Updated histones.csv -- added H2B.K and H2B.N sequences

intbio · Oct 28, 2024 · ce97304 · ce97304
1 parent f22a2f2
commit ce97304
Show file tree

Hide file tree

Showing 5 changed files with 24,316 additions and 646 deletions.
diff --git a/CURATED_SET/curated_service/curatedDB/UPD_curatedDB_241023.ipynb b/CURATED_SET/curated_service/curatedDB/UPD_curatedDB_241023.ipynb
@@ -712,7 +712,6 @@
    "cell_type": "markdown",
    "id": "01f74eb9-bc11-44ce-9520-f74c8e4db13a",
    "metadata": {
-    "jp-MarkdownHeadingCollapsed": true,
     "tags": []
    },
    "source": [
@@ -1487,8 +1486,22 @@
     "\n",
     "**Gene:** oryCun2, chr13, +-, 12617595-12619869\n",
     "\n",
-    "**Protein accession:** XP_002715119.1\n",
+    "**Sequence from article:**\n",
+    "```fasta\n",
+    ">Rabbit_H2B.K\n",
+    "MSAERGQQQQQASSRRGRSSGNKKSRKRSKRKETYSMYIYKVLKQVHPDIGISARAMSIMNSFVNDVFERLAGEAAQLAQYSGRSTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK\n",
+    "```\n",
+    "\n",
+    "BLASTP has one result with 100% coverage and 100% identity.\n",
     "\n",
+    "**Protein accession:** XP_002715119.2"
+   ]
+  },
+  {
+   "cell_type": "markdown",
+   "id": "b685e788-0990-4537-8a9a-48b89b51f3bf",
+   "metadata": {},
+   "source": [
     ">[Genome assembly OryCun2.0](https://www.ncbi.nlm.nih.gov/datasets/genome/GCF_000003625.3/)\n",
     ">\n",
     ">Status: RefSeq GCF_000003625.3 is suppressed\n",
@@ -2093,6 +2106,14 @@
     "\n",
     "**Gene:** susScr11, chr18, ++, 6019516-6022010\n",
     "\n",
+    "**Sequence from article:**\n",
+    "```fasta\n",
+    ">Pig_H2B.K\n",
+    "MSSAHGQQQQQQQQQQQQQQQGGGRRGRSSGEKKSKKRNRRKETYSMYIYKVLKQVHPDIGISSKAMSIMNSFVNDVFERLAGEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK\n",
+    "```\n",
+    "\n",
+    "BLASTP has one result with 100% coverage and 100% identity.\n",
+    "\n",
     "**Protein accession:** XP_013846203.1"
    ]
   },
@@ -2647,32 +2668,6 @@
     "conn.commit()"
    ]
   },
-  {
-   "cell_type": "markdown",
-   "id": "0c56b719-348a-44ea-89f1-41a87181eb42",
-   "metadata": {
-    "tags": []
-   },
-   "source": [
-    "# Add sheep H2B.K\n",
-    "\n",
-    "**Atricle:** https://academic.oup.com/mbe/article/39/2/msac019/6517784#333890704\n",
-    "\n",
-    "**Gene:** oviAri4, chr4, +-, 113150440-113152940\n",
-    "\n",
-    "**Protein accession:** XP_014950940.1\n",
-    "\n",
-    ">[Genome assembly Oar_v4.0](https://www.ncbi.nlm.nih.gov/datasets/genome/GCF_000298735.2/)\n",
-    ">\n",
-    ">Status: RefSeq GCF_000298735.2 is suppressed\n",
-    ">\n",
-    ">This record was removed as a result of standard genome annotation processing. Please see www.ncbi.nlm.nih.gov/genome/annotation_euk/process/ for more information.\n",
-    "\n",
-    "Actual version is [Genome assembly ]()\n",
-    "\n",
-    "**Protein accession after updating the genome assembly:** "
-   ]
-  },
   {
    "cell_type": "markdown",
    "id": "d3c8a219-f508-46e1-936f-7d6040016e39",