032, + 0x172a: 0x0716, 0x172b: 0x1036, 0x172c: 0x071a, 0x172d: 0x071a, 0x172e: 0x104e, 0x172f: 0x1052, + 0x1730: 0x105a, 0x1731: 0x105e, 0x1732: 0x106a, 0x1733: 0x071e, 0x1734: 0x1082, 0x1735: 0x1864, + 0x1736: 0x109e, 0x1737: 0x1869, 0x1738: 0x10aa, 0x1739: 0x17ce, 0x173a: 0x10ba, 0x173b: 0x186e, + 0x173c: 0x1873, 0x173d: 0x1878, 0x173e: 0x0722, 0x173f: 0x0726, + // Block 0x5d, offset 0x1740 + 0x1740: 0x10f2, 0x1741: 0x1882, 0x1742: 0x187d, 0x1743: 0x1887, 0x1744: 0x188c, 0x1745: 0x10fa, + 0x1746: 0x10fe, 0x1747: 0x10fe, 0x1748: 0x1106, 0x1749: 0x072e, 0x174a: 0x110a, 0x174b: 0x0732, + 0x174c: 0x0736, 0x174d: 0x1896, 0x174e: 0x111e, 0x174f: 0x1126, 0x1750: 0x1132, 0x1751: 0x073a, + 0x1752: 0x189b, 0x1753: 0x1156, 0x1754: 0x18a0, 0x1755: 0x18a5, 0x1756: 0x1176, 0x1757: 0x118e, + 0x1758: 0x073e, 0x1759: 0x1196, 0x175a: 0x119a, 0x175b: 0x119e, 0x175c: 0x18aa, 0x175d: 0x18af, + 0x175e: 0x18af, 0x175f: 0x11b6, 0x1760: 0x0742, 0x1761: 0x18b4, 0x1762: 0x11ca, 0x1763: 0x11ce, + 0x1764: 0x0746, 0x1765: 0x18b9, 0x1766: 0x11ea, 0x1767: 0x074a, 0x1768: 0x11fa, 0x1769: 0x11f2, + 0x176a: 0x1202, 0x176b: 0x18c3, 0x176c: 0x121a, 0x176d: 0x074e, 0x176e: 0x1226, 0x176f: 0x122e, + 0x1770: 0x123e, 0x1771: 0x0752, 0x1772: 0x18cd, 0x1773: 0x18d2, 0x1774: 0x0756, 0x1775: 0x18d7, + 0x1776: 0x1256, 0x1777: 0x18dc, 0x1778: 0x1262, 0x1779: 0x126e, 0x177a: 0x1276, 0x177b: 0x18e1, + 0x177c: 0x18e6, 0x177d: 0x128a, 0x177e: 0x18eb, 0x177f: 0x1292, + // Block 0x5e, offset 0x1780 + 0x1780: 0x17fb, 0x1781: 0x075a, 0x1782: 0x12aa, 0x1783: 0x12ae, 0x1784: 0x0762, 0x1785: 0x12b2, + 0x1786: 0x0b2e, 0x1787: 0x18f0, 0x1788: 0x18f5, 0x1789: 0x1800, 0x178a: 0x1805, 0x178b: 0x12d2, + 0x178c: 0x12d6, 0x178d: 0x14ee, 0x178e: 0x0766, 0x178f: 0x1302, 0x1790: 0x12fe, 0x1791: 0x1306, + 0x1792: 0x093a, 0x1793: 0x130a, 0x1794: 0x130e, 0x1795: 0x1312, 0x1796: 0x131a, 0x1797: 0x18fa, + 0x1798: 0x1316, 0x1799: 0x131e, 0x179a: 0x1332, 0x179b: 0x1336, 0x179c: 0x1322, 0x179d: 0x133a, + 0x179e: 0x134e, 0x179f: 0x1362, 0x17a0: 0x132e, 0x17a1: 0x1342, 0x17a2: 0x1346, 0x17a3: 0x134a, + 0x17a4: 0x18ff, 0x17a5: 0x1909, 0x17a6: 0x1904, 0x17a7: 0x076a, 0x17a8: 0x136a, 0x17a9: 0x136e, + 0x17aa: 0x1376, 0x17ab: 0x191d, 0x17ac: 0x137a, 0x17ad: 0x190e, 0x17ae: 0x076e, 0x17af: 0x0772, + 0x17b0: 0x1913, 0x17b1: 0x1918, 0x17b2: 0x0776, 0x17b3: 0x139a, 0x17b4: 0x139e, 0x17b5: 0x13a2, + 0x17b6: 0x13a6, 0x17b7: 0x13b2, 0x17b8: 0x13ae, 0x17b9: 0x13ba, 0x17ba: 0x13b6, 0x17bb: 0x13c6, + 0x17bc: 0x13be, 0x17bd: 0x13c2, 0x17be: 0x13ca, 0x17bf: 0x077a, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x13d2, 0x17c1: 0x13d6, 0x17c2: 0x077e, 0x17c3: 0x13e6, 0x17c4: 0x13ea, 0x17c5: 0x1922, + 0x17c6: 0x13f6, 0x17c7: 0x13fa, 0x17c8: 0x0782, 0x17c9: 0x1406, 0x17ca: 0x06b6, 0x17cb: 0x1927, + 0x17cc: 0x192c, 0x17cd: 0x0786, 0x17ce: 0x078a, 0x17cf: 0x1432, 0x17d0: 0x144a, 0x17d1: 0x1466, + 0x17d2: 0x1476, 0x17d3: 0x1931, 0x17d4: 0x148a, 0x17d5: 0x148e, 0x17d6: 0x14a6, 0x17d7: 0x14b2, + 0x17d8: 0x193b, 0x17d9: 0x178d, 0x17da: 0x14be, 0x17db: 0x14ba, 0x17dc: 0x14c6, 0x17dd: 0x1792, + 0x17de: 0x14d2, 0x17df: 0x14de, 0x17e0: 0x1940, 0x17e1: 0x1945, 0x17e2: 0x151e, 0x17e3: 0x152a, + 0x17e4: 0x1532, 0x17e5: 0x194a, 0x17e6: 0x1536, 0x17e7: 0x1562, 0x17e8: 0x156e, 0x17e9: 0x1572, + 0x17ea: 0x156a, 0x17eb: 0x157e, 0x17ec: 0x1582, 0x17ed: 0x194f, 0x17ee: 0x158e, 0x17ef: 0x078e, + 0x17f0: 0x1596, 0x17f1: 0x1954, 0x17f2: 0x0792, 0x17f3: 0x15ce, 0x17f4: 0x0bbe, 0x17f5: 0x15e6, + 0x17f6: 0x1959, 0x17f7: 0x1963, 0x17f8: 0x0796, 0x17f9: 0x079a, 0x17fa: 0x160e, 0x17fb: 0x1968, + 0x17fc: 0x079e, 0x17fd: 0x196d, 0x17fe: 0x1626, 0x17ff: 0x1626, + // Block 0x60, offset 0x1800 + 0x1800: 0x162e, 0x1801: 0x1972, 0x1802: 0x1646, 0x1803: 0x07a2, 0x1804: 0x1656, 0x1805: 0x1662, + 0x1806: 0x166a, 0x1807: 0x1672, 0x1808: 0x07a6, 0x1809: 0x1977, 0x180a: 0x1686, 0x180b: 0x16a2, + 0x180c: 0x16ae, 0x180d: 0x07aa, 0x180e: 0x07ae, 0x180f: 0x16b2, 0x1810: 0x197c, 0x1811: 0x07b2, + 0x1812: 0x1981, 0x1813: 0x1986, 0x1814: 0x198b, 0x1815: 0x16d6, 0x1816: 0x07b6, 0x1817: 0x16ea, + 0x1818: 0x16f2, 0x1819: 0x16f6, 0x181a: 0x16fe, 0x181b: 0x1706, 0x181c: 0x170e, 0x181d: 0x1995, +} + +// nfkcIndex: 22 blocks, 1408 entries, 2816 bytes +// Block 0 is the zero block. +var nfkcIndex = [1408]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x5f, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x60, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x61, 0xcb: 0x62, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x09, + 0xd0: 0x0a, 0xd1: 0x63, 0xd2: 0x64, 0xd3: 0x0b, 0xd6: 0x0c, 0xd7: 0x65, + 0xd8: 0x66, 0xd9: 0x0d, 0xdb: 0x67, 0xdc: 0x68, 0xdd: 0x69, 0xdf: 0x6a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x6b, 0x121: 0x6c, 0x122: 0x6d, 0x123: 0x0e, 0x124: 0x6e, 0x125: 0x6f, 0x126: 0x70, 0x127: 0x71, + 0x128: 0x72, 0x129: 0x73, 0x12a: 0x74, 0x12b: 0x75, 0x12c: 0x70, 0x12d: 0x76, 0x12e: 0x77, 0x12f: 0x78, + 0x130: 0x74, 0x131: 0x79, 0x132: 0x7a, 0x133: 0x7b, 0x134: 0x7c, 0x135: 0x7d, 0x137: 0x7e, + 0x138: 0x7f, 0x139: 0x80, 0x13a: 0x81, 0x13b: 0x82, 0x13c: 0x83, 0x13d: 0x84, 0x13e: 0x85, 0x13f: 0x86, + // Block 0x5, offset 0x140 + 0x140: 0x87, 0x142: 0x88, 0x143: 0x89, 0x144: 0x8a, 0x145: 0x8b, 0x146: 0x8c, 0x147: 0x8d, + 0x14d: 0x8e, + 0x15c: 0x8f, 0x15f: 0x90, + 0x162: 0x91, 0x164: 0x92, + 0x168: 0x93, 0x169: 0x94, 0x16a: 0x95, 0x16b: 0x96, 0x16c: 0x0f, 0x16d: 0x97, 0x16e: 0x98, 0x16f: 0x99, + 0x170: 0x9a, 0x173: 0x9b, 0x174: 0x9c, 0x175: 0x10, 0x176: 0x11, 0x177: 0x12, + 0x178: 0x13, 0x179: 0x14, 0x17a: 0x15, 0x17b: 0x16, 0x17c: 0x17, 0x17d: 0x18, 0x17e: 0x19, 0x17f: 0x1a, + // Block 0x6, offset 0x180 + 0x180: 0x9d, 0x181: 0x9e, 0x182: 0x9f, 0x183: 0xa0, 0x184: 0x1b, 0x185: 0x1c, 0x186: 0xa1, 0x187: 0xa2, + 0x188: 0xa3, 0x189: 0x1d, 0x18a: 0x1e, 0x18b: 0xa4, 0x18c: 0xa5, + 0x191: 0x1f, 0x192: 0x20, 0x193: 0xa6, + 0x1a8: 0xa7, 0x1a9: 0xa8, 0x1ab: 0xa9, + 0x1b1: 0xaa, 0x1b3: 0xab, 0x1b5: 0xac, 0x1b7: 0xad, + 0x1ba: 0xae, 0x1bb: 0xaf, 0x1bc: 0x21, 0x1bd: 0x22, 0x1be: 0x23, 0x1bf: 0xb0, + // Block 0x7, offset 0x1c0 + 0x1c0: 0xb1, 0x1c1: 0x24, 0x1c2: 0x25, 0x1c3: 0x26, 0x1c4: 0xb2, 0x1c5: 0x27, 0x1c6: 0x28, + 0x1c8: 0x29, 0x1c9: 0x2a, 0x1ca: 0x2b, 0x1cb: 0x2c, 0x1cc: 0x2d, 0x1cd: 0x2e, 0x1ce: 0x2f, 0x1cf: 0x30, + // Block 0x8, offset 0x200 + 0x219: 0xb3, 0x21a: 0xb4, 0x21b: 0xb5, 0x21d: 0xb6, 0x21f: 0xb7, + 0x220: 0xb8, 0x223: 0xb9, 0x224: 0xba, 0x225: 0xbb, 0x226: 0xbc, 0x227: 0xbd, + 0x22a: 0xbe, 0x22b: 0xbf, 0x22d: 0xc0, 0x22f: 0xc1, + 0x230: 0xc2, 0x231: 0xc3, 0x232: 0xc4, 0x233: 0xc5, 0x234: 0xc6, 0x235: 0xc7, 0x236: 0xc8, 0x237: 0xc2, + 0x238: 0xc3, 0x239: 0xc4, 0x23a: 0xc5, 0x23b: 0xc6, 0x23c: 0xc7, 0x23d: 0xc8, 0x23e: 0xc2, 0x23f: 0xc3, + // Block 0x9, offset 0x240 + 0x240: 0xc4, 0x241: 0xc5, 0x242: 0xc6, 0x243: 0xc7, 0x244: 0xc8, 0x245: 0xc2, 0x246: 0xc3, 0x247: 0xc4, + 0x248: 0xc5, 0x249: 0xc6, 0x24a: 0xc7, 0x24b: 0xc8, 0x24c: 0xc2, 0x24d: 0xc3, 0x24e: 0xc4, 0x24f: 0xc5, + 0x250: 0xc6, 0x251: 0xc7, 0x252: 0xc8, 0x253: 0xc2, 0x254: 0xc3, 0x255: 0xc4, 0x256: 0xc5, 0x257: 0xc6, + 0x258: 0xc7, 0x259: 0xc8, 0x25a: 0xc2, 0x25b: 0xc3, 0x25c: 0xc4, 0x25d: 0xc5, 0x25e: 0xc6, 0x25f: 0xc7, + 0x260: 0xc8, 0x261: 0xc2, 0x262: 0xc3, 0x263: 0xc4, 0x264: 0xc5, 0x265: 0xc6, 0x266: 0xc7, 0x267: 0xc8, + 0x268: 0xc2, 0x269: 0xc3, 0x26a: 0xc4, 0x26b: 0xc5, 0x26c: 0xc6, 0x26d: 0xc7, 0x26e: 0xc8, 0x26f: 0xc2, + 0x270: 0xc3, 0x271: 0xc4, 0x272: 0xc5, 0x273: 0xc6, 0x274: 0xc7, 0x275: 0xc8, 0x276: 0xc2, 0x277: 0xc3, + 0x278: 0xc4, 0x279: 0xc5, 0x27a: 0xc6, 0x27b: 0xc7, 0x27c: 0xc8, 0x27d: 0xc2, 0x27e: 0xc3, 0x27f: 0xc4, + // Block 0xa, offset 0x280 + 0x280: 0xc5, 0x281: 0xc6, 0x282: 0xc7, 0x283: 0xc8, 0x284: 0xc2, 0x285: 0xc3, 0x286: 0xc4, 0x287: 0xc5, + 0x288: 0xc6, 0x289: 0xc7, 0x28a: 0xc8, 0x28b: 0xc2, 0x28c: 0xc3, 0x28d: 0xc4, 0x28e: 0xc5, 0x28f: 0xc6, + 0x290: 0xc7, 0x291: 0xc8, 0x292: 0xc2, 0x293: 0xc3, 0x294: 0xc4, 0x295: 0xc5, 0x296: 0xc6, 0x297: 0xc7, + 0x298: 0xc8, 0x299: 0xc2, 0x29a: 0xc3, 0x29b: 0xc4, 0x29c: 0xc5, 0x29d: 0xc6, 0x29e: 0xc7, 0x29f: 0xc8, + 0x2a0: 0xc2, 0x2a1: 0xc3, 0x2a2: 0xc4, 0x2a3: 0xc5, 0x2a4: 0xc6, 0x2a5: 0xc7, 0x2a6: 0xc8, 0x2a7: 0xc2, + 0x2a8: 0xc3, 0x2a9: 0xc4, 0x2aa: 0xc5, 0x2ab: 0xc6, 0x2ac: 0xc7, 0x2ad: 0xc8, 0x2ae: 0xc2, 0x2af: 0xc3, + 0x2b0: 0xc4, 0x2b1: 0xc5, 0x2b2: 0xc6, 0x2b3: 0xc7, 0x2b4: 0xc8, 0x2b5: 0xc2, 0x2b6: 0xc3, 0x2b7: 0xc4, + 0x2b8: 0xc5, 0x2b9: 0xc6, 0x2ba: 0xc7, 0x2bb: 0xc8, 0x2bc: 0xc2, 0x2bd: 0xc3, 0x2be: 0xc4, 0x2bf: 0xc5, + // Block 0xb, offset 0x2c0 + 0x2c0: 0xc6, 0x2c1: 0xc7, 0x2c2: 0xc8, 0x2c3: 0xc2, 0x2c4: 0xc3, 0x2c5: 0xc4, 0x2c6: 0xc5, 0x2c7: 0xc6, + 0x2c8: 0xc7, 0x2c9: 0xc8, 0x2ca: 0xc2, 0x2cb: 0xc3, 0x2cc: 0xc4, 0x2cd: 0xc5, 0x2ce: 0xc6, 0x2cf: 0xc7, + 0x2d0: 0xc8, 0x2d1: 0xc2, 0x2d2: 0xc3, 0x2d3: 0xc4, 0x2d4: 0xc5, 0x2d5: 0xc6, 0x2d6: 0xc7, 0x2d7: 0xc8, + 0x2d8: 0xc2, 0x2d9: 0xc3, 0x2da: 0xc4, 0x2db: 0xc5, 0x2dc: 0xc6, 0x2dd: 0xc7, 0x2de: 0xc9, + // Block 0xc, offset 0x300 + 0x324: 0x31, 0x325: 0x32, 0x326: 0x33, 0x327: 0x34, + 0x328: 0x35, 0x329: 0x36, 0x32a: 0x37, 0x32b: 0x38, 0x32c: 0x39, 0x32d: 0x3a, 0x32e: 0x3b, 0x32f: 0x3c, + 0x330: 0x3d, 0x331: 0x3e, 0x332: 0x3f, 0x333: 0x40, 0x334: 0x41, 0x335: 0x42, 0x336: 0x43, 0x337: 0x44, + 0x338: 0x45, 0x339: 0x46, 0x33a: 0x47, 0x33b: 0x48, 0x33c: 0xca, 0x33d: 0x49, 0x33e: 0x4a, 0x33f: 0x4b, + // Block 0xd, offset 0x340 + 0x347: 0xcb, + 0x34b: 0xcc, 0x34d: 0xcd, + 0x35e: 0x4c, + 0x368: 0xce, 0x36b: 0xcf, + 0x374: 0xd0, + 0x37a: 0xd1, 0x37b: 0xd2, 0x37d: 0xd3, 0x37e: 0xd4, + // Block 0xe, offset 0x380 + 0x381: 0xd5, 0x382: 0xd6, 0x384: 0xd7, 0x385: 0xbc, 0x387: 0xd8, + 0x388: 0xd9, 0x38b: 0xda, 0x38c: 0xdb, 0x38d: 0xdc, + 0x391: 0xdd, 0x392: 0xde, 0x393: 0xdf, 0x396: 0xe0, 0x397: 0xe1, + 0x398: 0xe2, 0x39a: 0xe3, 0x39c: 0xe4, + 0x3a0: 0xe5, 0x3a4: 0xe6, 0x3a5: 0xe7, 0x3a7: 0xe8, + 0x3a8: 0xe9, 0x3a9: 0xea, 0x3aa: 0xeb, + 0x3b0: 0xe2, 0x3b5: 0xec, 0x3b6: 0xed, + 0x3bd: 0xee, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xef, 0x3ec: 0xf0, + 0x3ff: 0xf1, + // Block 0x10, offset 0x400 + 0x432: 0xf2, + // Block 0x11, offset 0x440 + 0x445: 0xf3, 0x446: 0xf4, 0x447: 0xf5, + 0x449: 0xf6, + 0x450: 0xf7, 0x451: 0xf8, 0x452: 0xf9, 0x453: 0xfa, 0x454: 0xfb, 0x455: 0xfc, 0x456: 0xfd, 0x457: 0xfe, + 0x458: 0xff, 0x459: 0x100, 0x45a: 0x4d, 0x45b: 0x101, 0x45c: 0x102, 0x45d: 0x103, 0x45e: 0x104, 0x45f: 0x4e, + // Block 0x12, offset 0x480 + 0x480: 0x4f, 0x481: 0x50, 0x482: 0x105, 0x484: 0xf0, + 0x48a: 0x106, 0x48b: 0x107, + 0x493: 0x108, + 0x4a3: 0x109, 0x4a5: 0x10a, + 0x4b8: 0x51, 0x4b9: 0x52, 0x4ba: 0x53, + // Block 0x13, offset 0x4c0 + 0x4c4: 0x54, 0x4c5: 0x10b, 0x4c6: 0x10c, + 0x4c8: 0x55, 0x4c9: 0x10d, + 0x4ef: 0x10e, + // Block 0x14, offset 0x500 + 0x520: 0x56, 0x521: 0x57, 0x522: 0x58, 0x523: 0x59, 0x524: 0x5a, 0x525: 0x5b, 0x526: 0x5c, 0x527: 0x5d, + 0x528: 0x5e, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfkcSparseOffset: 176 entries, 352 bytes +var nfkcSparseOffset = []uint16{0x0, 0xe, 0x12, 0x1c, 0x26, 0x36, 0x38, 0x3d, 0x48, 0x57, 0x64, 0x6c, 0x71, 0x76, 0x78, 0x7c, 0x84, 0x8b, 0x8e, 0x96, 0x9a, 0x9e, 0xa0, 0xa2, 0xab, 0xaf, 0xb6, 0xbb, 0xbe, 0xc8, 0xcb, 0xd2, 0xda, 0xde, 0xe0, 0xe4, 0xe8, 0xee, 0xff, 0x10b, 0x10d, 0x113, 0x115, 0x117, 0x119, 0x11b, 0x11d, 0x11f, 0x121, 0x124, 0x127, 0x129, 0x12c, 0x12f, 0x133, 0x139, 0x140, 0x149, 0x14b, 0x14e, 0x150, 0x15b, 0x166, 0x174, 0x182, 0x192, 0x1a0, 0x1a7, 0x1ad, 0x1bc, 0x1c0, 0x1c2, 0x1c6, 0x1c8, 0x1cb, 0x1cd, 0x1d0, 0x1d2, 0x1d5, 0x1d7, 0x1d9, 0x1db, 0x1e7, 0x1f1, 0x1fb, 0x1fe, 0x202, 0x204, 0x206, 0x20b, 0x20e, 0x211, 0x213, 0x215, 0x217, 0x219, 0x21f, 0x222, 0x227, 0x229, 0x230, 0x236, 0x23c, 0x244, 0x24a, 0x250, 0x256, 0x25a, 0x25c, 0x25e, 0x260, 0x262, 0x268, 0x26b, 0x26d, 0x26f, 0x271, 0x277, 0x27b, 0x27f, 0x287, 0x28e, 0x291, 0x294, 0x296, 0x299, 0x2a1, 0x2a5, 0x2ac, 0x2af, 0x2b5, 0x2b7, 0x2b9, 0x2bc, 0x2be, 0x2c1, 0x2c6, 0x2c8, 0x2ca, 0x2cc, 0x2ce, 0x2d0, 0x2d3, 0x2d5, 0x2d7, 0x2d9, 0x2db, 0x2dd, 0x2df, 0x2ec, 0x2f6, 0x2f8, 0x2fa, 0x2fe, 0x303, 0x30f, 0x314, 0x31d, 0x323, 0x328, 0x32c, 0x331, 0x335, 0x345, 0x353, 0x361, 0x36f, 0x371, 0x373, 0x375, 0x379, 0x37b, 0x37e, 0x389, 0x38b, 0x395} + +// nfkcSparseValues: 919 entries, 3676 bytes +var nfkcSparseValues = [919]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0002, lo: 0x0d}, + {value: 0x0001, lo: 0xa0, hi: 0xa0}, + {value: 0x43b9, lo: 0xa8, hi: 0xa8}, + {value: 0x0083, lo: 0xaa, hi: 0xaa}, + {value: 0x43a5, lo: 0xaf, hi: 0xaf}, + {value: 0x0025, lo: 0xb2, hi: 0xb3}, + {value: 0x439b, lo: 0xb4, hi: 0xb4}, + {value: 0x0260, lo: 0xb5, hi: 0xb5}, + {value: 0x43d2, lo: 0xb8, hi: 0xb8}, + {value: 0x0023, lo: 0xb9, hi: 0xb9}, + {value: 0x009f, lo: 0xba, hi: 0xba}, + {value: 0x234c, lo: 0xbc, hi: 0xbc}, + {value: 0x2340, lo: 0xbd, hi: 0xbd}, + {value: 0x23e2, lo: 0xbe, hi: 0xbe}, + // Block 0x1, offset 0xe + {value: 0x0091, lo: 0x03}, + {value: 0x4823, lo: 0xa0, hi: 0xa1}, + {value: 0x4855, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x12 + {value: 0x0004, lo: 0x09}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x0091, lo: 0xb0, hi: 0xb0}, + {value: 0x0140, lo: 0xb1, hi: 0xb1}, + {value: 0x0095, lo: 0xb2, hi: 0xb2}, + {value: 0x00a5, lo: 0xb3, hi: 0xb3}, + {value: 0x0179, lo: 0xb4, hi: 0xb4}, + {value: 0x017f, lo: 0xb5, hi: 0xb5}, + {value: 0x018b, lo: 0xb6, hi: 0xb6}, + {value: 0x00af, lo: 0xb7, hi: 0xb8}, + // Block 0x3, offset 0x1c + {value: 0x000a, lo: 0x09}, + {value: 0x43af, lo: 0x98, hi: 0x98}, + {value: 0x43b4, lo: 0x99, hi: 0x9a}, + {value: 0x43d7, lo: 0x9b, hi: 0x9b}, + {value: 0x43a0, lo: 0x9c, hi: 0x9c}, + {value: 0x43c3, lo: 0x9d, hi: 0x9d}, + {value: 0x0137, lo: 0xa0, hi: 0xa0}, + {value: 0x0099, lo: 0xa1, hi: 0xa1}, + {value: 0x00a7, lo: 0xa2, hi: 0xa3}, + {value: 0x01b8, lo: 0xa4, hi: 0xa4}, + // Block 0x4, offset 0x26 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x38e6, lo: 0x90, hi: 0x90}, + {value: 0x38f2, lo: 0x91, hi: 0x91}, + {value: 0x38e0, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3958, lo: 0x97, hi: 0x97}, + {value: 0x3922, lo: 0x9c, hi: 0x9c}, + {value: 0x390a, lo: 0x9d, hi: 0x9d}, + {value: 0x3934, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x395e, lo: 0xb6, hi: 0xb6}, + {value: 0x3964, lo: 0xb7, hi: 0xb7}, + // Block 0x5, offset 0x36 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x83, hi: 0x87}, + // Block 0x6, offset 0x38 + {value: 0x0001, lo: 0x04}, + {value: 0x8114, lo: 0x81, hi: 0x82}, + {value: 0x8133, lo: 0x84, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + {value: 0x810e, lo: 0x87, hi: 0x87}, + // Block 0x7, offset 0x3d + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x97}, + {value: 0x811a, lo: 0x98, hi: 0x98}, + {value: 0x811b, lo: 0x99, hi: 0x99}, + {value: 0x811c, lo: 0x9a, hi: 0x9a}, + {value: 0x3982, lo: 0xa2, hi: 0xa2}, + {value: 0x3988, lo: 0xa3, hi: 0xa3}, + {value: 0x3994, lo: 0xa4, hi: 0xa4}, + {value: 0x398e, lo: 0xa5, hi: 0xa5}, + {value: 0x399a, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x8, offset 0x48 + {value: 0x0000, lo: 0x0e}, + {value: 0x39ac, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x39a0, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x39a6, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8133, lo: 0x96, hi: 0x9c}, + {value: 0x8133, lo: 0x9f, hi: 0xa2}, + {value: 0x812e, lo: 0xa3, hi: 0xa3}, + {value: 0x8133, lo: 0xa4, hi: 0xa4}, + {value: 0x8133, lo: 0xa7, hi: 0xa8}, + {value: 0x812e, lo: 0xaa, hi: 0xaa}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + // Block 0x9, offset 0x57 + {value: 0x0000, lo: 0x0c}, + {value: 0x8120, lo: 0x91, hi: 0x91}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x812e, lo: 0xb1, hi: 0xb1}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb5, hi: 0xb6}, + {value: 0x812e, lo: 0xb7, hi: 0xb9}, + {value: 0x8133, lo: 0xba, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbc}, + {value: 0x8133, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbe, hi: 0xbe}, + {value: 0x8133, lo: 0xbf, hi: 0xbf}, + // Block 0xa, offset 0x64 + {value: 0x0005, lo: 0x07}, + {value: 0x8133, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x812e, lo: 0x82, hi: 0x83}, + {value: 0x812e, lo: 0x84, hi: 0x85}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x812e, lo: 0x88, hi: 0x89}, + {value: 0x8133, lo: 0x8a, hi: 0x8a}, + // Block 0xb, offset 0x6c + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0xab, hi: 0xb1}, + {value: 0x812e, lo: 0xb2, hi: 0xb2}, + {value: 0x8133, lo: 0xb3, hi: 0xb3}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0xc, offset 0x71 + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0x96, hi: 0x99}, + {value: 0x8133, lo: 0x9b, hi: 0xa3}, + {value: 0x8133, lo: 0xa5, hi: 0xa7}, + {value: 0x8133, lo: 0xa9, hi: 0xad}, + // Block 0xd, offset 0x76 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + // Block 0xe, offset 0x78 + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0x98, hi: 0x98}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + {value: 0x8133, lo: 0x9c, hi: 0x9f}, + // Block 0xf, offset 0x7c + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x4019, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x4021, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x4029, lo: 0xb4, hi: 0xb4}, + {value: 0x9903, lo: 0xbc, hi: 0xbc}, + // Block 0x10, offset 0x84 + {value: 0x0008, lo: 0x06}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x91, hi: 0x91}, + {value: 0x812e, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x93, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x94}, + {value: 0x465d, lo: 0x98, hi: 0x9f}, + // Block 0x11, offset 0x8b + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x12, offset 0x8e + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2dd5, lo: 0x8b, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x469d, lo: 0x9c, hi: 0x9d}, + {value: 0x46ad, lo: 0x9f, hi: 0x9f}, + {value: 0x8133, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x96 + {value: 0x0000, lo: 0x03}, + {value: 0x46d5, lo: 0xb3, hi: 0xb3}, + {value: 0x46dd, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x14, offset 0x9a + {value: 0x0008, lo: 0x03}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x46b5, lo: 0x99, hi: 0x9b}, + {value: 0x46cd, lo: 0x9e, hi: 0x9e}, + // Block 0x15, offset 0x9e + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x16, offset 0xa0 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + // Block 0x17, offset 0xa2 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ded, lo: 0x88, hi: 0x88}, + {value: 0x2de5, lo: 0x8b, hi: 0x8b}, + {value: 0x2df5, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x46e5, lo: 0x9c, hi: 0x9c}, + {value: 0x46ed, lo: 0x9d, hi: 0x9d}, + // Block 0x18, offset 0xab + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2dfd, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x19, offset 0xaf + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e05, lo: 0x8a, hi: 0x8a}, + {value: 0x2e15, lo: 0x8b, hi: 0x8b}, + {value: 0x2e0d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1a, offset 0xb6 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x4031, lo: 0x88, hi: 0x88}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8121, lo: 0x95, hi: 0x96}, + // Block 0x1b, offset 0xbb + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1c, offset 0xbe + {value: 0x0000, lo: 0x09}, + {value: 0x2e1d, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2e25, lo: 0x87, hi: 0x87}, + {value: 0x2e2d, lo: 0x88, hi: 0x88}, + {value: 0x3091, lo: 0x8a, hi: 0x8a}, + {value: 0x2f19, lo: 0x8b, hi: 0x8b}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1d, offset 0xc8 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xcb + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e35, lo: 0x8a, hi: 0x8a}, + {value: 0x2e45, lo: 0x8b, hi: 0x8b}, + {value: 0x2e3d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1f, offset 0xd2 + {value: 0x6ab3, lo: 0x07}, + {value: 0x9905, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4039, lo: 0x9a, hi: 0x9a}, + {value: 0x3099, lo: 0x9c, hi: 0x9c}, + {value: 0x2f24, lo: 0x9d, hi: 0x9d}, + {value: 0x2e4d, lo: 0x9e, hi: 0x9f}, + // Block 0x20, offset 0xda + {value: 0x0000, lo: 0x03}, + {value: 0x2751, lo: 0xb3, hi: 0xb3}, + {value: 0x8123, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x21, offset 0xde + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0x88, hi: 0x8b}, + // Block 0x22, offset 0xe0 + {value: 0x0000, lo: 0x03}, + {value: 0x2766, lo: 0xb3, hi: 0xb3}, + {value: 0x8125, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x23, offset 0xe4 + {value: 0x0000, lo: 0x03}, + {value: 0x8126, lo: 0x88, hi: 0x8b}, + {value: 0x2758, lo: 0x9c, hi: 0x9c}, + {value: 0x275f, lo: 0x9d, hi: 0x9d}, + // Block 0x24, offset 0xe8 + {value: 0x0000, lo: 0x05}, + {value: 0x03fe, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x98, hi: 0x99}, + {value: 0x812e, lo: 0xb5, hi: 0xb5}, + {value: 0x812e, lo: 0xb7, hi: 0xb7}, + {value: 0x812c, lo: 0xb9, hi: 0xb9}, + // Block 0x25, offset 0xee + {value: 0x0000, lo: 0x10}, + {value: 0x2774, lo: 0x83, hi: 0x83}, + {value: 0x277b, lo: 0x8d, hi: 0x8d}, + {value: 0x2782, lo: 0x92, hi: 0x92}, + {value: 0x2789, lo: 0x97, hi: 0x97}, + {value: 0x2790, lo: 0x9c, hi: 0x9c}, + {value: 0x276d, lo: 0xa9, hi: 0xa9}, + {value: 0x8127, lo: 0xb1, hi: 0xb1}, + {value: 0x8128, lo: 0xb2, hi: 0xb2}, + {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, + {value: 0x8129, lo: 0xb4, hi: 0xb4}, + {value: 0x4bce, lo: 0xb5, hi: 0xb5}, + {value: 0x46f5, lo: 0xb6, hi: 0xb6}, + {value: 0x4735, lo: 0xb7, hi: 0xb7}, + {value: 0x46fd, lo: 0xb8, hi: 0xb8}, + {value: 0x4740, lo: 0xb9, hi: 0xb9}, + {value: 0x8128, lo: 0xba, hi: 0xbd}, + // Block 0x26, offset 0xff + {value: 0x0000, lo: 0x0b}, + {value: 0x8128, lo: 0x80, hi: 0x80}, + {value: 0x4bd7, lo: 0x81, hi: 0x81}, + {value: 0x8133, lo: 0x82, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0x86, hi: 0x87}, + {value: 0x279e, lo: 0x93, hi: 0x93}, + {value: 0x27a5, lo: 0x9d, hi: 0x9d}, + {value: 0x27ac, lo: 0xa2, hi: 0xa2}, + {value: 0x27b3, lo: 0xa7, hi: 0xa7}, + {value: 0x27ba, lo: 0xac, hi: 0xac}, + {value: 0x2797, lo: 0xb9, hi: 0xb9}, + // Block 0x27, offset 0x10b + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x86, hi: 0x86}, + // Block 0x28, offset 0x10d + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2e55, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x29, offset 0x113 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + // Block 0x2a, offset 0x115 + {value: 0x0000, lo: 0x01}, + {value: 0x0402, lo: 0xbc, hi: 0xbc}, + // Block 0x2b, offset 0x117 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x119 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x11b + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x11d + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x11f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x121 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x94, hi: 0x95}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x124 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x127 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x129 + {value: 0x0004, lo: 0x02}, + {value: 0x812f, lo: 0xb9, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x12c + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x97, hi: 0x97}, + {value: 0x812e, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x12f + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + {value: 0x8133, lo: 0xb5, hi: 0xbc}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x133 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + {value: 0x812e, lo: 0xb5, hi: 0xba}, + {value: 0x8133, lo: 0xbb, hi: 0xbc}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x37, offset 0x139 + {value: 0x0000, lo: 0x06}, + {value: 0x812e, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8a}, + {value: 0x8133, lo: 0x8b, hi: 0x8e}, + // Block 0x38, offset 0x140 + {value: 0x0000, lo: 0x08}, + {value: 0x2e9d, lo: 0x80, hi: 0x80}, + {value: 0x2ea5, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2ead, lo: 0x83, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xab, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xac}, + {value: 0x8133, lo: 0xad, hi: 0xb3}, + // Block 0x39, offset 0x149 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xaa, hi: 0xab}, + // Block 0x3a, offset 0x14b + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xa6, hi: 0xa6}, + {value: 0x8105, lo: 0xb2, hi: 0xb3}, + // Block 0x3b, offset 0x14e + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x3c, offset 0x150 + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812e, lo: 0x95, hi: 0x99}, + {value: 0x8133, lo: 0x9a, hi: 0x9b}, + {value: 0x812e, lo: 0x9c, hi: 0x9f}, + {value: 0x8133, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x8133, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb8, hi: 0xb9}, + // Block 0x3d, offset 0x15b + {value: 0x0002, lo: 0x0a}, + {value: 0x0043, lo: 0xac, hi: 0xac}, + {value: 0x00d1, lo: 0xad, hi: 0xad}, + {value: 0x0045, lo: 0xae, hi: 0xae}, + {value: 0x0049, lo: 0xb0, hi: 0xb1}, + {value: 0x00ec, lo: 0xb2, hi: 0xb2}, + {value: 0x004f, lo: 0xb3, hi: 0xba}, + {value: 0x005f, lo: 0xbc, hi: 0xbc}, + {value: 0x00fe, lo: 0xbd, hi: 0xbd}, + {value: 0x0061, lo: 0xbe, hi: 0xbe}, + {value: 0x0065, lo: 0xbf, hi: 0xbf}, + // Block 0x3e, offset 0x166 + {value: 0x0000, lo: 0x0d}, + {value: 0x0001, lo: 0x80, hi: 0x8a}, + {value: 0x0532, lo: 0x91, hi: 0x91}, + {value: 0x43dc, lo: 0x97, hi: 0x97}, + {value: 0x001d, lo: 0xa4, hi: 0xa4}, + {value: 0x19a0, lo: 0xa5, hi: 0xa5}, + {value: 0x1c8c, lo: 0xa6, hi: 0xa6}, + {value: 0x0001, lo: 0xaf, hi: 0xaf}, + {value: 0x27c1, lo: 0xb3, hi: 0xb3}, + {value: 0x2935, lo: 0xb4, hi: 0xb4}, + {value: 0x27c8, lo: 0xb6, hi: 0xb6}, + {value: 0x293f, lo: 0xb7, hi: 0xb7}, + {value: 0x199a, lo: 0xbc, hi: 0xbc}, + {value: 0x43aa, lo: 0xbe, hi: 0xbe}, + // Block 0x3f, offset 0x174 + {value: 0x0002, lo: 0x0d}, + {value: 0x1a60, lo: 0x87, hi: 0x87}, + {value: 0x1a5d, lo: 0x88, hi: 0x88}, + {value: 0x199d, lo: 0x89, hi: 0x89}, + {value: 0x2ac5, lo: 0x97, hi: 0x97}, + {value: 0x0001, lo: 0x9f, hi: 0x9f}, + {value: 0x0021, lo: 0xb0, hi: 0xb0}, + {value: 0x0093, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb4, hi: 0xb9}, + {value: 0x0017, lo: 0xba, hi: 0xba}, + {value: 0x055e, lo: 0xbb, hi: 0xbb}, + {value: 0x003b, lo: 0xbc, hi: 0xbc}, + {value: 0x0011, lo: 0xbd, hi: 0xbe}, + {value: 0x009d, lo: 0xbf, hi: 0xbf}, + // Block 0x40, offset 0x182 + {value: 0x0002, lo: 0x0f}, + {value: 0x0021, lo: 0x80, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8a}, + {value: 0x055e, lo: 0x8b, hi: 0x8b}, + {value: 0x003b, lo: 0x8c, hi: 0x8c}, + {value: 0x0011, lo: 0x8d, hi: 0x8e}, + {value: 0x0083, lo: 0x90, hi: 0x90}, + {value: 0x008b, lo: 0x91, hi: 0x91}, + {value: 0x009f, lo: 0x92, hi: 0x92}, + {value: 0x00b1, lo: 0x93, hi: 0x93}, + {value: 0x011f, lo: 0x94, hi: 0x94}, + {value: 0x0091, lo: 0x95, hi: 0x95}, + {value: 0x0097, lo: 0x96, hi: 0x99}, + {value: 0x00a1, lo: 0x9a, hi: 0x9a}, + {value: 0x00a7, lo: 0x9b, hi: 0x9c}, + {value: 0x1ac9, lo: 0xa8, hi: 0xa8}, + // Block 0x41, offset 0x192 + {value: 0x0000, lo: 0x0d}, + {value: 0x8133, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8133, lo: 0x9b, hi: 0x9c}, + {value: 0x8133, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8133, lo: 0xa7, hi: 0xa7}, + {value: 0x812e, lo: 0xa8, hi: 0xa8}, + {value: 0x8133, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xaf}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + // Block 0x42, offset 0x1a0 + {value: 0x0007, lo: 0x06}, + {value: 0x22b0, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3cfa, lo: 0x9a, hi: 0x9b}, + {value: 0x3d08, lo: 0xae, hi: 0xae}, + // Block 0x43, offset 0x1a7 + {value: 0x000e, lo: 0x05}, + {value: 0x3d0f, lo: 0x8d, hi: 0x8e}, + {value: 0x3d16, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x44, offset 0x1ad + {value: 0x017a, lo: 0x0e}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3d24, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3d2b, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3d32, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3d39, lo: 0xa4, hi: 0xa4}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x3d40, lo: 0xa6, hi: 0xa6}, + {value: 0x27cf, lo: 0xac, hi: 0xad}, + {value: 0x27d6, lo: 0xaf, hi: 0xaf}, + {value: 0x2953, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x45, offset 0x1bc + {value: 0x0007, lo: 0x03}, + {value: 0x3da9, lo: 0xa0, hi: 0xa1}, + {value: 0x3dd3, lo: 0xa2, hi: 0xa3}, + {value: 0x3dfd, lo: 0xaa, hi: 0xad}, + // Block 0x46, offset 0x1c0 + {value: 0x0004, lo: 0x01}, + {value: 0x0586, lo: 0xa9, hi: 0xaa}, + // Block 0x47, offset 0x1c2 + {value: 0x0002, lo: 0x03}, + {value: 0x0057, lo: 0x80, hi: 0x8f}, + {value: 0x0083, lo: 0x90, hi: 0xa9}, + {value: 0x0021, lo: 0xaa, hi: 0xaa}, + // Block 0x48, offset 0x1c6 + {value: 0x0000, lo: 0x01}, + {value: 0x2ad2, lo: 0x8c, hi: 0x8c}, + // Block 0x49, offset 0x1c8 + {value: 0x0266, lo: 0x02}, + {value: 0x1cbc, lo: 0xb4, hi: 0xb4}, + {value: 0x1a5a, lo: 0xb5, hi: 0xb6}, + // Block 0x4a, offset 0x1cb + {value: 0x0000, lo: 0x01}, + {value: 0x461e, lo: 0x9c, hi: 0x9c}, + // Block 0x4b, offset 0x1cd + {value: 0x0000, lo: 0x02}, + {value: 0x0095, lo: 0xbc, hi: 0xbc}, + {value: 0x006d, lo: 0xbd, hi: 0xbd}, + // Block 0x4c, offset 0x1d0 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xaf, hi: 0xb1}, + // Block 0x4d, offset 0x1d2 + {value: 0x0000, lo: 0x02}, + {value: 0x057a, lo: 0xaf, hi: 0xaf}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x4e, offset 0x1d5 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa0, hi: 0xbf}, + // Block 0x4f, offset 0x1d7 + {value: 0x0000, lo: 0x01}, + {value: 0x0ebe, lo: 0x9f, hi: 0x9f}, + // Block 0x50, offset 0x1d9 + {value: 0x0000, lo: 0x01}, + {value: 0x172a, lo: 0xb3, hi: 0xb3}, + // Block 0x51, offset 0x1db + {value: 0x0004, lo: 0x0b}, + {value: 0x1692, lo: 0x80, hi: 0x82}, + {value: 0x16aa, lo: 0x83, hi: 0x83}, + {value: 0x16c2, lo: 0x84, hi: 0x85}, + {value: 0x16d2, lo: 0x86, hi: 0x89}, + {value: 0x16e6, lo: 0x8a, hi: 0x8c}, + {value: 0x16fa, lo: 0x8d, hi: 0x8d}, + {value: 0x1702, lo: 0x8e, hi: 0x8e}, + {value: 0x170a, lo: 0x8f, hi: 0x90}, + {value: 0x1716, lo: 0x91, hi: 0x93}, + {value: 0x1726, lo: 0x94, hi: 0x94}, + {value: 0x172e, lo: 0x95, hi: 0x95}, + // Block 0x52, offset 0x1e7 + {value: 0x0004, lo: 0x09}, + {value: 0x0001, lo: 0x80, hi: 0x80}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x8134, lo: 0xac, hi: 0xac}, + {value: 0x812f, lo: 0xad, hi: 0xad}, + {value: 0x8130, lo: 0xae, hi: 0xae}, + {value: 0x8130, lo: 0xaf, hi: 0xaf}, + {value: 0x05ae, lo: 0xb6, hi: 0xb6}, + {value: 0x0982, lo: 0xb8, hi: 0xba}, + // Block 0x53, offset 0x1f1 + {value: 0x0006, lo: 0x09}, + {value: 0x0406, lo: 0xb1, hi: 0xb1}, + {value: 0x040a, lo: 0xb2, hi: 0xb2}, + {value: 0x4b7c, lo: 0xb3, hi: 0xb3}, + {value: 0x040e, lo: 0xb4, hi: 0xb4}, + {value: 0x4b82, lo: 0xb5, hi: 0xb6}, + {value: 0x0412, lo: 0xb7, hi: 0xb7}, + {value: 0x0416, lo: 0xb8, hi: 0xb8}, + {value: 0x041a, lo: 0xb9, hi: 0xb9}, + {value: 0x4b8e, lo: 0xba, hi: 0xbf}, + // Block 0x54, offset 0x1fb + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + {value: 0x8133, lo: 0xb4, hi: 0xbd}, + // Block 0x55, offset 0x1fe + {value: 0x0000, lo: 0x03}, + {value: 0x02d8, lo: 0x9c, hi: 0x9c}, + {value: 0x02de, lo: 0x9d, hi: 0x9d}, + {value: 0x8133, lo: 0x9e, hi: 0x9f}, + // Block 0x56, offset 0x202 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb1}, + // Block 0x57, offset 0x204 + {value: 0x0000, lo: 0x01}, + {value: 0x173e, lo: 0xb0, hi: 0xb0}, + // Block 0x58, offset 0x206 + {value: 0x0006, lo: 0x04}, + {value: 0x0047, lo: 0xb2, hi: 0xb3}, + {value: 0x0063, lo: 0xb4, hi: 0xb4}, + {value: 0x00dd, lo: 0xb8, hi: 0xb8}, + {value: 0x00e9, lo: 0xb9, hi: 0xb9}, + // Block 0x59, offset 0x20b + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xac, hi: 0xac}, + // Block 0x5a, offset 0x20e + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xa0, hi: 0xb1}, + // Block 0x5b, offset 0x211 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xab, hi: 0xad}, + // Block 0x5c, offset 0x213 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x93, hi: 0x93}, + // Block 0x5d, offset 0x215 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb3, hi: 0xb3}, + // Block 0x5e, offset 0x217 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + // Block 0x5f, offset 0x219 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb7, hi: 0xb8}, + {value: 0x8133, lo: 0xbe, hi: 0xbf}, + // Block 0x60, offset 0x21f + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + // Block 0x61, offset 0x222 + {value: 0x000c, lo: 0x04}, + {value: 0x173a, lo: 0x9c, hi: 0x9d}, + {value: 0x014f, lo: 0x9e, hi: 0x9e}, + {value: 0x174a, lo: 0x9f, hi: 0x9f}, + {value: 0x01a6, lo: 0xa9, hi: 0xa9}, + // Block 0x62, offset 0x227 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xad, hi: 0xad}, + // Block 0x63, offset 0x229 + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x64, offset 0x230 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x65, offset 0x236 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x66, offset 0x23c + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x67, offset 0x244 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x68, offset 0x24a + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x69, offset 0x250 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x6a, offset 0x256 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x6b, offset 0x25a + {value: 0x0002, lo: 0x01}, + {value: 0x0003, lo: 0x81, hi: 0xbf}, + // Block 0x6c, offset 0x25c + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0x6d, offset 0x25e + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xa0, hi: 0xa0}, + // Block 0x6e, offset 0x260 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb6, hi: 0xba}, + // Block 0x6f, offset 0x262 + {value: 0x002d, lo: 0x05}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + {value: 0x8133, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x70, offset 0x268 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xa5, hi: 0xa5}, + {value: 0x812e, lo: 0xa6, hi: 0xa6}, + // Block 0x71, offset 0x26b + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa4, hi: 0xa7}, + // Block 0x72, offset 0x26d + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + // Block 0x73, offset 0x26f + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbf}, + // Block 0x74, offset 0x271 + {value: 0x0000, lo: 0x05}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x8133, lo: 0x88, hi: 0x8a}, + {value: 0x812e, lo: 0x8b, hi: 0x8b}, + {value: 0x8133, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x8d, hi: 0x90}, + // Block 0x75, offset 0x277 + {value: 0x0005, lo: 0x03}, + {value: 0x8133, lo: 0x82, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + // Block 0x76, offset 0x27b + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xb0, hi: 0xb0}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x77, offset 0x27f + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4379, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4383, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x438d, lo: 0xab, hi: 0xab}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x78, offset 0x287 + {value: 0x0000, lo: 0x06}, + {value: 0x8133, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2eb5, lo: 0xae, hi: 0xae}, + {value: 0x2ebf, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8105, lo: 0xb3, hi: 0xb4}, + // Block 0x79, offset 0x28e + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0x7a, offset 0x291 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb5, hi: 0xb5}, + {value: 0x8103, lo: 0xb6, hi: 0xb6}, + // Block 0x7b, offset 0x294 + {value: 0x0002, lo: 0x01}, + {value: 0x8103, lo: 0xa9, hi: 0xaa}, + // Block 0x7c, offset 0x296 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x7d, offset 0x299 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ec9, lo: 0x8b, hi: 0x8b}, + {value: 0x2ed3, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8133, lo: 0xa6, hi: 0xac}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + // Block 0x7e, offset 0x2a1 + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x86, hi: 0x86}, + {value: 0x8133, lo: 0x9e, hi: 0x9e}, + // Block 0x7f, offset 0x2a5 + {value: 0x6a23, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2ee7, lo: 0xbb, hi: 0xbb}, + {value: 0x2edd, lo: 0xbc, hi: 0xbd}, + {value: 0x2ef1, lo: 0xbe, hi: 0xbe}, + // Block 0x80, offset 0x2ac + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x81, offset 0x2af + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2efb, lo: 0xba, hi: 0xba}, + {value: 0x2f05, lo: 0xbb, hi: 0xbb}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x82, offset 0x2b5 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x80, hi: 0x80}, + // Block 0x83, offset 0x2b7 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x84, offset 0x2b9 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x85, offset 0x2bc + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xab, hi: 0xab}, + // Block 0x86, offset 0x2be + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb9, hi: 0xb9}, + {value: 0x8103, lo: 0xba, hi: 0xba}, + // Block 0x87, offset 0x2c1 + {value: 0x0000, lo: 0x04}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb5, hi: 0xb5}, + {value: 0x2f0f, lo: 0xb8, hi: 0xb8}, + {value: 0x8105, lo: 0xbd, hi: 0xbe}, + // Block 0x88, offset 0x2c6 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x89, offset 0x2c8 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + // Block 0x8a, offset 0x2ca + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x8b, offset 0x2cc + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x87, hi: 0x87}, + // Block 0x8c, offset 0x2ce + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x99, hi: 0x99}, + // Block 0x8d, offset 0x2d0 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0x82, hi: 0x82}, + {value: 0x8105, lo: 0x84, hi: 0x85}, + // Block 0x8e, offset 0x2d3 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x97, hi: 0x97}, + // Block 0x8f, offset 0x2d5 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x81, hi: 0x82}, + // Block 0x90, offset 0x2d7 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x91, offset 0x2d9 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb6}, + // Block 0x92, offset 0x2db + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb0, hi: 0xb1}, + // Block 0x93, offset 0x2dd + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x94, offset 0x2df + {value: 0x0000, lo: 0x0c}, + {value: 0x470d, lo: 0x9e, hi: 0x9e}, + {value: 0x4717, lo: 0x9f, hi: 0x9f}, + {value: 0x474b, lo: 0xa0, hi: 0xa0}, + {value: 0x4759, lo: 0xa1, hi: 0xa1}, + {value: 0x4767, lo: 0xa2, hi: 0xa2}, + {value: 0x4775, lo: 0xa3, hi: 0xa3}, + {value: 0x4783, lo: 0xa4, hi: 0xa4}, + {value: 0x812c, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8131, lo: 0xad, hi: 0xad}, + {value: 0x812c, lo: 0xae, hi: 0xb2}, + {value: 0x812e, lo: 0xbb, hi: 0xbf}, + // Block 0x95, offset 0x2ec + {value: 0x0000, lo: 0x09}, + {value: 0x812e, lo: 0x80, hi: 0x82}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8b}, + {value: 0x8133, lo: 0xaa, hi: 0xad}, + {value: 0x4721, lo: 0xbb, hi: 0xbb}, + {value: 0x472b, lo: 0xbc, hi: 0xbc}, + {value: 0x4791, lo: 0xbd, hi: 0xbd}, + {value: 0x47ad, lo: 0xbe, hi: 0xbe}, + {value: 0x479f, lo: 0xbf, hi: 0xbf}, + // Block 0x96, offset 0x2f6 + {value: 0x0000, lo: 0x01}, + {value: 0x47bb, lo: 0x80, hi: 0x80}, + // Block 0x97, offset 0x2f8 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x82, hi: 0x84}, + // Block 0x98, offset 0x2fa + {value: 0x0002, lo: 0x03}, + {value: 0x0043, lo: 0x80, hi: 0x99}, + {value: 0x0083, lo: 0x9a, hi: 0xb3}, + {value: 0x0043, lo: 0xb4, hi: 0xbf}, + // Block 0x99, offset 0x2fe + {value: 0x0002, lo: 0x04}, + {value: 0x005b, lo: 0x80, hi: 0x8d}, + {value: 0x0083, lo: 0x8e, hi: 0x94}, + {value: 0x0093, lo: 0x96, hi: 0xa7}, + {value: 0x0043, lo: 0xa8, hi: 0xbf}, + // Block 0x9a, offset 0x303 + {value: 0x0002, lo: 0x0b}, + {value: 0x0073, lo: 0x80, hi: 0x81}, + {value: 0x0083, lo: 0x82, hi: 0x9b}, + {value: 0x0043, lo: 0x9c, hi: 0x9c}, + {value: 0x0047, lo: 0x9e, hi: 0x9f}, + {value: 0x004f, lo: 0xa2, hi: 0xa2}, + {value: 0x0055, lo: 0xa5, hi: 0xa6}, + {value: 0x005d, lo: 0xa9, hi: 0xac}, + {value: 0x0067, lo: 0xae, hi: 0xb5}, + {value: 0x0083, lo: 0xb6, hi: 0xb9}, + {value: 0x008d, lo: 0xbb, hi: 0xbb}, + {value: 0x0091, lo: 0xbd, hi: 0xbf}, + // Block 0x9b, offset 0x30f + {value: 0x0002, lo: 0x04}, + {value: 0x0097, lo: 0x80, hi: 0x83}, + {value: 0x00a1, lo: 0x85, hi: 0x8f}, + {value: 0x0043, lo: 0x90, hi: 0xa9}, + {value: 0x0083, lo: 0xaa, hi: 0xbf}, + // Block 0x9c, offset 0x314 + {value: 0x0002, lo: 0x08}, + {value: 0x00af, lo: 0x80, hi: 0x83}, + {value: 0x0043, lo: 0x84, hi: 0x85}, + {value: 0x0049, lo: 0x87, hi: 0x8a}, + {value: 0x0055, lo: 0x8d, hi: 0x94}, + {value: 0x0067, lo: 0x96, hi: 0x9c}, + {value: 0x0083, lo: 0x9e, hi: 0xb7}, + {value: 0x0043, lo: 0xb8, hi: 0xb9}, + {value: 0x0049, lo: 0xbb, hi: 0xbe}, + // Block 0x9d, offset 0x31d + {value: 0x0002, lo: 0x05}, + {value: 0x0053, lo: 0x80, hi: 0x84}, + {value: 0x005f, lo: 0x86, hi: 0x86}, + {value: 0x0067, lo: 0x8a, hi: 0x90}, + {value: 0x0083, lo: 0x92, hi: 0xab}, + {value: 0x0043, lo: 0xac, hi: 0xbf}, + // Block 0x9e, offset 0x323 + {value: 0x0002, lo: 0x04}, + {value: 0x006b, lo: 0x80, hi: 0x85}, + {value: 0x0083, lo: 0x86, hi: 0x9f}, + {value: 0x0043, lo: 0xa0, hi: 0xb9}, + {value: 0x0083, lo: 0xba, hi: 0xbf}, + // Block 0x9f, offset 0x328 + {value: 0x0002, lo: 0x03}, + {value: 0x008f, lo: 0x80, hi: 0x93}, + {value: 0x0043, lo: 0x94, hi: 0xad}, + {value: 0x0083, lo: 0xae, hi: 0xbf}, + // Block 0xa0, offset 0x32c + {value: 0x0002, lo: 0x04}, + {value: 0x00a7, lo: 0x80, hi: 0x87}, + {value: 0x0043, lo: 0x88, hi: 0xa1}, + {value: 0x0083, lo: 0xa2, hi: 0xbb}, + {value: 0x0043, lo: 0xbc, hi: 0xbf}, + // Block 0xa1, offset 0x331 + {value: 0x0002, lo: 0x03}, + {value: 0x004b, lo: 0x80, hi: 0x95}, + {value: 0x0083, lo: 0x96, hi: 0xaf}, + {value: 0x0043, lo: 0xb0, hi: 0xbf}, + // Block 0xa2, offset 0x335 + {value: 0x0003, lo: 0x0f}, + {value: 0x023c, lo: 0x80, hi: 0x80}, + {value: 0x0556, lo: 0x81, hi: 0x81}, + {value: 0x023f, lo: 0x82, hi: 0x9a}, + {value: 0x0552, lo: 0x9b, hi: 0x9b}, + {value: 0x024b, lo: 0x9c, hi: 0x9c}, + {value: 0x0254, lo: 0x9d, hi: 0x9d}, + {value: 0x025a, lo: 0x9e, hi: 0x9e}, + {value: 0x027e, lo: 0x9f, hi: 0x9f}, + {value: 0x026f, lo: 0xa0, hi: 0xa0}, + {value: 0x026c, lo: 0xa1, hi: 0xa1}, + {value: 0x01f7, lo: 0xa2, hi: 0xb2}, + {value: 0x020c, lo: 0xb3, hi: 0xb3}, + {value: 0x022a, lo: 0xb4, hi: 0xba}, + {value: 0x0556, lo: 0xbb, hi: 0xbb}, + {value: 0x023f, lo: 0xbc, hi: 0xbf}, + // Block 0xa3, offset 0x345 + {value: 0x0003, lo: 0x0d}, + {value: 0x024b, lo: 0x80, hi: 0x94}, + {value: 0x0552, lo: 0x95, hi: 0x95}, + {value: 0x024b, lo: 0x96, hi: 0x96}, + {value: 0x0254, lo: 0x97, hi: 0x97}, + {value: 0x025a, lo: 0x98, hi: 0x98}, + {value: 0x027e, lo: 0x99, hi: 0x99}, + {value: 0x026f, lo: 0x9a, hi: 0x9a}, + {value: 0x026c, lo: 0x9b, hi: 0x9b}, + {value: 0x01f7, lo: 0x9c, hi: 0xac}, + {value: 0x020c, lo: 0xad, hi: 0xad}, + {value: 0x022a, lo: 0xae, hi: 0xb4}, + {value: 0x0556, lo: 0xb5, hi: 0xb5}, + {value: 0x023f, lo: 0xb6, hi: 0xbf}, + // Block 0xa4, offset 0x353 + {value: 0x0003, lo: 0x0d}, + {value: 0x025d, lo: 0x80, hi: 0x8e}, + {value: 0x0552, lo: 0x8f, hi: 0x8f}, + {value: 0x024b, lo: 0x90, hi: 0x90}, + {value: 0x0254, lo: 0x91, hi: 0x91}, + {value: 0x025a, lo: 0x92, hi: 0x92}, + {value: 0x027e, lo: 0x93, hi: 0x93}, + {value: 0x026f, lo: 0x94, hi: 0x94}, + {value: 0x026c, lo: 0x95, hi: 0x95}, + {value: 0x01f7, lo: 0x96, hi: 0xa6}, + {value: 0x020c, lo: 0xa7, hi: 0xa7}, + {value: 0x022a, lo: 0xa8, hi: 0xae}, + {value: 0x0556, lo: 0xaf, hi: 0xaf}, + {value: 0x023f, lo: 0xb0, hi: 0xbf}, + // Block 0xa5, offset 0x361 + {value: 0x0003, lo: 0x0d}, + {value: 0x026f, lo: 0x80, hi: 0x88}, + {value: 0x0552, lo: 0x89, hi: 0x89}, + {value: 0x024b, lo: 0x8a, hi: 0x8a}, + {value: 0x0254, lo: 0x8b, hi: 0x8b}, + {value: 0x025a, lo: 0x8c, hi: 0x8c}, + {value: 0x027e, lo: 0x8d, hi: 0x8d}, + {value: 0x026f, lo: 0x8e, hi: 0x8e}, + {value: 0x026c, lo: 0x8f, hi: 0x8f}, + {value: 0x01f7, lo: 0x90, hi: 0xa0}, + {value: 0x020c, lo: 0xa1, hi: 0xa1}, + {value: 0x022a, lo: 0xa2, hi: 0xa8}, + {value: 0x0556, lo: 0xa9, hi: 0xa9}, + {value: 0x023f, lo: 0xaa, hi: 0xbf}, + // Block 0xa6, offset 0x36f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + // Block 0xa7, offset 0x371 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xae, hi: 0xae}, + // Block 0xa8, offset 0x373 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xac, hi: 0xaf}, + // Block 0xa9, offset 0x375 + {value: 0x0000, lo: 0x03}, + {value: 0x8134, lo: 0xac, hi: 0xad}, + {value: 0x812e, lo: 0xae, hi: 0xae}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + // Block 0xaa, offset 0x379 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x90, hi: 0x96}, + // Block 0xab, offset 0x37b + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x84, hi: 0x89}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0xac, offset 0x37e + {value: 0x0002, lo: 0x0a}, + {value: 0x0063, lo: 0x80, hi: 0x89}, + {value: 0x1a7e, lo: 0x8a, hi: 0x8a}, + {value: 0x1ab1, lo: 0x8b, hi: 0x8b}, + {value: 0x1acc, lo: 0x8c, hi: 0x8c}, + {value: 0x1ad2, lo: 0x8d, hi: 0x8d}, + {value: 0x1cf0, lo: 0x8e, hi: 0x8e}, + {value: 0x1ade, lo: 0x8f, hi: 0x8f}, + {value: 0x1aa8, lo: 0xaa, hi: 0xaa}, + {value: 0x1aab, lo: 0xab, hi: 0xab}, + {value: 0x1aae, lo: 0xac, hi: 0xac}, + // Block 0xad, offset 0x389 + {value: 0x0000, lo: 0x01}, + {value: 0x1a6c, lo: 0x90, hi: 0x90}, + // Block 0xae, offset 0x38b + {value: 0x0028, lo: 0x09}, + {value: 0x2999, lo: 0x80, hi: 0x80}, + {value: 0x295d, lo: 0x81, hi: 0x81}, + {value: 0x2967, lo: 0x82, hi: 0x82}, + {value: 0x297b, lo: 0x83, hi: 0x84}, + {value: 0x2985, lo: 0x85, hi: 0x86}, + {value: 0x2971, lo: 0x87, hi: 0x87}, + {value: 0x298f, lo: 0x88, hi: 0x88}, + {value: 0x0c6a, lo: 0x90, hi: 0x90}, + {value: 0x09e2, lo: 0x91, hi: 0x91}, + // Block 0xaf, offset 0x395 + {value: 0x0002, lo: 0x01}, + {value: 0x0021, lo: 0xb0, hi: 0xb9}, +} + +// recompMap: 7528 bytes (entries only) +var recompMap map[uint32]rune +var recompMapOnce sync.Once + +const recompMapPacked = "" + + "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 + "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 + "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 + "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 + "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 + "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 + "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 + "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 + "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 + "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA + "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB + "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC + "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD + "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE + "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF + "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 + "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 + "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 + "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 + "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 + "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 + "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 + "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA + "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB + "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC + "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD + "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 + "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 + "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 + "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 + "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 + "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 + "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 + "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 + "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 + "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA + "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB + "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC + "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED + "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE + "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF + "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 + "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 + "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 + "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 + "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 + "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 + "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 + "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA + "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB + "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC + "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD + "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF + "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 + "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 + "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 + "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 + "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 + "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 + "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 + "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 + "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 + "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 + "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A + "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B + "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C + "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D + "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E + "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F + "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 + "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 + "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 + "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 + "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 + "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 + "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 + "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 + "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A + "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B + "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C + "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D + "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E + "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F + "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 + "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 + "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 + "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 + "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 + "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 + "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 + "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 + "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A + "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B + "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C + "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D + "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E + "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F + "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 + "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 + "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 + "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 + "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 + "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 + "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A + "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B + "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C + "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D + "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E + "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 + "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 + "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 + "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 + "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 + "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 + "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C + "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D + "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E + "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F + "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 + "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 + "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 + "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 + "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 + "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 + "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 + "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 + "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A + "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B + "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C + "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D + "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E + "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F + "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 + "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 + "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 + "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 + "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 + "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 + "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 + "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 + "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A + "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B + "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C + "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D + "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E + "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F + "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 + "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 + "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 + "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 + "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 + "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 + "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 + "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 + "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 + "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 + "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A + "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B + "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C + "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D + "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E + "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 + "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 + "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF + "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 + "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD + "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE + "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF + "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 + "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 + "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 + "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 + "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 + "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 + "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 + "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 + "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 + "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 + "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA + "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB + "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC + "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE + "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF + "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 + "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 + "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 + "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 + "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 + "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 + "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 + "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 + "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA + "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB + "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC + "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED + "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE + "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF + "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 + "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 + "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 + "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 + "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 + "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA + "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB + "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC + "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD + "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE + "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF + "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 + "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 + "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 + "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 + "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 + "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 + "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 + "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 + "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 + "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 + "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A + "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B + "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C + "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D + "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E + "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F + "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 + "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 + "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 + "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 + "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 + "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 + "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 + "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 + "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 + "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 + "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A + "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B + "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E + "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F + "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 + "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 + "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 + "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 + "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A + "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B + "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C + "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D + "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E + "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F + "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 + "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 + "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 + "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 + "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 + "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 + "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 + "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 + "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A + "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C + "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E + "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F + "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 + "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA + "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB + "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC + "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD + "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE + "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF + "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 + "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA + "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB + "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC + "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD + "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE + "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 + "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 + "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 + "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 + "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 + "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 + "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C + "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D + "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E + "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 + "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 + "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 + "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 + "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 + "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 + "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C + "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D + "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E + "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 + "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 + "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 + "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 + "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 + "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 + "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 + "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 + "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 + "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 + "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA + "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB + "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC + "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD + "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE + "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF + "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 + "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 + "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 + "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 + "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 + "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 + "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA + "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB + "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC + "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED + "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE + "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF + "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 + "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 + "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 + "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 + "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 + "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 + "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 + "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 + "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 + "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 + "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 + "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 + "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 + "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 + "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 + "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 + "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 + "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 + "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 + "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB + "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC + "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 + "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B + "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C + "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 + "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA + "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB + "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC + "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 + "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 + "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 + "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 + "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA + "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB + "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A + "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B + "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C + "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA + "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC + "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD + "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE + "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 + "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 + "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 + "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A + "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C + "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E + "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 + "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B + "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D + "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 + "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 + "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 + "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 + "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 + "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 + "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 + "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 + "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 + "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 + "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 + "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 + "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 + "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A + "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B + "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C + "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D + "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E + "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F + "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 + "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 + "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 + "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 + "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 + "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 + "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 + "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 + "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 + "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 + "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A + "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B + "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C + "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D + "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E + "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F + "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 + "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 + "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 + "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 + "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 + "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 + "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 + "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 + "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 + "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 + "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A + "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B + "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C + "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D + "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E + "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F + "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 + "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 + "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 + "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 + "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 + "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 + "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 + "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 + "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 + "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 + "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A + "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B + "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C + "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D + "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E + "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F + "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 + "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 + "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 + "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 + "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 + "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 + "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 + "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 + "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 + "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 + "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A + "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B + "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C + "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D + "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E + "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F + "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 + "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 + "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 + "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 + "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 + "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 + "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 + "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 + "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 + "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 + "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A + "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B + "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C + "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D + "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E + "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F + "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 + "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 + "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 + "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 + "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 + "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 + "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 + "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 + "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 + "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 + "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A + "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B + "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C + "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D + "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E + "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F + "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 + "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 + "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 + "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 + "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 + "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 + "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 + "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 + "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 + "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 + "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A + "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C + "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D + "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E + "\x00v\x03#\x00\x00\x1e\x7f" + // 0x00760323: 0x00001E7F + "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 + "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 + "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 + "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 + "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 + "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 + "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 + "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 + "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 + "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 + "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A + "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B + "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C + "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D + "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E + "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F + "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 + "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 + "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 + "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 + "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 + "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 + "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 + "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 + "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 + "\x01\x7f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 + "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 + "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 + "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 + "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 + "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 + "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 + "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 + "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 + "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 + "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA + "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB + "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC + "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD + "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE + "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF + "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 + "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 + "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 + "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 + "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 + "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 + "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 + "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 + "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 + "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 + "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA + "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB + "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC + "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD + "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE + "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF + "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 + "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 + "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 + "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 + "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 + "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 + "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 + "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 + "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 + "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 + "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA + "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB + "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC + "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD + "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE + "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF + "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 + "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 + "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 + "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 + "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 + "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 + "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 + "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 + "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 + "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 + "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA + "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB + "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC + "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD + "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE + "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF + "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 + "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 + "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 + "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 + "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 + "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 + "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 + "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 + "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 + "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 + "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA + "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB + "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC + "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED + "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE + "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF + "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 + "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 + "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 + "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 + "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 + "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 + "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 + "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 + "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 + "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 + "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 + "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 + "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 + "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 + "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 + "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 + "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 + "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 + "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 + "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 + "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A + "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B + "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C + "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D + "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E + "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F + "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 + "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 + "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 + "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 + "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 + "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 + "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 + "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 + "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A + "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B + "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C + "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D + "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 + "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 + "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 + "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 + "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 + "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 + "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 + "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 + "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 + "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 + "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A + "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B + "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C + "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D + "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E + "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F + "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 + "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 + "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 + "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 + "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 + "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 + "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 + "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 + "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 + "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 + "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A + "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B + "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C + "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D + "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E + "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F + "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 + "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 + "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 + "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 + "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 + "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 + "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 + "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 + "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A + "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B + "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C + "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D + "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 + "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 + "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 + "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 + "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 + "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 + "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 + "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 + "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 + "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B + "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D + "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F + "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 + "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 + "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 + "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 + "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 + "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 + "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 + "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 + "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 + "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 + "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A + "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B + "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C + "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D + "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E + "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F + "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 + "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 + "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 + "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 + "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 + "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A + "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C + "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 + "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 + "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 + "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 + "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 + "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 + "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 + "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 + "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 + "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 + "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A + "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B + "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C + "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D + "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E + "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F + "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 + "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 + "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 + "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 + "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 + "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 + "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 + "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 + "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 + "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 + "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A + "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B + "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C + "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D + "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E + "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F + "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 + "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 + "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 + "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 + "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 + "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 + "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 + "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 + "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 + "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 + "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA + "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB + "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC + "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD + "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE + "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF + "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 + "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 + "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 + "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 + "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 + "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 + "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 + "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 + "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 + "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA + "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC + "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 + "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 + "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 + "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 + "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 + "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 + "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 + "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA + "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC + "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD + "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE + "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF + "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 + "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 + "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 + "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 + "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 + "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 + "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 + "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA + "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD + "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE + "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF + "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 + "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 + "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 + "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 + "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 + "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 + "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 + "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 + "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 + "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA + "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC + "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED + "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 + "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 + "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 + "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 + "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 + "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 + "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA + "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC + "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A + "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B + "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE + "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD + "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE + "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF + "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 + "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 + "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C + "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 + "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 + "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 + "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 + "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 + "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 + "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 + "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 + "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D + "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E + "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F + "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 + "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 + "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 + "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 + "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 + "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 + "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 + "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 + "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 + "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 + "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 + "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 + "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC + "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD + "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE + "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF + "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 + "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 + "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 + "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 + "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA + "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB + "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC + "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED + "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C + "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E + "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 + "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 + "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 + "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 + "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 + "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A + "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C + "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E + "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 + "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 + "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 + "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 + "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 + "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 + "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 + "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 + "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 + "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 + "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 + "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 + "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A + "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C + "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D + "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 + "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E + "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC + "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE + "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 + "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 + "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 + "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 + "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 + "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA + "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC + "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE + "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 + "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 + "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 + "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 + "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 + "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 + "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 + "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 + "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 + "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 + "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 + "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 + "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA + "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC + "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD + "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 + "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 + "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 + "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 + "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA + "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE + "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A + "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C + "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB + "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E + "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F + "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B + "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C + "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB + "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC + "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE + "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA + "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB + "\x195\x190\x00\x01\x198" + // 0x19351930: 0x00011938 + "" + // Total size of tables: 56KB (57068 bytes) diff --git a/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go index 0175eae5..bf65457d 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build !go1.10 -// +build !go1.10 package norm diff --git a/vendor/golang.org/x/text/unicode/norm/trie.go b/vendor/golang.org/x/text/unicode/norm/trie.go index 423386bf..e4250ae2 100644 --- a/vendor/golang.org/x/text/unicode/norm/trie.go +++ b/vendor/golang.org/x/text/unicode/norm/trie.go @@ -29,7 +29,7 @@ var ( nfkcData = newNfkcTrie(0) ) -// lookupValue determines the type of block n and looks up the value for b. +// lookup determines the type of block n and looks up the value for b. // For n < t.cutoff, the block is a simple lookup table. Otherwise, the block // is a list of ranges with an accompanying value. Given a matching range r, // the value for b is by r.value + (b - r.lo) * stride. diff --git a/vendor/modules.txt b/vendor/modules.txt index 45ab555b..f9c2f0e2 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -1,4 +1,4 @@ -# atomicgo.dev/cursor v0.1.1 +# atomicgo.dev/cursor v0.2.0 ## explicit; go 1.15 atomicgo.dev/cursor # atomicgo.dev/keyboard v0.2.9 @@ -6,7 +6,7 @@ atomicgo.dev/cursor atomicgo.dev/keyboard atomicgo.dev/keyboard/internal atomicgo.dev/keyboard/keys -# atomicgo.dev/schedule v0.0.2 +# atomicgo.dev/schedule v0.1.0 ## explicit; go 1.18 atomicgo.dev/schedule # github.com/bitfield/script v0.22.0 @@ -18,7 +18,7 @@ github.com/containerd/console # github.com/dustin/go-humanize v1.0.1 ## explicit; go 1.16 github.com/dustin/go-humanize -# github.com/gookit/color v1.5.3 +# github.com/gookit/color v1.5.4 ## explicit; go 1.18 github.com/gookit/color # github.com/itchyny/gojq v0.12.12 @@ -34,11 +34,11 @@ github.com/lithammer/fuzzysearch/fuzzy ## explicit; go 1.12 github.com/magefile/mage/mg github.com/magefile/mage/sh -# github.com/mattn/go-runewidth v0.0.14 +# github.com/mattn/go-runewidth v0.0.15 ## explicit; go 1.9 github.com/mattn/go-runewidth -# github.com/pterm/pterm v0.12.62 -## explicit; go 1.18 +# github.com/pterm/pterm v0.12.79 +## explicit; go 1.21 github.com/pterm/pterm github.com/pterm/pterm/internal # github.com/rivo/uniseg v0.4.4 @@ -63,17 +63,16 @@ golang.org/x/mod/internal/lazyregexp golang.org/x/mod/modfile golang.org/x/mod/module golang.org/x/mod/semver -# golang.org/x/sys v0.8.0 -## explicit; go 1.17 -golang.org/x/sys/internal/unsafeheader +# golang.org/x/sys v0.16.0 +## explicit; go 1.18 golang.org/x/sys/plan9 golang.org/x/sys/unix golang.org/x/sys/windows -# golang.org/x/term v0.8.0 -## explicit; go 1.17 +# golang.org/x/term v0.16.0 +## explicit; go 1.18 golang.org/x/term -# golang.org/x/text v0.9.0 -## explicit; go 1.17 +# golang.org/x/text v0.14.0 +## explicit; go 1.18 golang.org/x/text/cases golang.org/x/text/internal golang.org/x/text/internal/language