From ed273da8d5b1568681c721a8553ff91098c81270 Mon Sep 17 00:00:00 2001 From: speakeasybot Date: Thu, 2 Jan 2025 12:14:03 +0000 Subject: [PATCH] ci: regenerated with OpenAPI Doc , Speakeasy CLI 1.460.3 --- .speakeasy/gen.lock | 242 ++++---------- .speakeasy/gen.yaml | 2 +- .speakeasy/workflow.lock | 20 +- .speakeasy/workflow.yaml | 4 +- README.md | 21 +- RELEASES.md | 12 +- RUNTIMES.md | 28 +- codeSamples.yaml | 262 ++++++++-------- .../components/advertisementcampaign.md | 10 +- .../advertisementcampaignlistresource.md | 16 +- .../components/advertisementsortproperty.md | 2 +- docs/models/components/amounttype.md | 15 - docs/models/components/attachedcustomfield.md | 4 +- .../components/authorizeorganization.md | 2 +- .../authorizeresponseorganization.md | 32 +- .../authorizeresponseorganizationsubtype.md | 15 - .../components/authorizeresponseuser.md | 30 +- .../authorizeresponseusersubtype.md | 15 - docs/models/components/authorizeuser.md | 4 +- docs/models/components/benefit.md | 24 +- docs/models/components/benefitads.md | 6 +- docs/models/components/benefitadscreate.md | 4 +- .../models/components/benefitadscreatetype.md | 15 - .../models/components/benefitadssubscriber.md | 22 +- .../components/benefitadssubscribertype.md | 15 - docs/models/components/benefitadstype.md | 15 - docs/models/components/benefitadsupdate.md | 2 +- .../models/components/benefitadsupdatetype.md | 15 - docs/models/components/benefitbase.md | 4 +- docs/models/components/benefitcreate.md | 18 +- docs/models/components/benefitcustom.md | 6 +- docs/models/components/benefitcustomcreate.md | 4 +- .../components/benefitcustomcreatetype.md | 15 - .../components/benefitcustomsubscriber.md | 22 +- .../components/benefitcustomsubscribertype.md | 15 - docs/models/components/benefitcustomtype.md | 15 - docs/models/components/benefitcustomupdate.md | 2 +- .../components/benefitcustomupdatetype.md | 15 - docs/models/components/benefitdiscord.md | 6 +- .../models/components/benefitdiscordcreate.md | 4 +- .../components/benefitdiscordcreatetype.md | 15 - .../components/benefitdiscordsubscriber.md | 23 +- .../benefitdiscordsubscribertype.md | 15 - docs/models/components/benefitdiscordtype.md | 15 - .../models/components/benefitdiscordupdate.md | 2 +- .../components/benefitdiscordupdatetype.md | 15 - .../models/components/benefitdownloadables.md | 6 +- .../components/benefitdownloadablescreate.md | 5 +- .../benefitdownloadablescreatetype.md | 15 - .../benefitdownloadablessubscriber.md | 22 +- .../benefitdownloadablessubscribertype.md | 15 - .../components/benefitdownloadablestype.md | 15 - .../components/benefitdownloadablesupdate.md | 2 +- .../benefitdownloadablesupdatetype.md | 15 - .../components/benefitgithubrepository.md | 6 +- .../benefitgithubrepositorycreate.md | 5 +- ...hubrepositorycreatepropertiespermission.md | 2 +- .../benefitgithubrepositorycreatetype.md | 15 - .../benefitgithubrepositorysubscriber.md | 22 +- .../benefitgithubrepositorysubscribertype.md | 15 - .../components/benefitgithubrepositorytype.md | 15 - .../benefitgithubrepositoryupdate.md | 4 +- .../benefitgithubrepositoryupdatetype.md | 15 - docs/models/components/benefitgrant.md | 28 +- ...antgithubrepositorypropertiespermission.md | 2 +- docs/models/components/benefitgrantwebhook.md | 35 ++- docs/models/components/benefitlicensekeys.md | 6 +- .../components/benefitlicensekeyscreate.md | 5 +- .../benefitlicensekeyscreatetype.md | 15 - .../benefitlicensekeyssubscriber.md | 28 +- .../benefitlicensekeyssubscriberproperties.md | 6 +- .../benefitlicensekeyssubscribertype.md | 15 - .../components/benefitlicensekeystype.md | 15 - .../components/benefitlicensekeysupdate.md | 2 +- .../benefitlicensekeysupdatetype.md | 15 - docs/models/components/checkout.md | 31 +- docs/models/components/checkoutlegacy.md | 39 +-- .../models/components/checkoutlegacycreate.md | 2 +- docs/models/components/checkoutlink.md | 67 ++-- .../models/components/checkoutlinkdiscount.md | 78 ++--- .../models/components/checkoutlinkmetadata.md | 2 +- .../components/checkoutlinkpricecreate.md | 2 +- .../checkoutlinkpricecreatemetadata.md | 2 +- ...checkoutlinkpricecreatepaymentprocessor.md | 17 - docs/models/components/checkoutlinkproduct.md | 34 +- .../components/checkoutlinkproductcreate.md | 2 +- .../checkoutlinkproductcreatemetadata.md | 2 +- ...eckoutlinkproductcreatepaymentprocessor.md | 17 - .../components/checkoutlinksortproperty.md | 2 +- .../components/checkoutlinkupdatemetadata.md | 2 +- docs/models/components/checkoutpricecreate.md | 1 - .../checkoutpricecreatecustomermetadata.md | 2 +- .../components/checkoutpricecreatemetadata.md | 2 +- .../checkoutpricecreatepaymentprocessor.md | 17 - docs/models/components/checkoutproduct.md | 16 +- .../components/checkoutproductcreate.md | 1 - .../checkoutproductcreatecustomermetadata.md | 2 +- .../checkoutproductcreatemetadata.md | 2 +- .../checkoutproductcreatepaymentprocessor.md | 17 - docs/models/components/checkoutpublic.md | 105 +++---- .../components/checkoutpublicconfirmed.md | 101 +++--- .../checkoutpublicconfirmeddiscount.md | 24 +- .../components/checkoutpublicdiscount.md | 24 +- .../checkoutupdatecustomermetadata.md | 2 +- .../components/checkoutupdatemetadata.md | 2 +- docs/models/components/customer.md | 14 +- .../models/components/customerbenefitgrant.md | 296 ++++++++++++------ .../components/customerbenefitgrantads.md | 50 ++- .../customerbenefitgrantadsupdate.md | 6 +- ...ustomerbenefitgrantadsupdatebenefittype.md | 15 - .../components/customerbenefitgrantcustom.md | 49 ++- .../customerbenefitgrantcustomupdate.md | 6 +- ...omerbenefitgrantcustomupdatebenefittype.md | 15 - .../components/customerbenefitgrantdiscord.md | 49 ++- .../customerbenefitgrantdiscordupdate.md | 8 +- ...merbenefitgrantdiscordupdatebenefittype.md | 15 - .../customerbenefitgrantdownloadables.md | 50 ++- ...customerbenefitgrantdownloadablesupdate.md | 6 +- ...efitgrantdownloadablesupdatebenefittype.md | 15 - .../customerbenefitgrantgithubrepository.md | 50 ++- ...tomerbenefitgrantgithubrepositoryupdate.md | 8 +- ...tgrantgithubrepositoryupdatebenefittype.md | 16 - .../customerbenefitgrantlicensekeys.md | 58 ++-- .../customerbenefitgrantlicensekeysupdate.md | 6 +- ...enefitgrantlicensekeysupdatebenefittype.md | 15 - .../customerbenefitgrantsortproperty.md | 2 +- docs/models/components/customercreate.md | 2 +- docs/models/components/customercreatetaxid.md | 2 +- docs/models/components/customermetadata1.md | 2 +- docs/models/components/customerorder.md | 79 +++-- .../models/components/customerorderinvoice.md | 2 +- .../models/components/customerorderproduct.md | 47 +-- .../components/customerordersortproperty.md | 2 +- .../components/customerordersubscription.md | 20 +- .../components/customerportalcustomer.md | 10 +- .../components/customerportalcustomertaxid.md | 2 +- docs/models/components/customersession.md | 22 +- .../models/components/customersubscription.md | 77 ++--- .../components/customersubscriptionproduct.md | 49 +-- .../customersubscriptionsortproperty.md | 2 +- docs/models/components/customertaxid.md | 2 +- docs/models/components/customerupdatetaxid.md | 2 +- docs/models/components/customfield.md | 20 +- docs/models/components/customfieldcheckbox.md | 6 +- .../components/customfieldcheckboxtype.md | 15 - .../components/customfieldcreatecheckbox.md | 2 +- .../customfieldcreatecheckboxmetadata.md | 2 +- .../customfieldcreatecheckboxtype.md | 15 - .../components/customfieldcreatedate.md | 2 +- .../customfieldcreatedatemetadata.md | 2 +- .../components/customfieldcreatedatetype.md | 15 - .../components/customfieldcreatenumber.md | 2 +- .../customfieldcreatenumbermetadata.md | 2 +- .../components/customfieldcreatenumbertype.md | 15 - .../components/customfieldcreateselect.md | 2 +- .../customfieldcreateselectmetadata.md | 2 +- .../components/customfieldcreateselecttype.md | 15 - .../components/customfieldcreatetext.md | 2 +- .../customfieldcreatetextmetadata.md | 2 +- .../components/customfieldcreatetexttype.md | 15 - docs/models/components/customfielddate.md | 6 +- docs/models/components/customfielddatetype.md | 15 - docs/models/components/customfieldnumber.md | 6 +- .../components/customfieldnumbertype.md | 15 - docs/models/components/customfieldselect.md | 6 +- .../components/customfieldselecttype.md | 15 - .../components/customfieldsortproperty.md | 2 +- docs/models/components/customfieldtext.md | 6 +- docs/models/components/customfieldtexttype.md | 15 - .../components/customfieldupdatecheckbox.md | 2 +- .../customfieldupdatecheckboxmetadata.md | 2 +- .../customfieldupdatecheckboxtype.md | 15 - .../components/customfieldupdatedate.md | 2 +- .../customfieldupdatedatemetadata.md | 2 +- .../components/customfieldupdatedatetype.md | 15 - .../components/customfieldupdatenumber.md | 2 +- .../customfieldupdatenumbermetadata.md | 2 +- .../components/customfieldupdatenumbertype.md | 15 - .../components/customfieldupdateselect.md | 2 +- .../customfieldupdateselectmetadata.md | 2 +- .../components/customfieldupdateselecttype.md | 15 - .../components/customfieldupdatetext.md | 2 +- .../customfieldupdatetextmetadata.md | 2 +- .../components/customfieldupdatetexttype.md | 15 - docs/models/components/discount.md | 110 +++---- docs/models/components/discountcreate.md | 24 +- .../discountfixedonceforeverduration.md | 24 +- .../discountfixedonceforeverdurationbase.md | 8 +- .../discountfixedonceforeverdurationcreate.md | 4 +- ...tfixedonceforeverdurationcreatemetadata.md | 2 +- ...iscountfixedonceforeverdurationmetadata.md | 2 +- .../components/discountfixedrepeatduration.md | 31 +- .../discountfixedrepeatdurationbase.md | 8 +- .../discountfixedrepeatdurationcreate.md | 6 +- ...scountfixedrepeatdurationcreatemetadata.md | 2 +- .../discountfixedrepeatdurationmetadata.md | 2 +- .../discountpercentageonceforeverduration.md | 26 +- ...scountpercentageonceforeverdurationbase.md | 8 +- ...ountpercentageonceforeverdurationcreate.md | 4 +- ...entageonceforeverdurationcreatemetadata.md | 2 +- ...ntpercentageonceforeverdurationmetadata.md | 2 +- .../discountpercentagerepeatduration.md | 27 +- .../discountpercentagerepeatdurationbase.md | 8 +- .../discountpercentagerepeatdurationcreate.md | 6 +- ...tpercentagerepeatdurationcreatemetadata.md | 2 +- ...iscountpercentagerepeatdurationmetadata.md | 2 +- docs/models/components/discountproduct.md | 6 +- .../models/components/discountsortproperty.md | 2 +- .../components/discountupdatemetadata.md | 2 +- .../components/downloadablefilecreate.md | 28 +- .../downloadablefilecreateservice.md | 15 - .../models/components/downloadablefileread.md | 44 +-- .../components/downloadablefilereadservice.md | 15 - docs/models/components/downloadableread.md | 12 +- .../models/components/externalorganization.md | 1 + docs/models/components/filecreate.md | 24 +- docs/models/components/filedownload.md | 10 +- docs/models/components/fileread.md | 28 +- docs/models/components/fileservicetypes.md | 2 +- docs/models/components/fileupload.md | 20 +- docs/models/components/fileuploadcompleted.md | 4 +- docs/models/components/granttype.md | 15 - docs/models/components/granttypes.md | 2 +- docs/models/components/interval.md | 2 +- .../components/introspecttokenresponse.md | 30 +- .../introspecttokenresponsetokentype.md | 15 - docs/models/components/issue.md | 9 +- .../components/licensekeyactivationbase.md | 4 +- .../components/licensekeyactivationread.md | 30 +- docs/models/components/licensekeycustomer.md | 12 +- .../components/licensekeycustomermetadata.md | 2 +- .../components/licensekeycustomertaxid.md | 2 +- docs/models/components/licensekeyread.md | 28 +- docs/models/components/licensekeystatus.md | 2 +- docs/models/components/licensekeyuser.md | 2 +- .../components/licensekeywithactivations.md | 34 +- docs/models/components/listresourcebenefit.md | 20 +- .../components/listresourcebenefitgrant.md | 27 +- .../models/components/listresourcecheckout.md | 89 +++--- .../components/listresourcecheckoutlink.md | 74 ++--- .../models/components/listresourcecustomer.md | 18 +- .../listresourcecustomerbenefitgrant.md | 63 +++- .../components/listresourcecustomerorder.md | 92 +++--- .../listresourcecustomersubscription.md | 78 ++--- .../components/listresourcecustomfield.md | 17 +- .../models/components/listresourcediscount.md | 26 +- .../listresourcedownloadableread.md | 12 +- .../listresourceexternalorganization.md | 13 +- .../models/components/listresourcefileread.md | 14 +- .../components/listresourcelicensekeyread.md | 30 +- .../components/listresourceoauth2client.md | 14 +- docs/models/components/listresourceorder.md | 90 +++--- .../components/listresourceorganization.md | 18 +- docs/models/components/listresourceproduct.md | 67 ++-- .../components/listresourcerepository.md | 33 +- .../components/listresourcesubscription.md | 111 ++++--- docs/models/components/metric.md | 4 +- docs/models/components/metricperiod.md | 24 +- docs/models/components/metrics.md | 32 +- .../models/components/metricsintervallimit.md | 2 +- .../components/metricsintervalslimits.md | 10 +- docs/models/components/metricslimits.md | 12 +- docs/models/components/metricsresponse.md | 54 ++-- docs/models/components/metrictype.md | 2 +- docs/models/components/oauth2client.md | 12 +- .../components/oauth2clientconfiguration.md | 4 +- .../oauth2clientconfigurationgranttypes.md | 2 +- .../oauth2clientconfigurationresponsetypes.md | 15 - ...entconfigurationtokenendpointauthmethod.md | 3 +- .../oauth2clientconfigurationupdate.md | 4 +- ...2clientconfigurationupdateresponsetypes.md | 15 - docs/models/components/oauth2clientpublic.md | 12 +- ...componentsauthorizationcodetokenrequest.md | 16 +- ...tokenpostxcomponentsrefreshtokenrequest.md | 12 +- ...xcomponentsrefreshtokenrequestgranttype.md | 16 - docs/models/components/order.md | 36 +-- docs/models/components/ordercustomer.md | 4 +- docs/models/components/orderdiscount.md | 32 +- docs/models/components/orderinvoice.md | 2 +- docs/models/components/orderproduct.md | 4 +- docs/models/components/ordersortproperty.md | 2 +- docs/models/components/ordersubscription.md | 12 +- docs/models/components/organization.md | 4 +- .../organizationavatarfilecreate.md | 28 +- .../organizationavatarfilecreateservice.md | 15 - .../components/organizationavatarfileread.md | 48 +-- .../organizationavatarfilereadservice.md | 15 - .../components/organizationsortproperty.md | 2 +- docs/models/components/pagination.md | 4 +- docs/models/components/pledge.md | 13 +- docs/models/components/prices.md | 2 +- docs/models/components/product.md | 20 +- docs/models/components/productcreate.md | 7 +- .../components/productmediafilecreate.md | 28 +- .../productmediafilecreateservice.md | 15 - .../models/components/productmediafileread.md | 6 +- .../productonetimecreatemetadata.md | 2 +- docs/models/components/productprice.md | 8 +- docs/models/components/productpriceonetime.md | 12 +- .../components/productpriceonetimecustom.md | 30 +- .../productpriceonetimecustomamounttype.md | 15 - .../productpriceonetimecustomcreate.md | 16 +- ...oductpriceonetimecustomcreateamounttype.md | 15 - .../productpriceonetimecustomcreatetype.md | 15 - .../productpriceonetimecustomtype.md | 17 - .../components/productpriceonetimefixed.md | 26 +- .../productpriceonetimefixedamounttype.md | 15 - .../productpriceonetimefixedcreate.md | 14 +- ...roductpriceonetimefixedcreateamounttype.md | 15 - .../productpriceonetimefixedcreatetype.md | 15 - .../productpriceonetimefixedtype.md | 17 - .../components/productpriceonetimefree.md | 22 +- .../productpriceonetimefreeamounttype.md | 15 - .../productpriceonetimefreecreate.md | 8 +- ...productpriceonetimefreecreateamounttype.md | 15 - .../productpriceonetimefreecreatetype.md | 15 - .../components/productpriceonetimefreetype.md | 17 - .../components/productpricerecurring.md | 12 +- .../components/productpricerecurringcustom.md | 32 +- .../productpricerecurringcustomamounttype.md | 15 - .../productpricerecurringcustomtype.md | 17 - .../components/productpricerecurringfixed.md | 8 +- .../productpricerecurringfixedcreate.md | 18 +- ...ductpricerecurringfixedcreateamounttype.md | 15 - .../productpricerecurringfixedcreatetype.md | 15 - .../components/productpricerecurringfree.md | 24 +- .../productpricerecurringfreeamounttype.md | 15 - .../productpricerecurringfreecreate.md | 10 +- ...oductpricerecurringfreecreateamounttype.md | 15 - .../productpricerecurringfreecreatetype.md | 15 - .../productpricerecurringfreetype.md | 17 - .../components/productrecurringcreate.md | 4 +- .../productrecurringcreatemetadata.md | 2 +- .../productrecurringcreateprices.md | 6 +- docs/models/components/productsortproperty.md | 2 +- .../components/productupdatemetadata.md | 2 +- docs/models/components/productupdateprices.md | 6 +- docs/models/components/repository.md | 6 +- .../components/repositorysortproperty.md | 2 +- docs/models/components/responsetypes.md | 15 - docs/models/components/s3downloadurl.md | 4 +- .../components/s3filecreatemultipart.md | 6 +- docs/models/components/s3filecreatepart.md | 6 +- .../components/s3fileuploadcompletedpart.md | 2 +- .../components/s3fileuploadmultipart.md | 12 +- docs/models/components/s3fileuploadpart.md | 10 +- docs/models/components/scope.md | 2 +- docs/models/components/service.md | 15 - docs/models/components/status.md | 15 - docs/models/components/subscription.md | 48 +-- .../models/components/subscriptioncustomer.md | 4 +- .../models/components/subscriptiondiscount.md | 32 +- .../components/subscriptionsortproperty.md | 2 +- docs/models/components/subtype.md | 2 +- .../components/tokenendpointauthmethod.md | 2 +- docs/models/components/tokenresponse.md | 18 +- docs/models/components/tokentype.md | 4 +- docs/models/components/type.md | 17 - docs/models/components/validatedlicensekey.md | 30 +- .../webhookbenefitcreatedpayload.md | 12 +- .../webhookbenefitcreatedpayloadtype.md | 15 - .../webhookbenefitgrantcreatedpayload.md | 43 ++- .../webhookbenefitgrantcreatedpayloadtype.md | 15 - .../webhookbenefitgrantrevokedpayload.md | 42 ++- .../webhookbenefitgrantrevokedpayloadtype.md | 15 - .../webhookbenefitgrantupdatedpayload.md | 46 ++- .../webhookbenefitgrantupdatedpayloadtype.md | 15 - .../webhookbenefitupdatedpayload.md | 12 +- .../webhookbenefitupdatedpayloadtype.md | 15 - .../webhookcheckoutcreatedpayload.md | 39 +-- .../webhookcheckoutcreatedpayloadtype.md | 15 - .../webhookcheckoutupdatedpayload.md | 39 +-- .../webhookcheckoutupdatedpayloadtype.md | 15 - .../components/webhookordercreatedpayload.md | 44 +-- .../webhookordercreatedpayloadtype.md | 15 - .../webhookorganizationupdatedpayload.md | 12 +- .../webhookorganizationupdatedpayloadtype.md | 15 - .../components/webhookpledgecreatedpayload.md | 21 +- .../webhookpledgecreatedpayloadtype.md | 15 - .../components/webhookpledgeupdatedpayload.md | 21 +- .../webhookpledgeupdatedpayloadtype.md | 15 - .../webhookproductcreatedpayload.md | 28 +- .../webhookproductcreatedpayloadtype.md | 15 - .../webhookproductupdatedpayload.md | 28 +- .../webhookproductupdatedpayloadtype.md | 15 - .../webhooksubscriptionactivepayload.md | 56 ++-- .../webhooksubscriptionactivepayloadtype.md | 15 - .../webhooksubscriptioncanceledpayload.md | 56 ++-- .../webhooksubscriptioncanceledpayloadtype.md | 15 - .../webhooksubscriptioncreatedpayload.md | 56 ++-- .../webhooksubscriptioncreatedpayloadtype.md | 15 - .../webhooksubscriptionrevokedpayload.md | 56 ++-- .../webhooksubscriptionrevokedpayloadtype.md | 15 - .../webhooksubscriptionupdatedpayload.md | 56 ++-- .../webhooksubscriptionupdatedpayloadtype.md | 15 - .../errors/alreadycanceledsubscription.md | 8 +- .../alreadycanceledsubscriptionerror.md | 15 - docs/models/errors/errort.md | 15 - docs/models/errors/notpermitted.md | 8 +- docs/models/errors/notpermittederror.md | 15 - docs/models/errors/resourcenotfound.md | 8 +- docs/models/errors/unauthorized.md | 8 +- docs/models/errors/unauthorizederror.md | 15 - .../operations/advertisementslistresponse.md | 16 +- .../operations/benefitsgrantsresponse.md | 31 +- .../models/operations/benefitslistresponse.md | 23 +- .../operations/benefitsupdatebenefitupdate.md | 2 +- .../operations/benefitsupdaterequest.md | 8 +- .../operations/checkoutlinkslistresponse.md | 74 +++-- .../operations/checkoutscustomlistresponse.md | 100 +++--- ...customerportalbenefitgrantslistresponse.md | 64 ++-- ...customerportaldownloadableslistresponse.md | 16 +- .../customerportallicensekeyslistresponse.md | 30 +- ...erslistqueryparamproductpricetypefilter.md | 2 +- .../customerportalorderslistresponse.md | 88 +++--- ...customerportalsubscriptionslistresponse.md | 78 ++--- .../operations/customerslistresponse.md | 18 +- .../operations/customfieldslistresponse.md | 10 +- .../operations/customfieldtypefilter.md | 4 +- .../operations/discountslistresponse.md | 31 +- .../externalorganizationslistresponse.md | 13 +- docs/models/operations/fileslistresponse.md | 13 +- .../filesupdateresponsefilesupdate.md | 28 +- .../models/operations/filesuploadedrequest.md | 4 +- .../filesuploadedresponsefilesuploaded.md | 28 +- .../operations/licensekeyslistresponse.md | 34 +- docs/models/operations/metricsgetrequest.md | 6 +- .../oauth2authorizeresponseoauth2authorize.md | 36 +-- .../operations/oauth2clientslistresponse.md | 14 +- .../oauth2clientsoauth2updateclientrequest.md | 2 +- .../oauth2introspecttokentokentypehint.md | 2 +- .../oauth2requesttokenrequestbody.md | 2 +- docs/models/operations/orderslistresponse.md | 91 +++--- .../operations/organizationslistresponse.md | 18 +- .../operations/productpricetypefilter.md | 2 +- .../models/operations/productslistresponse.md | 60 ++-- .../operations/queryparambenefittypefilter.md | 4 +- .../operations/repositorieslistresponse.md | 32 +- .../operations/subscriptionslistresponse.md | 115 ++++--- docs/models/operations/tokentypehint.md | 2 +- jsr.json | 2 +- package-lock.json | 4 +- package.json | 2 +- src/funcs/advertisementsList.ts | 4 +- src/funcs/benefitsGrants.ts | 4 +- src/funcs/benefitsList.ts | 4 +- src/funcs/checkoutLinksList.ts | 4 +- src/funcs/checkoutsCustomList.ts | 4 +- src/funcs/customFieldsList.ts | 4 +- src/funcs/customerPortalBenefitGrantsList.ts | 4 +- src/funcs/customerPortalDownloadablesList.ts | 4 +- src/funcs/customerPortalLicenseKeysList.ts | 4 +- src/funcs/customerPortalOrdersList.ts | 4 +- src/funcs/customerPortalSubscriptionsList.ts | 4 +- src/funcs/customersList.ts | 4 +- src/funcs/discountsList.ts | 4 +- src/funcs/externalOrganizationsList.ts | 4 +- src/funcs/filesList.ts | 4 +- src/funcs/licenseKeysList.ts | 4 +- src/funcs/oauth2ClientsList.ts | 4 +- src/funcs/ordersList.ts | 4 +- src/funcs/organizationsList.ts | 4 +- src/funcs/productsList.ts | 4 +- src/funcs/repositoriesList.ts | 4 +- src/funcs/subscriptionsList.ts | 4 +- src/lib/config.ts | 6 +- src/lib/security.ts | 2 +- .../authorizeresponseorganization.ts | 34 +- .../components/authorizeresponseuser.ts | 31 +- src/models/components/benefitads.ts | 29 +- src/models/components/benefitadscreate.ts | 29 +- src/models/components/benefitadssubscriber.ts | 31 +- src/models/components/benefitadsupdate.ts | 29 +- src/models/components/benefitcustom.ts | 29 +- src/models/components/benefitcustomcreate.ts | 31 +- .../components/benefitcustomsubscriber.ts | 31 +- src/models/components/benefitcustomupdate.ts | 31 +- src/models/components/benefitdiscord.ts | 29 +- src/models/components/benefitdiscordcreate.ts | 31 +- .../components/benefitdiscordsubscriber.ts | 31 +- src/models/components/benefitdiscordupdate.ts | 31 +- src/models/components/benefitdownloadables.ts | 31 +- .../components/benefitdownloadablescreate.ts | 31 +- .../benefitdownloadablessubscriber.ts | 32 +- .../components/benefitdownloadablesupdate.ts | 31 +- .../components/benefitgithubrepository.ts | 31 +- .../benefitgithubrepositorycreate.ts | 32 +- .../benefitgithubrepositorysubscriber.ts | 34 +- .../benefitgithubrepositoryupdate.ts | 32 +- src/models/components/benefitgrant.ts | 13 + src/models/components/benefitgrantwebhook.ts | 13 + src/models/components/benefitlicensekeys.ts | 29 +- .../components/benefitlicensekeyscreate.ts | 31 +- .../benefitlicensekeyssubscriber.ts | 31 +- .../components/benefitlicensekeysupdate.ts | 31 +- src/models/components/checkout.ts | 13 +- src/models/components/checkoutlink.ts | 13 +- .../components/checkoutlinkpricecreate.ts | 39 +-- .../components/checkoutlinkproductcreate.ts | 39 +-- src/models/components/checkoutpricecreate.ts | 46 --- .../components/checkoutproductcreate.ts | 47 --- src/models/components/checkoutpublic.ts | 13 +- .../components/checkoutpublicconfirmed.ts | 40 +-- .../components/customerbenefitgrantads.ts | 10 + .../customerbenefitgrantadsupdate.ts | 33 +- .../components/customerbenefitgrantcustom.ts | 10 + .../customerbenefitgrantcustomupdate.ts | 33 +- .../components/customerbenefitgrantdiscord.ts | 10 + .../customerbenefitgrantdiscordupdate.ts | 33 +- .../customerbenefitgrantdownloadables.ts | 10 + ...customerbenefitgrantdownloadablesupdate.ts | 33 +- .../customerbenefitgrantgithubrepository.ts | 10 + ...tomerbenefitgrantgithubrepositoryupdate.ts | 37 +-- .../customerbenefitgrantlicensekeys.ts | 10 + .../customerbenefitgrantlicensekeysupdate.ts | 33 +- src/models/components/customersession.ts | 6 + src/models/components/customfieldcheckbox.ts | 31 +- .../components/customfieldcreatecheckbox.ts | 31 +- .../components/customfieldcreatedate.ts | 31 +- .../components/customfieldcreatenumber.ts | 31 +- .../components/customfieldcreateselect.ts | 31 +- .../components/customfieldcreatetext.ts | 31 +- src/models/components/customfielddate.ts | 29 +- src/models/components/customfieldnumber.ts | 29 +- src/models/components/customfieldselect.ts | 29 +- src/models/components/customfieldtext.ts | 29 +- .../components/customfieldupdatecheckbox.ts | 31 +- .../components/customfieldupdatedate.ts | 31 +- .../components/customfieldupdatenumber.ts | 31 +- .../components/customfieldupdateselect.ts | 31 +- .../components/customfieldupdatetext.ts | 31 +- .../components/downloadablefilecreate.ts | 31 +- src/models/components/downloadablefileread.ts | 31 +- src/models/components/externalorganization.ts | 13 +- .../components/introspecttokenresponse.ts | 32 +- src/models/components/issue.ts | 13 +- src/models/components/oauth2client.ts | 32 +- .../components/oauth2clientconfiguration.ts | 39 +-- .../oauth2clientconfigurationupdate.ts | 42 +-- ...componentsauthorizationcodetokenrequest.ts | 29 +- ...tokenpostxcomponentsrefreshtokenrequest.ts | 39 +-- .../organizationavatarfilecreate.ts | 35 +-- .../components/organizationavatarfileread.ts | 34 +- .../components/productmediafilecreate.ts | 31 +- src/models/components/productmediafileread.ts | 27 +- .../components/productpriceonetimecustom.ts | 69 +--- .../productpriceonetimecustomcreate.ts | 65 +--- .../components/productpriceonetimefixed.ts | 68 +--- .../productpriceonetimefixedcreate.ts | 64 +--- .../components/productpriceonetimefree.ts | 68 +--- .../productpriceonetimefreecreate.ts | 64 +--- .../components/productpricerecurringcustom.ts | 70 +---- .../components/productpricerecurringfixed.ts | 60 +--- .../productpricerecurringfixedcreate.ts | 66 +--- .../components/productpricerecurringfree.ts | 69 +--- .../productpricerecurringfreecreate.ts | 65 +--- src/models/components/repository.ts | 13 +- src/models/components/tokenresponse.ts | 27 +- .../webhookbenefitcreatedpayload.ts | 31 +- .../webhookbenefitgrantcreatedpayload.ts | 36 +-- .../webhookbenefitgrantrevokedpayload.ts | 36 +-- .../webhookbenefitgrantupdatedpayload.ts | 36 +-- .../webhookbenefitupdatedpayload.ts | 31 +- .../webhookcheckoutcreatedpayload.ts | 32 +- .../webhookcheckoutupdatedpayload.ts | 32 +- .../components/webhookordercreatedpayload.ts | 31 +- .../webhookorganizationupdatedpayload.ts | 36 +-- .../components/webhookpledgecreatedpayload.ts | 31 +- .../components/webhookpledgeupdatedpayload.ts | 31 +- .../webhookproductcreatedpayload.ts | 31 +- .../webhookproductupdatedpayload.ts | 31 +- .../webhooksubscriptionactivepayload.ts | 36 +-- .../webhooksubscriptioncanceledpayload.ts | 36 +-- .../webhooksubscriptioncreatedpayload.ts | 36 +-- .../webhooksubscriptionrevokedpayload.ts | 36 +-- .../webhooksubscriptionupdatedpayload.ts | 36 +-- .../errors/alreadycanceledsubscription.ts | 31 +- src/models/errors/notpermitted.ts | 29 +- src/models/errors/resourcenotfound.ts | 27 +- src/models/errors/unauthorized.ts | 29 +- tsconfig.json | 2 +- 581 files changed, 4018 insertions(+), 8371 deletions(-) delete mode 100644 docs/models/components/amounttype.md delete mode 100644 docs/models/components/authorizeresponseorganizationsubtype.md delete mode 100644 docs/models/components/authorizeresponseusersubtype.md delete mode 100644 docs/models/components/benefitadscreatetype.md delete mode 100644 docs/models/components/benefitadssubscribertype.md delete mode 100644 docs/models/components/benefitadstype.md delete mode 100644 docs/models/components/benefitadsupdatetype.md delete mode 100644 docs/models/components/benefitcustomcreatetype.md delete mode 100644 docs/models/components/benefitcustomsubscribertype.md delete mode 100644 docs/models/components/benefitcustomtype.md delete mode 100644 docs/models/components/benefitcustomupdatetype.md delete mode 100644 docs/models/components/benefitdiscordcreatetype.md delete mode 100644 docs/models/components/benefitdiscordsubscribertype.md delete mode 100644 docs/models/components/benefitdiscordtype.md delete mode 100644 docs/models/components/benefitdiscordupdatetype.md delete mode 100644 docs/models/components/benefitdownloadablescreatetype.md delete mode 100644 docs/models/components/benefitdownloadablessubscribertype.md delete mode 100644 docs/models/components/benefitdownloadablestype.md delete mode 100644 docs/models/components/benefitdownloadablesupdatetype.md delete mode 100644 docs/models/components/benefitgithubrepositorycreatetype.md delete mode 100644 docs/models/components/benefitgithubrepositorysubscribertype.md delete mode 100644 docs/models/components/benefitgithubrepositorytype.md delete mode 100644 docs/models/components/benefitgithubrepositoryupdatetype.md delete mode 100644 docs/models/components/benefitlicensekeyscreatetype.md delete mode 100644 docs/models/components/benefitlicensekeyssubscribertype.md delete mode 100644 docs/models/components/benefitlicensekeystype.md delete mode 100644 docs/models/components/benefitlicensekeysupdatetype.md delete mode 100644 docs/models/components/checkoutlinkpricecreatepaymentprocessor.md delete mode 100644 docs/models/components/checkoutlinkproductcreatepaymentprocessor.md delete mode 100644 docs/models/components/checkoutpricecreatepaymentprocessor.md delete mode 100644 docs/models/components/checkoutproductcreatepaymentprocessor.md delete mode 100644 docs/models/components/customerbenefitgrantadsupdatebenefittype.md delete mode 100644 docs/models/components/customerbenefitgrantcustomupdatebenefittype.md delete mode 100644 docs/models/components/customerbenefitgrantdiscordupdatebenefittype.md delete mode 100644 docs/models/components/customerbenefitgrantdownloadablesupdatebenefittype.md delete mode 100644 docs/models/components/customerbenefitgrantgithubrepositoryupdatebenefittype.md delete mode 100644 docs/models/components/customerbenefitgrantlicensekeysupdatebenefittype.md delete mode 100644 docs/models/components/customfieldcheckboxtype.md delete mode 100644 docs/models/components/customfieldcreatecheckboxtype.md delete mode 100644 docs/models/components/customfieldcreatedatetype.md delete mode 100644 docs/models/components/customfieldcreatenumbertype.md delete mode 100644 docs/models/components/customfieldcreateselecttype.md delete mode 100644 docs/models/components/customfieldcreatetexttype.md delete mode 100644 docs/models/components/customfielddatetype.md delete mode 100644 docs/models/components/customfieldnumbertype.md delete mode 100644 docs/models/components/customfieldselecttype.md delete mode 100644 docs/models/components/customfieldtexttype.md delete mode 100644 docs/models/components/customfieldupdatecheckboxtype.md delete mode 100644 docs/models/components/customfieldupdatedatetype.md delete mode 100644 docs/models/components/customfieldupdatenumbertype.md delete mode 100644 docs/models/components/customfieldupdateselecttype.md delete mode 100644 docs/models/components/customfieldupdatetexttype.md delete mode 100644 docs/models/components/downloadablefilecreateservice.md delete mode 100644 docs/models/components/downloadablefilereadservice.md delete mode 100644 docs/models/components/granttype.md delete mode 100644 docs/models/components/introspecttokenresponsetokentype.md delete mode 100644 docs/models/components/oauth2clientconfigurationresponsetypes.md delete mode 100644 docs/models/components/oauth2clientconfigurationupdateresponsetypes.md delete mode 100644 docs/models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequestgranttype.md delete mode 100644 docs/models/components/organizationavatarfilecreateservice.md delete mode 100644 docs/models/components/organizationavatarfilereadservice.md delete mode 100644 docs/models/components/productmediafilecreateservice.md delete mode 100644 docs/models/components/productpriceonetimecustomamounttype.md delete mode 100644 docs/models/components/productpriceonetimecustomcreateamounttype.md delete mode 100644 docs/models/components/productpriceonetimecustomcreatetype.md delete mode 100644 docs/models/components/productpriceonetimecustomtype.md delete mode 100644 docs/models/components/productpriceonetimefixedamounttype.md delete mode 100644 docs/models/components/productpriceonetimefixedcreateamounttype.md delete mode 100644 docs/models/components/productpriceonetimefixedcreatetype.md delete mode 100644 docs/models/components/productpriceonetimefixedtype.md delete mode 100644 docs/models/components/productpriceonetimefreeamounttype.md delete mode 100644 docs/models/components/productpriceonetimefreecreateamounttype.md delete mode 100644 docs/models/components/productpriceonetimefreecreatetype.md delete mode 100644 docs/models/components/productpriceonetimefreetype.md delete mode 100644 docs/models/components/productpricerecurringcustomamounttype.md delete mode 100644 docs/models/components/productpricerecurringcustomtype.md delete mode 100644 docs/models/components/productpricerecurringfixedcreateamounttype.md delete mode 100644 docs/models/components/productpricerecurringfixedcreatetype.md delete mode 100644 docs/models/components/productpricerecurringfreeamounttype.md delete mode 100644 docs/models/components/productpricerecurringfreecreateamounttype.md delete mode 100644 docs/models/components/productpricerecurringfreecreatetype.md delete mode 100644 docs/models/components/productpricerecurringfreetype.md delete mode 100644 docs/models/components/responsetypes.md delete mode 100644 docs/models/components/service.md delete mode 100644 docs/models/components/status.md delete mode 100644 docs/models/components/type.md delete mode 100644 docs/models/components/webhookbenefitcreatedpayloadtype.md delete mode 100644 docs/models/components/webhookbenefitgrantcreatedpayloadtype.md delete mode 100644 docs/models/components/webhookbenefitgrantrevokedpayloadtype.md delete mode 100644 docs/models/components/webhookbenefitgrantupdatedpayloadtype.md delete mode 100644 docs/models/components/webhookbenefitupdatedpayloadtype.md delete mode 100644 docs/models/components/webhookcheckoutcreatedpayloadtype.md delete mode 100644 docs/models/components/webhookcheckoutupdatedpayloadtype.md delete mode 100644 docs/models/components/webhookordercreatedpayloadtype.md delete mode 100644 docs/models/components/webhookorganizationupdatedpayloadtype.md delete mode 100644 docs/models/components/webhookpledgecreatedpayloadtype.md delete mode 100644 docs/models/components/webhookpledgeupdatedpayloadtype.md delete mode 100644 docs/models/components/webhookproductcreatedpayloadtype.md delete mode 100644 docs/models/components/webhookproductupdatedpayloadtype.md delete mode 100644 docs/models/components/webhooksubscriptionactivepayloadtype.md delete mode 100644 docs/models/components/webhooksubscriptioncanceledpayloadtype.md delete mode 100644 docs/models/components/webhooksubscriptioncreatedpayloadtype.md delete mode 100644 docs/models/components/webhooksubscriptionrevokedpayloadtype.md delete mode 100644 docs/models/components/webhooksubscriptionupdatedpayloadtype.md delete mode 100644 docs/models/errors/alreadycanceledsubscriptionerror.md delete mode 100644 docs/models/errors/errort.md delete mode 100644 docs/models/errors/notpermittederror.md delete mode 100644 docs/models/errors/unauthorizederror.md diff --git a/.speakeasy/gen.lock b/.speakeasy/gen.lock index 006e137c..72d36d06 100644 --- a/.speakeasy/gen.lock +++ b/.speakeasy/gen.lock @@ -1,12 +1,12 @@ lockVersion: 2.0.0 id: 983150e6-ebc8-43fe-9b18-750461aad344 management: - docChecksum: 509f7f04da4bb45734ebdd8250c8c50d + docChecksum: c3ec889aa8a2bcd07b83f1b4d4b9fe5a docVersion: 0.1.0 - speakeasyVersion: 1.456.1 - generationVersion: 2.481.0 - releaseVersion: 0.19.2 - configChecksum: 196e205096e401a6865ca7e7c1ab93fd + speakeasyVersion: 1.460.3 + generationVersion: 2.484.0 + releaseVersion: 0.20.0 + configChecksum: 189f2b0bfc7d04f770ca90f9ef0993d5 repoURL: https://github.com/polarsource/polar-js.git installationURL: https://github.com/polarsource/polar-js published: true @@ -14,26 +14,26 @@ features: typescript: additionalDependencies: 0.1.0 constsAndDefaults: 0.1.11 - core: 3.18.11 + core: 3.18.12 defaultEnabledRetries: 0.1.0 deprecations: 2.81.1 devContainers: 2.90.0 enumUnions: 0.1.0 envVarSecurityUsage: 0.1.2 - globalSecurity: 2.82.11 + globalSecurity: 2.82.12 globalSecurityCallbacks: 0.1.0 globalSecurityFlattening: 0.1.0 globalServerURLs: 2.82.4 groups: 2.81.2 nameOverrides: 2.81.2 nullables: 0.1.0 - pagination: 2.82.7 + pagination: 2.82.8 responseFormat: 0.2.3 retries: 2.83.0 sdkHooks: 0.2.0 serverIDs: 2.81.2 unions: 2.85.8 - webhooks: 1.2.0 + webhooks: 1.3.0 generatedFiles: - .devcontainer/README.md - .devcontainer/devcontainer.json @@ -50,74 +50,51 @@ generatedFiles: - docs/models/components/advertisementcampaign.md - docs/models/components/advertisementcampaignlistresource.md - docs/models/components/advertisementsortproperty.md - - docs/models/components/amounttype.md - docs/models/components/assignee.md - docs/models/components/attachedcustomfield.md - docs/models/components/attachedcustomfieldcreate.md - docs/models/components/author.md - docs/models/components/authorizeorganization.md - docs/models/components/authorizeresponseorganization.md - - docs/models/components/authorizeresponseorganizationsubtype.md - docs/models/components/authorizeresponseuser.md - - docs/models/components/authorizeresponseusersubtype.md - docs/models/components/authorizeuser.md - docs/models/components/benefit.md - docs/models/components/benefitads.md - docs/models/components/benefitadscreate.md - - docs/models/components/benefitadscreatetype.md - docs/models/components/benefitadsproperties.md - docs/models/components/benefitadssubscriber.md - - docs/models/components/benefitadssubscribertype.md - - docs/models/components/benefitadstype.md - docs/models/components/benefitadsupdate.md - - docs/models/components/benefitadsupdatetype.md - docs/models/components/benefitbase.md - docs/models/components/benefitcreate.md - docs/models/components/benefitcustom.md - docs/models/components/benefitcustomcreate.md - docs/models/components/benefitcustomcreateproperties.md - - docs/models/components/benefitcustomcreatetype.md - docs/models/components/benefitcustomproperties.md - docs/models/components/benefitcustomsubscriber.md - docs/models/components/benefitcustomsubscriberproperties.md - - docs/models/components/benefitcustomsubscribertype.md - - docs/models/components/benefitcustomtype.md - docs/models/components/benefitcustomupdate.md - - docs/models/components/benefitcustomupdatetype.md - docs/models/components/benefitdiscord.md - docs/models/components/benefitdiscordcreate.md - docs/models/components/benefitdiscordcreateproperties.md - - docs/models/components/benefitdiscordcreatetype.md - docs/models/components/benefitdiscordproperties.md - docs/models/components/benefitdiscordsubscriber.md - docs/models/components/benefitdiscordsubscriberproperties.md - - docs/models/components/benefitdiscordsubscribertype.md - - docs/models/components/benefitdiscordtype.md - docs/models/components/benefitdiscordupdate.md - - docs/models/components/benefitdiscordupdatetype.md - docs/models/components/benefitdownloadables.md - docs/models/components/benefitdownloadablescreate.md - docs/models/components/benefitdownloadablescreateproperties.md - - docs/models/components/benefitdownloadablescreatetype.md - docs/models/components/benefitdownloadablesproperties.md - docs/models/components/benefitdownloadablessubscriber.md - docs/models/components/benefitdownloadablessubscriberproperties.md - - docs/models/components/benefitdownloadablessubscribertype.md - - docs/models/components/benefitdownloadablestype.md - docs/models/components/benefitdownloadablesupdate.md - - docs/models/components/benefitdownloadablesupdatetype.md - docs/models/components/benefitgithubrepository.md - docs/models/components/benefitgithubrepositorycreate.md - docs/models/components/benefitgithubrepositorycreateproperties.md - docs/models/components/benefitgithubrepositorycreatepropertiespermission.md - - docs/models/components/benefitgithubrepositorycreatetype.md - docs/models/components/benefitgithubrepositoryproperties.md - docs/models/components/benefitgithubrepositorysubscriber.md - docs/models/components/benefitgithubrepositorysubscriberproperties.md - - docs/models/components/benefitgithubrepositorysubscribertype.md - - docs/models/components/benefitgithubrepositorytype.md - docs/models/components/benefitgithubrepositoryupdate.md - - docs/models/components/benefitgithubrepositoryupdatetype.md - docs/models/components/benefitgrant.md - docs/models/components/benefitgrantadsproperties.md - docs/models/components/benefitgrantcustomproperties.md @@ -133,14 +110,10 @@ generatedFiles: - docs/models/components/benefitlicensekeys.md - docs/models/components/benefitlicensekeyscreate.md - docs/models/components/benefitlicensekeyscreateproperties.md - - docs/models/components/benefitlicensekeyscreatetype.md - docs/models/components/benefitlicensekeysproperties.md - docs/models/components/benefitlicensekeyssubscriber.md - docs/models/components/benefitlicensekeyssubscriberproperties.md - - docs/models/components/benefitlicensekeyssubscribertype.md - - docs/models/components/benefitlicensekeystype.md - docs/models/components/benefitlicensekeysupdate.md - - docs/models/components/benefitlicensekeysupdatetype.md - docs/models/components/benefittype.md - docs/models/components/checkout.md - docs/models/components/checkoutconfirmstripe.md @@ -160,11 +133,9 @@ generatedFiles: - docs/models/components/checkoutlinkmetadata.md - docs/models/components/checkoutlinkpricecreate.md - docs/models/components/checkoutlinkpricecreatemetadata.md - - docs/models/components/checkoutlinkpricecreatepaymentprocessor.md - docs/models/components/checkoutlinkproduct.md - docs/models/components/checkoutlinkproductcreate.md - docs/models/components/checkoutlinkproductcreatemetadata.md - - docs/models/components/checkoutlinkproductcreatepaymentprocessor.md - docs/models/components/checkoutlinksortproperty.md - docs/models/components/checkoutlinkupdate.md - docs/models/components/checkoutlinkupdatemetadata.md @@ -173,13 +144,11 @@ generatedFiles: - docs/models/components/checkoutpricecreatecustomermetadata.md - docs/models/components/checkoutpricecreatecustomfielddata.md - docs/models/components/checkoutpricecreatemetadata.md - - docs/models/components/checkoutpricecreatepaymentprocessor.md - docs/models/components/checkoutproduct.md - docs/models/components/checkoutproductcreate.md - docs/models/components/checkoutproductcreatecustomermetadata.md - docs/models/components/checkoutproductcreatecustomfielddata.md - docs/models/components/checkoutproductcreatemetadata.md - - docs/models/components/checkoutproductcreatepaymentprocessor.md - docs/models/components/checkoutpublic.md - docs/models/components/checkoutpublicconfirmed.md - docs/models/components/checkoutpublicconfirmedcustomfielddata.md @@ -201,24 +170,18 @@ generatedFiles: - docs/models/components/customerbenefitgrant.md - docs/models/components/customerbenefitgrantads.md - docs/models/components/customerbenefitgrantadsupdate.md - - docs/models/components/customerbenefitgrantadsupdatebenefittype.md - docs/models/components/customerbenefitgrantcustom.md - docs/models/components/customerbenefitgrantcustomupdate.md - - docs/models/components/customerbenefitgrantcustomupdatebenefittype.md - docs/models/components/customerbenefitgrantdiscord.md - docs/models/components/customerbenefitgrantdiscordpropertiesupdate.md - docs/models/components/customerbenefitgrantdiscordupdate.md - - docs/models/components/customerbenefitgrantdiscordupdatebenefittype.md - docs/models/components/customerbenefitgrantdownloadables.md - docs/models/components/customerbenefitgrantdownloadablesupdate.md - - docs/models/components/customerbenefitgrantdownloadablesupdatebenefittype.md - docs/models/components/customerbenefitgrantgithubrepository.md - docs/models/components/customerbenefitgrantgithubrepositorypropertiesupdate.md - docs/models/components/customerbenefitgrantgithubrepositoryupdate.md - - docs/models/components/customerbenefitgrantgithubrepositoryupdatebenefittype.md - docs/models/components/customerbenefitgrantlicensekeys.md - docs/models/components/customerbenefitgrantlicensekeysupdate.md - - docs/models/components/customerbenefitgrantlicensekeysupdatebenefittype.md - docs/models/components/customerbenefitgrantsortproperty.md - docs/models/components/customerbenefitgrantupdate.md - docs/models/components/customercreate.md @@ -247,59 +210,44 @@ generatedFiles: - docs/models/components/customfieldcheckbox.md - docs/models/components/customfieldcheckboxmetadata.md - docs/models/components/customfieldcheckboxproperties.md - - docs/models/components/customfieldcheckboxtype.md - docs/models/components/customfieldcreate.md - docs/models/components/customfieldcreatecheckbox.md - docs/models/components/customfieldcreatecheckboxmetadata.md - - docs/models/components/customfieldcreatecheckboxtype.md - docs/models/components/customfieldcreatedate.md - docs/models/components/customfieldcreatedatemetadata.md - - docs/models/components/customfieldcreatedatetype.md - docs/models/components/customfieldcreatenumber.md - docs/models/components/customfieldcreatenumbermetadata.md - - docs/models/components/customfieldcreatenumbertype.md - docs/models/components/customfieldcreateselect.md - docs/models/components/customfieldcreateselectmetadata.md - - docs/models/components/customfieldcreateselecttype.md - docs/models/components/customfieldcreatetext.md - docs/models/components/customfieldcreatetextmetadata.md - - docs/models/components/customfieldcreatetexttype.md - docs/models/components/customfielddata.md - docs/models/components/customfielddate.md - docs/models/components/customfielddatemetadata.md - docs/models/components/customfielddateproperties.md - - docs/models/components/customfielddatetype.md - docs/models/components/customfieldnumber.md - docs/models/components/customfieldnumbermetadata.md - docs/models/components/customfieldnumberproperties.md - - docs/models/components/customfieldnumbertype.md - docs/models/components/customfieldselect.md - docs/models/components/customfieldselectmetadata.md - docs/models/components/customfieldselectoption.md - docs/models/components/customfieldselectproperties.md - - docs/models/components/customfieldselecttype.md - docs/models/components/customfieldsortproperty.md - docs/models/components/customfieldtext.md - docs/models/components/customfieldtextmetadata.md - docs/models/components/customfieldtextproperties.md - - docs/models/components/customfieldtexttype.md - docs/models/components/customfieldtype.md - docs/models/components/customfieldupdate.md - docs/models/components/customfieldupdatecheckbox.md - docs/models/components/customfieldupdatecheckboxmetadata.md - - docs/models/components/customfieldupdatecheckboxtype.md - docs/models/components/customfieldupdatedate.md - docs/models/components/customfieldupdatedatemetadata.md - - docs/models/components/customfieldupdatedatetype.md - docs/models/components/customfieldupdatenumber.md - docs/models/components/customfieldupdatenumbermetadata.md - - docs/models/components/customfieldupdatenumbertype.md - docs/models/components/customfieldupdateselect.md - docs/models/components/customfieldupdateselectmetadata.md - - docs/models/components/customfieldupdateselecttype.md - docs/models/components/customfieldupdatetext.md - docs/models/components/customfieldupdatetextmetadata.md - - docs/models/components/customfieldupdatetexttype.md - docs/models/components/discount.md - docs/models/components/discountcreate.md - docs/models/components/discountduration.md @@ -333,9 +281,7 @@ generatedFiles: - docs/models/components/discountupdate.md - docs/models/components/discountupdatemetadata.md - docs/models/components/downloadablefilecreate.md - - docs/models/components/downloadablefilecreateservice.md - docs/models/components/downloadablefileread.md - - docs/models/components/downloadablefilereadservice.md - docs/models/components/downloadableread.md - docs/models/components/existingproductprice.md - docs/models/components/externalorganization.md @@ -348,11 +294,9 @@ generatedFiles: - docs/models/components/fileupload.md - docs/models/components/fileuploadcompleted.md - docs/models/components/funding.md - - docs/models/components/granttype.md - docs/models/components/granttypes.md - docs/models/components/interval.md - docs/models/components/introspecttokenresponse.md - - docs/models/components/introspecttokenresponsetokentype.md - docs/models/components/issue.md - docs/models/components/label.md - docs/models/components/licensekeyactivate.md @@ -405,16 +349,13 @@ generatedFiles: - docs/models/components/oauth2client.md - docs/models/components/oauth2clientconfiguration.md - docs/models/components/oauth2clientconfigurationgranttypes.md - - docs/models/components/oauth2clientconfigurationresponsetypes.md - docs/models/components/oauth2clientconfigurationtokenendpointauthmethod.md - docs/models/components/oauth2clientconfigurationupdate.md - docs/models/components/oauth2clientconfigurationupdategranttypes.md - - docs/models/components/oauth2clientconfigurationupdateresponsetypes.md - docs/models/components/oauth2clientconfigurationupdatetokenendpointauthmethod.md - docs/models/components/oauth2clientpublic.md - docs/models/components/onev11oauth21tokenpostxcomponentsauthorizationcodetokenrequest.md - docs/models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequest.md - - docs/models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequestgranttype.md - docs/models/components/order.md - docs/models/components/orderbillingreason.md - docs/models/components/ordercustomer.md @@ -431,9 +372,7 @@ generatedFiles: - docs/models/components/orderuser.md - docs/models/components/organization.md - docs/models/components/organizationavatarfilecreate.md - - docs/models/components/organizationavatarfilecreateservice.md - docs/models/components/organizationavatarfileread.md - - docs/models/components/organizationavatarfilereadservice.md - docs/models/components/organizationcreate.md - docs/models/components/organizationfeaturesettings.md - docs/models/components/organizationprofilesettings.md @@ -455,7 +394,6 @@ generatedFiles: - docs/models/components/productbenefitsupdate.md - docs/models/components/productcreate.md - docs/models/components/productmediafilecreate.md - - docs/models/components/productmediafilecreateservice.md - docs/models/components/productmediafileread.md - docs/models/components/productmetadata.md - docs/models/components/productonetimecreate.md @@ -463,37 +401,17 @@ generatedFiles: - docs/models/components/productprice.md - docs/models/components/productpriceonetime.md - docs/models/components/productpriceonetimecustom.md - - docs/models/components/productpriceonetimecustomamounttype.md - docs/models/components/productpriceonetimecustomcreate.md - - docs/models/components/productpriceonetimecustomcreateamounttype.md - - docs/models/components/productpriceonetimecustomcreatetype.md - - docs/models/components/productpriceonetimecustomtype.md - docs/models/components/productpriceonetimefixed.md - - docs/models/components/productpriceonetimefixedamounttype.md - docs/models/components/productpriceonetimefixedcreate.md - - docs/models/components/productpriceonetimefixedcreateamounttype.md - - docs/models/components/productpriceonetimefixedcreatetype.md - - docs/models/components/productpriceonetimefixedtype.md - docs/models/components/productpriceonetimefree.md - - docs/models/components/productpriceonetimefreeamounttype.md - docs/models/components/productpriceonetimefreecreate.md - - docs/models/components/productpriceonetimefreecreateamounttype.md - - docs/models/components/productpriceonetimefreecreatetype.md - - docs/models/components/productpriceonetimefreetype.md - docs/models/components/productpricerecurring.md - docs/models/components/productpricerecurringcustom.md - - docs/models/components/productpricerecurringcustomamounttype.md - - docs/models/components/productpricerecurringcustomtype.md - docs/models/components/productpricerecurringfixed.md - docs/models/components/productpricerecurringfixedcreate.md - - docs/models/components/productpricerecurringfixedcreateamounttype.md - - docs/models/components/productpricerecurringfixedcreatetype.md - docs/models/components/productpricerecurringfree.md - - docs/models/components/productpricerecurringfreeamounttype.md - docs/models/components/productpricerecurringfreecreate.md - - docs/models/components/productpricerecurringfreecreateamounttype.md - - docs/models/components/productpricerecurringfreecreatetype.md - - docs/models/components/productpricerecurringfreetype.md - docs/models/components/productpricetype.md - docs/models/components/productrecurringcreate.md - docs/models/components/productrecurringcreatemetadata.md @@ -509,7 +427,6 @@ generatedFiles: - docs/models/components/repositoryprofilesettingsupdate.md - docs/models/components/repositorysortproperty.md - docs/models/components/repositoryupdate.md - - docs/models/components/responsetypes.md - docs/models/components/revoketokenresponse.md - docs/models/components/s3downloadurl.md - docs/models/components/s3filecreatemultipart.md @@ -519,9 +436,7 @@ generatedFiles: - docs/models/components/s3fileuploadpart.md - docs/models/components/scope.md - docs/models/components/security.md - - docs/models/components/service.md - docs/models/components/state.md - - docs/models/components/status.md - docs/models/components/subscription.md - docs/models/components/subscriptioncustomer.md - docs/models/components/subscriptioncustomermetadata.md @@ -538,56 +453,33 @@ generatedFiles: - docs/models/components/tokenendpointauthmethod.md - docs/models/components/tokenresponse.md - docs/models/components/tokentype.md - - docs/models/components/type.md - docs/models/components/userinfoorganization.md - docs/models/components/userinfouser.md - docs/models/components/validatedlicensekey.md - docs/models/components/validationerror.md - docs/models/components/webhookbenefitcreatedpayload.md - - docs/models/components/webhookbenefitcreatedpayloadtype.md - docs/models/components/webhookbenefitgrantcreatedpayload.md - - docs/models/components/webhookbenefitgrantcreatedpayloadtype.md - docs/models/components/webhookbenefitgrantrevokedpayload.md - - docs/models/components/webhookbenefitgrantrevokedpayloadtype.md - docs/models/components/webhookbenefitgrantupdatedpayload.md - - docs/models/components/webhookbenefitgrantupdatedpayloadtype.md - docs/models/components/webhookbenefitupdatedpayload.md - - docs/models/components/webhookbenefitupdatedpayloadtype.md - docs/models/components/webhookcheckoutcreatedpayload.md - - docs/models/components/webhookcheckoutcreatedpayloadtype.md - docs/models/components/webhookcheckoutupdatedpayload.md - - docs/models/components/webhookcheckoutupdatedpayloadtype.md - docs/models/components/webhookordercreatedpayload.md - - docs/models/components/webhookordercreatedpayloadtype.md - docs/models/components/webhookorganizationupdatedpayload.md - - docs/models/components/webhookorganizationupdatedpayloadtype.md - docs/models/components/webhookpledgecreatedpayload.md - - docs/models/components/webhookpledgecreatedpayloadtype.md - docs/models/components/webhookpledgeupdatedpayload.md - - docs/models/components/webhookpledgeupdatedpayloadtype.md - docs/models/components/webhookproductcreatedpayload.md - - docs/models/components/webhookproductcreatedpayloadtype.md - docs/models/components/webhookproductupdatedpayload.md - - docs/models/components/webhookproductupdatedpayloadtype.md - docs/models/components/webhooksubscriptionactivepayload.md - - docs/models/components/webhooksubscriptionactivepayloadtype.md - docs/models/components/webhooksubscriptioncanceledpayload.md - - docs/models/components/webhooksubscriptioncanceledpayloadtype.md - docs/models/components/webhooksubscriptioncreatedpayload.md - - docs/models/components/webhooksubscriptioncreatedpayloadtype.md - docs/models/components/webhooksubscriptionrevokedpayload.md - - docs/models/components/webhooksubscriptionrevokedpayloadtype.md - docs/models/components/webhooksubscriptionupdatedpayload.md - - docs/models/components/webhooksubscriptionupdatedpayloadtype.md - docs/models/errors/alreadycanceledsubscription.md - - docs/models/errors/alreadycanceledsubscriptionerror.md - - docs/models/errors/errort.md - docs/models/errors/httpvalidationerror.md - docs/models/errors/notpermitted.md - - docs/models/errors/notpermittederror.md - docs/models/errors/resourcenotfound.md - docs/models/errors/unauthorized.md - - docs/models/errors/unauthorizederror.md - docs/models/operations/advertisementsgetrequest.md - docs/models/operations/advertisementslistrequest.md - docs/models/operations/advertisementslistresponse.md @@ -1603,7 +1495,7 @@ examples: id: "" responses: "200": - application/json: {"id": "b18d8d81-fd7b-4764-a31e-475cb1f36591", "is_private": false, "name": "MyOrg", "description": "Optional reciprocal projection", "stars": 1337, "license": "", "homepage": "", "organization": {"id": "c65bc928-1545-452e-b0c0-48b8c2b5ed5f", "name": "", "avatar_url": "", "is_personal": true, "bio": "", "pretty_name": "", "company": "Windler, Bahringer and Kilback", "blog": "", "location": "", "email": "Herbert14@hotmail.com", "twitter_username": "", "organization_id": ""}, "internal_organization": {"created_at": "2024-02-07T13:54:48.821Z", "modified_at": "2023-09-05T11:33:52.011Z", "id": "", "name": "", "slug": "", "avatar_url": "https://misguided-violin.info", "bio": "", "company": "Gislason Group", "blog": "", "location": "", "email": "Ian.Block31@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 552582, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 380699}} + application/json: {"id": "b18d8d81-fd7b-4764-a31e-475cb1f36591", "platform": "github", "is_private": false, "name": "MyOrg", "description": "Optional reciprocal projection", "stars": 1337, "license": "", "homepage": "", "organization": {"id": "c65bc928-1545-452e-b0c0-48b8c2b5ed5f", "platform": "github", "name": "", "avatar_url": "", "is_personal": true, "bio": "", "pretty_name": "", "company": "Windler, Bahringer and Kilback", "blog": "", "location": "", "email": "Herbert14@hotmail.com", "twitter_username": "", "organization_id": ""}, "internal_organization": {"created_at": "2024-02-07T13:54:48.821Z", "modified_at": "2023-09-05T11:33:52.011Z", "id": "", "name": "", "slug": "", "avatar_url": "https://misguided-violin.info", "bio": "", "company": "Gislason Group", "blog": "", "location": "", "email": "Ian.Block31@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 552582, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 380699}} "404": application/json: {"detail": ""} "422": @@ -1615,7 +1507,7 @@ examples: id: "" responses: "200": - application/json: {"id": "d0905bf4-aa77-4f20-8e77-54c352acfe54", "is_private": true, "name": "MyOrg", "description": "Multi-lateral grid-enabled product", "stars": 1337, "license": "", "homepage": "", "organization": {"id": "abf6805c-5ca7-4187-9435-5ad7d4e1b584", "name": "", "avatar_url": "", "is_personal": false, "bio": "", "pretty_name": "", "company": "Lubowitz - Wiza", "blog": "", "location": "", "email": "Reta_Larkin@yahoo.com", "twitter_username": "", "organization_id": ""}, "internal_organization": {"created_at": "2024-07-28T19:04:48.565Z", "modified_at": "2023-10-17T10:52:42.015Z", "id": "", "name": "", "slug": "", "avatar_url": "https://yearly-order.info/", "bio": "", "company": "Becker, Treutel and King", "blog": "", "location": "", "email": "Delphia_Schamberger@gmail.com", "twitter_username": "", "pledge_minimum_amount": 771203, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 404265}} + application/json: {"id": "d0905bf4-aa77-4f20-8e77-54c352acfe54", "platform": "github", "is_private": true, "name": "MyOrg", "description": "Multi-lateral grid-enabled product", "stars": 1337, "license": "", "homepage": "", "organization": {"id": "abf6805c-5ca7-4187-9435-5ad7d4e1b584", "platform": "github", "name": "", "avatar_url": "", "is_personal": false, "bio": "", "pretty_name": "", "company": "Lubowitz - Wiza", "blog": "", "location": "", "email": "Reta_Larkin@yahoo.com", "twitter_username": "", "organization_id": ""}, "internal_organization": {"created_at": "2024-07-28T19:04:48.565Z", "modified_at": "2023-10-17T10:52:42.015Z", "id": "", "name": "", "slug": "", "avatar_url": "https://yearly-order.info/", "bio": "", "company": "Becker, Treutel and King", "blog": "", "location": "", "email": "Delphia_Schamberger@gmail.com", "twitter_username": "", "pledge_minimum_amount": 771203, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 404265}} "403": application/json: {"detail": ""} "404": @@ -1889,7 +1781,7 @@ examples: application/json: {"description": "delightfully fumigate convection though zowie up bulky electronics", "properties": {"guild_token": "", "role_id": ""}} responses: "201": - application/json: {"created_at": "2023-07-24T05:13:02.679Z", "modified_at": "2022-12-24T06:50:18.755Z", "id": "", "description": "while till lazily than clear-cut whoever", "selectable": false, "deletable": false, "organization_id": "", "properties": {"repository_owner": "polarsource", "repository_name": "private_repo", "permission": "admin"}} + application/json: {"created_at": "2024-07-23T05:13:02.679Z", "modified_at": "2023-12-24T06:50:18.755Z", "id": "", "description": "while till lazily than clear-cut whoever", "selectable": false, "deletable": false, "organization_id": "", "properties": {"repository_owner": "polarsource", "repository_name": "private_repo", "permission": "admin"}} "422": application/json: {} benefits:get: @@ -1899,7 +1791,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2023-09-05T11:33:52.011Z", "modified_at": "2023-08-20T11:11:04.610Z", "id": "", "description": "hundred whereas dimly unused cone restructure gadzooks", "selectable": false, "deletable": false, "organization_id": "", "properties": {"archived": {"key": true, "key1": false, "key2": true}, "files": []}} + application/json: {"created_at": "2024-09-04T11:33:52.011Z", "modified_at": "2024-08-19T11:11:04.610Z", "id": "", "description": "hundred whereas dimly unused cone restructure gadzooks", "selectable": false, "deletable": false, "organization_id": "", "properties": {"archived": {"key": true, "key1": false, "key2": true}, "files": []}} "404": application/json: {"detail": ""} "422": @@ -1911,7 +1803,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2023-01-13T16:52:57.274Z", "modified_at": "2024-12-22T15:27:45.882Z", "id": "", "description": "hence reconstitute amid miserable daintily certainly yak surprised", "selectable": false, "deletable": true, "organization_id": "", "properties": {"repository_owner": "polarsource", "repository_name": "private_repo", "permission": "maintain"}} + application/json: {"created_at": "2024-01-13T16:52:57.274Z", "modified_at": "2025-12-22T15:27:45.882Z", "id": "", "description": "hence reconstitute amid miserable daintily certainly yak surprised", "selectable": false, "deletable": true, "organization_id": "", "properties": {"repository_owner": "polarsource", "repository_name": "private_repo", "permission": "maintain"}} "403": application/json: {"detail": ""} "404": @@ -1969,7 +1861,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2024-02-07T13:54:48.780Z", "modified_at": "2022-04-09T17:04:24.706Z", "id": "", "name": "", "description": "Optional static intranet", "is_recurring": false, "is_archived": true, "organization_id": "", "metadata": {"key": 544221, "key1": 969961}, "prices": [], "benefits": [], "medias": [], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2023-09-05T11:33:52.011Z", "modified_at": "2023-08-20T11:11:04.610Z", "id": "", "metadata": {"key": true, "key1": 262795}, "slug": "", "name": "", "organization_id": "", "properties": {"options": []}}, "order": 458049, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2023-04-26T04:53:50.189Z", "modified_at": "2024-05-28T07:17:57.134Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 801373, "required": true}]} + application/json: {"created_at": "2024-02-07T13:54:48.780Z", "modified_at": "2022-04-09T17:04:24.706Z", "id": "", "name": "", "description": "Optional static intranet", "is_recurring": false, "is_archived": true, "organization_id": "", "metadata": {"key": 544221, "key1": 969961}, "prices": [], "benefits": [], "medias": [], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-09-04T11:33:52.011Z", "modified_at": "2024-08-19T11:11:04.610Z", "id": "", "metadata": {"key": true, "key1": 262795}, "slug": "", "name": "", "organization_id": "", "properties": {"options": []}}, "order": 458049, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2024-04-25T04:53:50.189Z", "modified_at": "2025-05-28T07:17:57.134Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 801373, "required": true}]} "404": application/json: {"detail": ""} "422": @@ -1981,7 +1873,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2024-07-28T19:04:48.900Z", "modified_at": "2022-01-27T21:53:39.052Z", "id": "", "name": "", "description": "Persistent 24/7 focus group", "is_recurring": true, "is_archived": false, "organization_id": "", "metadata": {"key": 344620, "key1": false, "key2": 984008}, "prices": [], "benefits": [], "medias": [], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-12-22T15:27:45.882Z", "modified_at": "2023-11-19T22:44:58.301Z", "id": "", "metadata": {"key": true}, "slug": "", "name": "", "organization_id": ""}, "order": 488852, "required": false}, {"custom_field_id": "", "custom_field": {"created_at": "2023-05-05T18:16:40.936Z", "modified_at": "2022-12-08T09:52:54.805Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 249440, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2024-05-15T01:05:20.251Z", "modified_at": "2024-09-02T06:16:41.919Z", "id": "", "metadata": {"key": 771203}, "slug": "", "name": "", "organization_id": ""}, "order": 693508, "required": true}]} + application/json: {"created_at": "2024-07-28T19:04:48.900Z", "modified_at": "2022-01-27T21:53:39.052Z", "id": "", "name": "", "description": "Persistent 24/7 focus group", "is_recurring": true, "is_archived": false, "organization_id": "", "metadata": {"key": 344620, "key1": false, "key2": 984008}, "prices": [], "benefits": [], "medias": [], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2025-12-22T15:27:45.882Z", "modified_at": "2024-11-18T22:44:58.301Z", "id": "", "metadata": {"key": true}, "slug": "", "name": "", "organization_id": ""}, "order": 488852, "required": false}, {"custom_field_id": "", "custom_field": {"created_at": "2024-05-04T18:16:40.936Z", "modified_at": "2023-12-08T09:52:54.805Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 249440, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2025-05-15T01:05:20.251Z", "modified_at": "2025-09-02T06:16:41.919Z", "id": "", "metadata": {"key": 771203}, "slug": "", "name": "", "organization_id": ""}, "order": 693508, "required": true}]} "403": application/json: {"detail": ""} "404": @@ -1997,7 +1889,7 @@ examples: application/json: {"benefits": []} responses: "200": - application/json: {"created_at": "2023-02-17T23:13:10.706Z", "modified_at": "2024-10-03T16:30:23.323Z", "id": "", "name": "", "description": "Intuitive object-oriented parallelism", "is_recurring": false, "is_archived": true, "organization_id": "", "metadata": {"key": 724966}, "prices": [], "benefits": [], "medias": [], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2023-03-21T10:54:06.081Z", "modified_at": "2024-03-05T13:29:26.777Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 176757, "required": false}]} + application/json: {"created_at": "2023-02-17T23:13:10.706Z", "modified_at": "2024-10-03T16:30:23.323Z", "id": "", "name": "", "description": "Intuitive object-oriented parallelism", "is_recurring": false, "is_archived": true, "organization_id": "", "metadata": {"key": 724966}, "prices": [], "benefits": [], "medias": [], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-03-20T10:54:06.081Z", "modified_at": "2025-03-05T13:29:26.777Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 176757, "required": false}]} "403": application/json: {"detail": ""} "404": @@ -2018,7 +1910,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2024-02-07T13:54:48.780Z", "modified_at": "2022-04-09T17:04:24.706Z", "id": "", "metadata": {"key": "", "key1": ""}, "amount": 558834, "tax_amount": 844199, "currency": "Ouguiya", "billing_reason": "subscription_cycle", "billing_address": {"country": "Peru"}, "customer_id": "", "product_id": "", "product_price_id": "", "discount_id": "", "subscription_id": "", "checkout_id": "", "customer": {"created_at": "2024-02-07T13:54:48.821Z", "modified_at": "2023-09-05T11:33:52.011Z", "id": "", "metadata": {"key": 969961, "key1": 450824}, "email": "Creola_Kessler7@gmail.com", "email_verified": true, "name": "", "billing_address": {"country": "Benin"}, "tax_id": ["eu_vat", "mx_rfc"], "organization_id": "", "avatar_url": "https://glorious-fellow.biz"}, "user_id": "", "user": {"id": "", "email": "Jovanny_Block45@hotmail.com", "public_name": ""}, "product": {"created_at": "2024-03-16T20:58:20.526Z", "modified_at": "2023-05-10T02:28:23.859Z", "id": "", "name": "", "description": "Inverse demand-driven superstructure", "is_recurring": true, "is_archived": true, "organization_id": ""}, "product_price": {"created_at": "2023-08-20T11:11:04.610Z", "modified_at": "2023-07-26T06:33:15.810Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 458049, "maximum_amount": 450824, "preset_amount": 262795}, "discount": {"duration": "repeating", "type": "fixed", "amount": 801373, "currency": "Taka", "created_at": "2022-08-30T01:43:46.030Z", "modified_at": "2022-12-10T13:21:20.945Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2023-08-29T15:06:35.685Z", "ends_at": "2024-06-02T05:45:06.910Z", "max_redemptions": 380699, "redemptions_count": 746585, "organization_id": ""}, "subscription": {"metadata": {"key": "", "key1": "", "key2": ""}, "created_at": "2024-12-06T14:08:11.458Z", "modified_at": "2022-08-30T01:43:46.083Z", "id": "", "amount": 521235, "currency": "Bulgarian Lev", "recurring_interval": "year", "status": "trialing", "current_period_start": "2022-12-10T13:21:21.114Z", "current_period_end": "2023-09-21T05:37:11.740Z", "cancel_at_period_end": true, "started_at": "2023-01-14T09:14:56.629Z", "ended_at": "2023-08-29T15:06:35.313Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": ""}} + application/json: {"created_at": "2024-02-07T13:54:48.780Z", "modified_at": "2022-04-09T17:04:24.706Z", "id": "", "metadata": {"key": "", "key1": ""}, "amount": 558834, "tax_amount": 844199, "currency": "Ouguiya", "billing_reason": "subscription_cycle", "billing_address": {"country": "Peru"}, "customer_id": "", "product_id": "", "product_price_id": "", "discount_id": "", "subscription_id": "", "checkout_id": "", "customer": {"created_at": "2024-02-07T13:54:48.821Z", "modified_at": "2023-09-05T11:33:52.011Z", "id": "", "metadata": {"key": 969961, "key1": 450824}, "email": "Creola_Kessler7@gmail.com", "email_verified": true, "name": "", "billing_address": {"country": "Benin"}, "tax_id": ["eu_vat", "mx_rfc"], "organization_id": "", "avatar_url": "https://glorious-fellow.biz"}, "user_id": "", "user": {"id": "", "email": "Jovanny_Block45@hotmail.com", "public_name": ""}, "product": {"created_at": "2024-03-16T20:58:20.526Z", "modified_at": "2023-05-10T02:28:23.859Z", "id": "", "name": "", "description": "Inverse demand-driven superstructure", "is_recurring": true, "is_archived": true, "organization_id": ""}, "product_price": {"created_at": "2024-08-19T11:11:04.610Z", "modified_at": "2024-07-25T06:33:15.810Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 458049, "maximum_amount": 450824, "preset_amount": 262795}, "discount": {"duration": "repeating", "type": "fixed", "amount": 801373, "currency": "Taka", "created_at": "2022-08-30T01:43:46.030Z", "modified_at": "2022-12-10T13:21:20.945Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2023-08-29T15:06:35.685Z", "ends_at": "2024-06-02T05:45:06.910Z", "max_redemptions": 380699, "redemptions_count": 746585, "organization_id": ""}, "subscription": {"metadata": {"key": "", "key1": "", "key2": ""}, "created_at": "2024-12-06T14:08:11.458Z", "modified_at": "2022-08-30T01:43:46.083Z", "id": "", "amount": 521235, "currency": "Bulgarian Lev", "recurring_interval": "year", "status": "trialing", "current_period_start": "2022-12-10T13:21:21.114Z", "current_period_end": "2023-09-21T05:37:11.740Z", "cancel_at_period_end": true, "started_at": "2023-01-14T09:14:56.629Z", "ended_at": "2023-08-29T15:06:35.313Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": ""}} "404": application/json: {"detail": ""} "422": @@ -2041,7 +1933,7 @@ examples: application/json: {"product_price_id": "", "success_url": "http://limp-pastry.org"} responses: "201": - application/json: {"id": "", "customer_email": "", "customer_name": "", "product": {"created_at": "2023-04-03T12:48:32.050Z", "modified_at": "2022-11-13T02:16:42.101Z", "id": "", "name": "", "description": "Customer-focused regional approach", "is_recurring": false, "is_archived": false, "organization_id": "", "prices": [], "benefits": [], "medias": []}, "product_price": {"created_at": "2023-04-03T12:48:32.253Z", "modified_at": "2022-05-28T06:20:22.766Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 796474, "maximum_amount": 951062, "preset_amount": 86, "recurring_interval": "month"}} + application/json: {"id": "", "customer_email": "", "customer_name": "", "product": {"created_at": "2023-04-03T12:48:32.050Z", "modified_at": "2022-11-13T02:16:42.101Z", "id": "", "name": "", "description": "Customer-focused regional approach", "is_recurring": false, "is_archived": false, "organization_id": "", "prices": [], "benefits": [], "medias": []}, "product_price": {"created_at": "2024-04-02T12:48:32.253Z", "modified_at": "2023-05-28T06:20:22.766Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 796474, "maximum_amount": 951062, "preset_amount": 86, "recurring_interval": "month"}} "422": application/json: {} checkouts:get: @@ -2051,7 +1943,7 @@ examples: id: "" responses: "200": - application/json: {"id": "", "customer_email": "", "customer_name": "", "product": {"created_at": "2024-02-07T13:54:48.780Z", "modified_at": "2022-04-09T17:04:24.706Z", "id": "", "name": "", "description": "Optional static intranet", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [], "benefits": [], "medias": []}, "product_price": {"created_at": "2023-08-20T11:11:04.610Z", "modified_at": "2023-07-26T06:33:15.810Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 458049, "maximum_amount": 450824, "preset_amount": 262795}} + application/json: {"id": "", "customer_email": "", "customer_name": "", "product": {"created_at": "2024-02-07T13:54:48.780Z", "modified_at": "2022-04-09T17:04:24.706Z", "id": "", "name": "", "description": "Optional static intranet", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [], "benefits": [], "medias": []}, "product_price": {"created_at": "2024-08-19T11:11:04.610Z", "modified_at": "2024-07-25T06:33:15.810Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 458049, "maximum_amount": 450824, "preset_amount": 262795}} "422": application/json: {} files:list: @@ -2081,7 +1973,7 @@ examples: application/json: {"id": "", "path": "/sys", "parts": []} responses: "200": - application/json: {"id": "", "organization_id": "", "name": "", "path": "/usr/ports", "mime_type": "", "size": 173116, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-09-06T20:34:00.390Z", "version": "", "is_uploaded": false, "created_at": "2023-12-06T04:28:57.373Z", "size_readable": "", "public_url": "https://heartfelt-folklore.net/"} + application/json: {"id": "", "organization_id": "", "name": "", "path": "/usr/ports", "mime_type": "", "size": 173116, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2025-09-06T20:34:00.390Z", "version": "", "is_uploaded": false, "created_at": "2024-12-05T04:28:57.373Z", "size_readable": "", "public_url": "https://heartfelt-folklore.net/"} "422": application/json: {} "403": @@ -2095,7 +1987,7 @@ examples: id: "" responses: "200": - application/json: {"id": "", "organization_id": "", "name": "", "path": "/srv", "mime_type": "", "size": 344620, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-12-22T15:27:45.882Z", "version": "", "is_uploaded": false, "created_at": "2023-06-20T18:46:17.643Z", "size_readable": "", "public_url": "https://awful-technician.info"} + application/json: {"id": "", "organization_id": "", "name": "", "path": "/srv", "mime_type": "", "size": 344620, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2025-12-22T15:27:45.882Z", "version": "", "is_uploaded": false, "created_at": "2024-06-19T18:46:17.643Z", "size_readable": "", "public_url": "https://awful-technician.info"} "422": application/json: {} "403": @@ -2189,7 +2081,7 @@ examples: speakeasy-default-checkouts:custom:list: responses: "200": - application/json: {"items": [{"created_at": "2023-08-23T19:26:20.850Z", "modified_at": "2024-01-14T10:26:00.433Z", "id": "", "status": "open", "client_secret": "", "url": "https://average-fedora.org/", "expires_at": "2022-09-09T18:28:08.953Z", "success_url": "https://primary-paintwork.com/", "embed_origin": "", "amount": 718303, "tax_amount": 86140, "currency": "Convertible Marks", "subtotal_amount": 768578, "total_amount": 687960, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": false, "is_discount_applicable": false, "is_free_product_price": true, "is_payment_required": false, "is_payment_setup_required": true, "is_payment_form_required": true, "customer_id": "", "customer_name": "", "customer_email": "Adam7@yahoo.com", "customer_ip_address": "", "customer_billing_address": {"country": "Mauritius"}, "customer_tax_id": "", "metadata": {"key": "", "key1": "", "key2": ""}, "product": {"created_at": "2024-04-22T08:39:55.981Z", "modified_at": "2023-08-23T19:26:20.850Z", "id": "", "name": "", "description": "mmm avalanche jungle unto meanwhile beside tromp worth", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [], "benefits": [{"created_at": "2023-08-23T19:26:20.850Z", "modified_at": "2024-01-14T10:26:00.433Z", "id": "", "type": "downloadables", "description": "bob inwardly beautifully comparison", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2023-02-10T20:11:51.410Z", "modified_at": "2023-05-17T08:33:13.471Z", "id": "", "type": "github_repository", "description": "commonly softly boo massive sorrowful aw strict behind along energetic", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2023-04-12T03:59:08.538Z", "modified_at": "2023-04-20T11:47:41.889Z", "id": "", "type": "discord", "description": "cleverly blossom defiantly", "selectable": true, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/private/var", "mime_type": "", "size": 704478, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-05-27T06:03:00.110Z", "version": "", "is_uploaded": false, "created_at": "2024-01-10T05:13:52.456Z", "size_readable": "", "public_url": "https://jam-packed-median.net/"}, {"id": "", "organization_id": "", "name": "", "path": "/var/yp", "mime_type": "", "size": 186930, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-03-11T17:32:08.709Z", "version": "", "is_uploaded": false, "created_at": "2022-12-07T09:46:44.632Z", "size_readable": "", "public_url": "https://hateful-linseed.info"}, {"id": "", "organization_id": "", "name": "", "path": "/dev", "mime_type": "", "size": 694688, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-08-19T17:38:55.606Z", "version": "", "is_uploaded": false, "created_at": "2024-10-13T14:46:57.561Z", "size_readable": "", "public_url": "https://left-exterior.biz/"}]}, "product_price": {"created_at": "2024-01-14T10:26:00.433Z", "modified_at": "2022-07-14T18:23:27.528Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 152837, "maximum_amount": 635532, "preset_amount": 639387}, "discount": {"duration": "repeating", "type": "fixed", "amount": 5229, "currency": "Syrian Pound", "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-02-27T06:14:46.641Z", "modified_at": "2022-04-05T09:49:38.010Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 33597, "required": false}], "customer_metadata": {"key": 633911, "key1": ""}}, {"created_at": "2022-01-21T00:48:05.986Z", "modified_at": "2024-09-10T07:49:25.657Z", "id": "", "status": "confirmed", "client_secret": "", "url": "https://practical-trick.org/", "expires_at": "2024-09-28T03:47:03.515Z", "success_url": "https://blue-technologist.com/", "embed_origin": "", "amount": 460276, "tax_amount": 425334, "currency": "Kenyan Shilling", "subtotal_amount": 406555, "total_amount": 480616, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": true, "is_discount_applicable": false, "is_free_product_price": false, "is_payment_required": true, "is_payment_setup_required": false, "is_payment_form_required": true, "customer_id": "", "customer_name": "", "customer_email": "Roman.Stracke39@yahoo.com", "customer_ip_address": "", "customer_billing_address": {"country": "China"}, "customer_tax_id": "", "metadata": {"key": "", "key1": "", "key2": ""}, "product": {"created_at": "2023-12-15T18:53:29.970Z", "modified_at": "2023-10-06T17:09:46.559Z", "id": "", "name": "", "description": "soap cheerfully distinction range", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2023-11-26T18:23:24.264Z", "modified_at": "2022-01-09T04:26:27.312Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 367745, "maximum_amount": 485729, "preset_amount": 73227}, {"created_at": "2024-08-18T13:00:42.665Z", "modified_at": "2023-06-22T03:00:04.393Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 322596, "maximum_amount": 860596, "preset_amount": 18278}, {"created_at": "2024-09-28T03:47:03.515Z", "modified_at": "2022-07-09T16:58:41.012Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 897069, "maximum_amount": 135572, "preset_amount": 460276}], "benefits": [], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/usr/src", "mime_type": "", "size": 88338, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-06-07T09:30:51.196Z", "version": "", "is_uploaded": false, "created_at": "2024-10-06T07:08:41.329Z", "size_readable": "", "public_url": "https://damaged-tapioca.com"}, {"id": "", "organization_id": "", "name": "", "path": "/root", "mime_type": "", "size": 387926, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-10-05T10:11:23.447Z", "version": "", "is_uploaded": true, "created_at": "2024-05-23T21:54:30.697Z", "size_readable": "", "public_url": "https://favorite-digit.biz"}]}, "product_price": {"created_at": "2023-06-11T18:07:18.321Z", "modified_at": "2022-04-24T08:24:21.019Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 841031, "maximum_amount": 410206, "preset_amount": 863466, "recurring_interval": "month"}, "discount": {"duration": "forever", "type": "percentage", "amount": 751563, "currency": "Fiji Dollar", "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2022-05-05T09:08:16.530Z", "modified_at": "2022-07-18T12:08:53.113Z", "id": "", "metadata": {"key": "", "key1": 934960, "key2": true}, "slug": "", "name": "", "organization_id": ""}, "order": 810770, "required": false}], "customer_metadata": {"key": 838930, "key1": false}}, {"created_at": "2022-04-03T06:30:19.876Z", "modified_at": "2024-01-30T10:30:11.361Z", "id": "", "status": "confirmed", "client_secret": "", "url": "https://bustling-plastic.info/", "expires_at": "2024-07-08T11:13:00.198Z", "success_url": "https://yummy-birdcage.com", "embed_origin": "", "amount": 73973, "tax_amount": 836788, "currency": "Leone", "subtotal_amount": 385327, "total_amount": 141764, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": false, "is_discount_applicable": false, "is_free_product_price": false, "is_payment_required": false, "is_payment_setup_required": false, "is_payment_form_required": true, "customer_id": "", "customer_name": "", "customer_email": "Oswald29@gmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Saint Helena"}, "customer_tax_id": "", "metadata": {"key": ""}, "product": {"created_at": "2022-04-29T02:27:27.855Z", "modified_at": "2024-09-02T23:08:00.186Z", "id": "", "name": "", "description": "frenetically from yuck failing consign tedious scar failing unknown in", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2024-12-27T15:09:02.427Z", "modified_at": "2022-03-31T02:45:39.610Z", "id": "", "is_archived": true, "product_id": ""}], "benefits": [{"created_at": "2022-07-20T03:42:25.608Z", "modified_at": "2022-08-23T12:47:09.406Z", "id": "", "type": "ads", "description": "toothpick silently aftermath never tooth swelter fund provided although dreary", "selectable": true, "deletable": true, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/dev", "mime_type": "", "size": 679829, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-04-24T19:54:59.989Z", "version": "", "is_uploaded": false, "created_at": "2023-08-01T10:27:50.144Z", "size_readable": "", "public_url": "https://plump-markup.net"}]}, "product_price": {"created_at": "2024-05-01T20:38:29.097Z", "modified_at": "2022-06-05T08:58:03.644Z", "id": "", "is_archived": false, "product_id": "", "recurring_interval": "month"}, "discount": {"duration": "forever", "duration_in_months": 973913, "type": "fixed", "basis_points": 18518, "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2023-08-20T22:29:27.736Z", "modified_at": "2022-03-15T10:11:56.132Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": "", "properties": {"options": [{"value": "", "label": ""}]}}, "order": 282091, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2024-03-30T07:52:25.805Z", "modified_at": "2022-10-11T19:17:33.283Z", "id": "", "metadata": {"key": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 634941, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2023-05-04T10:59:46.313Z", "modified_at": "2022-01-06T17:33:20.863Z", "id": "", "metadata": {"key": false, "key1": 948614, "key2": true}, "slug": "", "name": "", "organization_id": "", "properties": {"options": [{"value": "", "label": ""}]}}, "order": 520064, "required": false}], "customer_metadata": {"key": false, "key1": 41398}}], "pagination": {"total_count": 5229, "max_page": 810770}} + application/json: {"items": [{"created_at": "2023-08-23T19:26:20.850Z", "modified_at": "2024-01-14T10:26:00.433Z", "id": "", "payment_processor": "stripe", "status": "open", "client_secret": "", "url": "https://average-fedora.org/", "expires_at": "2022-09-09T18:28:08.953Z", "success_url": "https://primary-paintwork.com/", "embed_origin": "", "amount": 718303, "tax_amount": 86140, "currency": "Convertible Marks", "subtotal_amount": 768578, "total_amount": 687960, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": false, "is_discount_applicable": false, "is_free_product_price": true, "is_payment_required": false, "is_payment_setup_required": true, "is_payment_form_required": true, "customer_id": "", "customer_name": "", "customer_email": "Adam7@yahoo.com", "customer_ip_address": "", "customer_billing_address": {"country": "Mauritius"}, "customer_tax_id": "", "metadata": {"key": "", "key1": "", "key2": ""}, "product": {"created_at": "2024-04-22T08:39:55.981Z", "modified_at": "2023-08-23T19:26:20.850Z", "id": "", "name": "", "description": "mmm avalanche jungle unto meanwhile beside tromp worth", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [], "benefits": [{"created_at": "2023-08-23T19:26:20.850Z", "modified_at": "2024-01-14T10:26:00.433Z", "id": "", "type": "downloadables", "description": "bob inwardly beautifully comparison", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2023-02-10T20:11:51.410Z", "modified_at": "2023-05-17T08:33:13.471Z", "id": "", "type": "github_repository", "description": "commonly softly boo massive sorrowful aw strict behind along energetic", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2023-04-12T03:59:08.538Z", "modified_at": "2023-04-20T11:47:41.889Z", "id": "", "type": "discord", "description": "cleverly blossom defiantly", "selectable": true, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/private/var", "mime_type": "", "size": 704478, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-05-27T06:03:00.110Z", "version": "", "is_uploaded": false, "created_at": "2024-01-10T05:13:52.456Z", "size_readable": "", "public_url": "https://jam-packed-median.net/"}, {"id": "", "organization_id": "", "name": "", "path": "/var/yp", "mime_type": "", "size": 186930, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-03-11T17:32:08.709Z", "version": "", "is_uploaded": false, "created_at": "2022-12-07T09:46:44.632Z", "size_readable": "", "public_url": "https://hateful-linseed.info"}, {"id": "", "organization_id": "", "name": "", "path": "/dev", "mime_type": "", "size": 694688, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-08-19T17:38:55.606Z", "version": "", "is_uploaded": false, "created_at": "2024-10-13T14:46:57.561Z", "size_readable": "", "public_url": "https://left-exterior.biz/"}]}, "product_price": {"created_at": "2025-01-13T10:26:00.433Z", "modified_at": "2023-07-14T18:23:27.528Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 152837, "maximum_amount": 635532, "preset_amount": 639387}, "discount": {"duration": "repeating", "type": "fixed", "amount": 5229, "currency": "Syrian Pound", "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2025-02-26T06:14:46.641Z", "modified_at": "2023-04-05T09:49:38.010Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 33597, "required": false}], "customer_metadata": {"key": 633911, "key1": ""}}, {"created_at": "2022-01-21T00:48:05.986Z", "modified_at": "2024-09-10T07:49:25.657Z", "id": "", "payment_processor": "stripe", "status": "confirmed", "client_secret": "", "url": "https://practical-trick.org/", "expires_at": "2024-09-28T03:47:03.515Z", "success_url": "https://blue-technologist.com/", "embed_origin": "", "amount": 460276, "tax_amount": 425334, "currency": "Kenyan Shilling", "subtotal_amount": 406555, "total_amount": 480616, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": true, "is_discount_applicable": false, "is_free_product_price": false, "is_payment_required": true, "is_payment_setup_required": false, "is_payment_form_required": true, "customer_id": "", "customer_name": "", "customer_email": "Roman.Stracke39@yahoo.com", "customer_ip_address": "", "customer_billing_address": {"country": "China"}, "customer_tax_id": "", "metadata": {"key": "", "key1": "", "key2": ""}, "product": {"created_at": "2023-12-15T18:53:29.970Z", "modified_at": "2023-10-06T17:09:46.559Z", "id": "", "name": "", "description": "soap cheerfully distinction range", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2024-11-25T18:23:24.264Z", "modified_at": "2023-01-09T04:26:27.312Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 367745, "maximum_amount": 485729, "preset_amount": 73227}, {"created_at": "2025-08-18T13:00:42.665Z", "modified_at": "2024-06-21T03:00:04.393Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 322596, "maximum_amount": 860596, "preset_amount": 18278}, {"created_at": "2025-09-28T03:47:03.515Z", "modified_at": "2023-07-09T16:58:41.012Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 897069, "maximum_amount": 135572, "preset_amount": 460276}], "benefits": [], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/usr/src", "mime_type": "", "size": 88338, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-06-07T09:30:51.196Z", "version": "", "is_uploaded": false, "created_at": "2024-10-06T07:08:41.329Z", "size_readable": "", "public_url": "https://damaged-tapioca.com"}, {"id": "", "organization_id": "", "name": "", "path": "/root", "mime_type": "", "size": 387926, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-10-05T10:11:23.447Z", "version": "", "is_uploaded": true, "created_at": "2024-05-23T21:54:30.697Z", "size_readable": "", "public_url": "https://favorite-digit.biz"}]}, "product_price": {"created_at": "2024-06-10T18:07:18.321Z", "modified_at": "2023-04-24T08:24:21.019Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 841031, "maximum_amount": 410206, "preset_amount": 863466, "recurring_interval": "month"}, "discount": {"duration": "forever", "type": "percentage", "amount": 751563, "currency": "Fiji Dollar", "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2023-05-05T09:08:16.530Z", "modified_at": "2023-07-18T12:08:53.113Z", "id": "", "metadata": {"key": "", "key1": 934960, "key2": true}, "slug": "", "name": "", "organization_id": ""}, "order": 810770, "required": false}], "customer_metadata": {"key": 838930, "key1": false}}, {"created_at": "2022-04-03T06:30:19.876Z", "modified_at": "2024-01-30T10:30:11.361Z", "id": "", "payment_processor": "stripe", "status": "confirmed", "client_secret": "", "url": "https://bustling-plastic.info/", "expires_at": "2024-07-08T11:13:00.198Z", "success_url": "https://yummy-birdcage.com", "embed_origin": "", "amount": 73973, "tax_amount": 836788, "currency": "Leone", "subtotal_amount": 385327, "total_amount": 141764, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": false, "is_discount_applicable": false, "is_free_product_price": false, "is_payment_required": false, "is_payment_setup_required": false, "is_payment_form_required": true, "customer_id": "", "customer_name": "", "customer_email": "Oswald29@gmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Saint Helena"}, "customer_tax_id": "", "metadata": {"key": ""}, "product": {"created_at": "2022-04-29T02:27:27.855Z", "modified_at": "2024-09-02T23:08:00.186Z", "id": "", "name": "", "description": "frenetically from yuck failing consign tedious scar failing unknown in", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2025-12-27T15:09:02.427Z", "modified_at": "2023-03-31T02:45:39.610Z", "id": "", "is_archived": true, "product_id": ""}], "benefits": [{"created_at": "2022-07-20T03:42:25.608Z", "modified_at": "2022-08-23T12:47:09.406Z", "id": "", "type": "ads", "description": "toothpick silently aftermath never tooth swelter fund provided although dreary", "selectable": true, "deletable": true, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/dev", "mime_type": "", "size": 679829, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-04-24T19:54:59.989Z", "version": "", "is_uploaded": false, "created_at": "2023-08-01T10:27:50.144Z", "size_readable": "", "public_url": "https://plump-markup.net"}]}, "product_price": {"created_at": "2025-05-01T20:38:29.097Z", "modified_at": "2023-06-05T08:58:03.644Z", "id": "", "is_archived": false, "product_id": "", "recurring_interval": "month"}, "discount": {"duration": "forever", "duration_in_months": 973913, "type": "fixed", "basis_points": 18518, "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-08-19T22:29:27.736Z", "modified_at": "2023-03-15T10:11:56.132Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": "", "properties": {"options": [{"value": "", "label": ""}]}}, "order": 282091, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2025-03-30T07:52:25.805Z", "modified_at": "2023-10-11T19:17:33.283Z", "id": "", "metadata": {"key": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 634941, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2024-05-03T10:59:46.313Z", "modified_at": "2023-01-06T17:33:20.863Z", "id": "", "metadata": {"key": false, "key1": 948614, "key2": true}, "slug": "", "name": "", "organization_id": "", "properties": {"options": [{"value": "", "label": ""}]}}, "order": 520064, "required": false}], "customer_metadata": {"key": false, "key1": 41398}}], "pagination": {"total_count": 5229, "max_page": 810770}} "422": application/json: {} checkouts:custom:create: @@ -2198,7 +2090,7 @@ examples: application/json: {"product_id": ""} responses: "201": - application/json: {"created_at": "2023-06-18T07:14:55.338Z", "modified_at": "2023-12-01T17:06:07.804Z", "id": "", "status": "confirmed", "client_secret": "", "url": "https://blind-breastplate.name/", "expires_at": "2022-05-28T06:20:22.766Z", "success_url": "https://standard-utilization.com/", "embed_origin": "", "amount": 169727, "tax_amount": 89964, "currency": "South Sudanese pound", "subtotal_amount": 638424, "total_amount": 816588, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": true, "is_discount_applicable": true, "is_free_product_price": true, "is_payment_required": false, "is_payment_setup_required": false, "is_payment_form_required": false, "customer_id": "", "customer_name": "", "customer_email": "Vernice.Gerlach23@hotmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Bahamas"}, "customer_tax_id": "", "metadata": {"key": ""}, "product": {"created_at": "2023-06-18T07:14:55.338Z", "modified_at": "2023-12-01T17:06:07.804Z", "id": "", "name": "", "description": "calmly fortunately bench around igloo scaffold", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2022-05-28T06:20:22.766Z", "modified_at": "2022-03-17T15:39:20.911Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 951062, "maximum_amount": 86, "preset_amount": 169727}], "benefits": [{"created_at": "2024-05-18T17:03:53.906Z", "modified_at": "2024-06-13T23:30:51.782Z", "id": "", "type": "github_repository", "description": "barracks approximate though championship kookily attend alongside aw blend", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/var/tmp", "mime_type": "", "size": 282436, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-06-30T08:34:56.549Z", "version": "", "is_uploaded": false, "created_at": "2024-05-17T00:17:31.738Z", "size_readable": "", "public_url": "https://vivid-understanding.org"}, {"id": "", "organization_id": "", "name": "", "path": "/opt/lib", "mime_type": "", "size": 78523, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-03-01T22:29:56.777Z", "version": "", "is_uploaded": false, "created_at": "2023-02-12T14:03:31.774Z", "size_readable": "", "public_url": "https://frequent-cope.net/"}, {"id": "", "organization_id": "", "name": "", "path": "/var/tmp", "mime_type": "", "size": 239872, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-09-18T18:56:43.213Z", "version": "", "is_uploaded": false, "created_at": "2023-06-02T16:37:35.306Z", "size_readable": "", "public_url": "https://spotless-catalyst.biz/"}]}, "product_price": {"created_at": "2024-06-13T23:30:51.782Z", "modified_at": "2023-10-05T11:56:21.731Z", "id": "", "is_archived": false, "product_id": "", "recurring_interval": "year"}, "discount": {"duration": "once", "type": "fixed", "amount": 651985, "currency": "Hong Kong Dollar", "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2022-10-12T13:17:54.745Z", "modified_at": "2022-01-20T11:09:16.789Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 64738, "required": true}], "customer_metadata": {}} + application/json: {"created_at": "2023-06-18T07:14:55.338Z", "modified_at": "2023-12-01T17:06:07.804Z", "id": "", "payment_processor": "stripe", "status": "confirmed", "client_secret": "", "url": "https://blind-breastplate.name/", "expires_at": "2022-05-28T06:20:22.766Z", "success_url": "https://standard-utilization.com/", "embed_origin": "", "amount": 169727, "tax_amount": 89964, "currency": "South Sudanese pound", "subtotal_amount": 638424, "total_amount": 816588, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": true, "is_discount_applicable": true, "is_free_product_price": true, "is_payment_required": false, "is_payment_setup_required": false, "is_payment_form_required": false, "customer_id": "", "customer_name": "", "customer_email": "Vernice.Gerlach23@hotmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Bahamas"}, "customer_tax_id": "", "metadata": {"key": ""}, "product": {"created_at": "2023-06-18T07:14:55.338Z", "modified_at": "2023-12-01T17:06:07.804Z", "id": "", "name": "", "description": "calmly fortunately bench around igloo scaffold", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2024-04-02T12:48:32.253Z", "modified_at": "2023-05-28T06:20:22.766Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 796474, "maximum_amount": 951062, "preset_amount": 86, "recurring_interval": "month"}], "benefits": [{"created_at": "2024-05-18T17:03:53.906Z", "modified_at": "2024-06-13T23:30:51.782Z", "id": "", "type": "github_repository", "description": "barracks approximate though championship kookily attend alongside aw blend", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/var/tmp", "mime_type": "", "size": 282436, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-06-30T08:34:56.549Z", "version": "", "is_uploaded": false, "created_at": "2024-05-17T00:17:31.738Z", "size_readable": "", "public_url": "https://vivid-understanding.org"}, {"id": "", "organization_id": "", "name": "", "path": "/opt/lib", "mime_type": "", "size": 78523, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-03-01T22:29:56.777Z", "version": "", "is_uploaded": false, "created_at": "2023-02-12T14:03:31.774Z", "size_readable": "", "public_url": "https://frequent-cope.net/"}, {"id": "", "organization_id": "", "name": "", "path": "/var/tmp", "mime_type": "", "size": 239872, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-09-18T18:56:43.213Z", "version": "", "is_uploaded": false, "created_at": "2023-06-02T16:37:35.306Z", "size_readable": "", "public_url": "https://spotless-catalyst.biz/"}]}, "product_price": {"created_at": "2025-06-13T23:30:51.782Z", "modified_at": "2024-10-04T11:56:21.731Z", "id": "", "is_archived": false, "product_id": "", "recurring_interval": "year"}, "discount": {"duration": "once", "type": "fixed", "amount": 651985, "currency": "Hong Kong Dollar", "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2023-10-12T13:17:54.745Z", "modified_at": "2023-01-20T11:09:16.789Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 64738, "required": true}], "customer_metadata": {}} "422": application/json: {} checkouts:custom:get: @@ -2208,7 +2100,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2024-02-07T13:54:48.821Z", "modified_at": "2023-09-05T11:33:52.011Z", "id": "", "status": "confirmed", "client_secret": "", "url": "https://glossy-concentration.biz/", "expires_at": "2023-07-26T06:33:15.810Z", "success_url": "https://lavish-ice-cream.biz", "embed_origin": "", "amount": 213457, "tax_amount": 937146, "currency": "Som", "subtotal_amount": 700347, "total_amount": 801373, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": false, "is_discount_applicable": false, "is_free_product_price": false, "is_payment_required": true, "is_payment_setup_required": false, "is_payment_form_required": true, "customer_id": "", "customer_name": "", "customer_email": "Elyssa38@gmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Mozambique"}, "customer_tax_id": "", "metadata": {"key": "", "key1": ""}, "product": {"created_at": "2024-02-07T13:54:48.821Z", "modified_at": "2023-09-05T11:33:52.011Z", "id": "", "name": "", "description": "tune only fellow scary but embarrassment metabolise", "is_recurring": false, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2023-08-20T11:11:04.610Z", "modified_at": "2023-07-26T06:33:15.810Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 458049, "maximum_amount": 450824, "preset_amount": 262795}, {"created_at": "2023-04-26T04:53:50.189Z", "modified_at": "2024-05-28T07:17:57.134Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "month"}], "benefits": [{"created_at": "2022-04-14T16:04:46.468Z", "modified_at": "2023-08-29T15:06:35.685Z", "id": "", "type": "downloadables", "description": "disapprove glum ugh roundabout middle ha", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2022-04-14T16:04:46.468Z", "modified_at": "2023-08-29T15:06:35.685Z", "id": "", "type": "downloadables", "description": "disapprove glum ugh roundabout middle ha", "selectable": true, "deletable": false, "organization_id": ""}], "medias": []}, "product_price": {"created_at": "2023-08-29T15:06:35.685Z", "modified_at": "2024-06-02T05:45:06.910Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 746585, "recurring_interval": "year"}, "discount": {"duration": "repeating", "type": "percentage", "basis_points": 909118, "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2022-12-20T13:59:56.783Z", "modified_at": "2022-12-21T05:04:07.004Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 165215, "required": false}, {"custom_field_id": "", "custom_field": {"created_at": "2024-05-05T04:00:06.053Z", "modified_at": "2022-11-08T07:25:39.944Z", "id": "", "metadata": {"key": false, "key1": true}, "slug": "", "name": "", "organization_id": ""}, "order": 292469, "required": false}], "customer_metadata": {}} + application/json: {"created_at": "2024-02-07T13:54:48.821Z", "modified_at": "2023-09-05T11:33:52.011Z", "id": "", "payment_processor": "stripe", "status": "confirmed", "client_secret": "", "url": "https://glossy-concentration.biz/", "expires_at": "2023-07-26T06:33:15.810Z", "success_url": "https://lavish-ice-cream.biz", "embed_origin": "", "amount": 213457, "tax_amount": 937146, "currency": "Som", "subtotal_amount": 700347, "total_amount": 801373, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": false, "is_discount_applicable": false, "is_free_product_price": false, "is_payment_required": true, "is_payment_setup_required": false, "is_payment_form_required": true, "customer_id": "", "customer_name": "", "customer_email": "Elyssa38@gmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Mozambique"}, "customer_tax_id": "", "metadata": {"key": "", "key1": ""}, "product": {"created_at": "2024-02-07T13:54:48.821Z", "modified_at": "2023-09-05T11:33:52.011Z", "id": "", "name": "", "description": "tune only fellow scary but embarrassment metabolise", "is_recurring": false, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2024-08-19T11:11:04.610Z", "modified_at": "2024-07-25T06:33:15.810Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 458049, "maximum_amount": 450824, "preset_amount": 262795}, {"created_at": "2024-04-25T04:53:50.189Z", "modified_at": "2025-05-28T07:17:57.134Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "month"}], "benefits": [{"created_at": "2022-04-14T16:04:46.468Z", "modified_at": "2023-08-29T15:06:35.685Z", "id": "", "type": "downloadables", "description": "disapprove glum ugh roundabout middle ha", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2022-04-14T16:04:46.468Z", "modified_at": "2023-08-29T15:06:35.685Z", "id": "", "type": "downloadables", "description": "disapprove glum ugh roundabout middle ha", "selectable": true, "deletable": false, "organization_id": ""}], "medias": []}, "product_price": {"created_at": "2024-08-28T15:06:35.685Z", "modified_at": "2025-06-02T05:45:06.910Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 746585, "recurring_interval": "year"}, "discount": {"duration": "repeating", "type": "percentage", "basis_points": 909118, "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2023-12-20T13:59:56.783Z", "modified_at": "2023-12-21T05:04:07.004Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 165215, "required": false}, {"custom_field_id": "", "custom_field": {"created_at": "2025-05-05T04:00:06.053Z", "modified_at": "2023-11-08T07:25:39.944Z", "id": "", "metadata": {"key": false, "key1": true}, "slug": "", "name": "", "organization_id": ""}, "order": 292469, "required": false}], "customer_metadata": {}} "404": application/json: {"detail": ""} "422": @@ -2220,7 +2112,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2024-07-28T19:04:48.565Z", "modified_at": "2023-10-17T10:52:42.015Z", "id": "", "status": "expired", "client_secret": "", "url": "https://joyful-knight.com", "expires_at": "2024-12-22T15:27:45.882Z", "success_url": "https://lumbering-wheel.com", "embed_origin": "", "amount": 896501, "tax_amount": 446863, "currency": "Gibraltar Pound", "subtotal_amount": 857478, "total_amount": 249440, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": false, "is_discount_applicable": true, "is_free_product_price": false, "is_payment_required": true, "is_payment_setup_required": false, "is_payment_form_required": true, "customer_id": "", "customer_name": "", "customer_email": "Sienna_Kohler@hotmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Antarctica"}, "customer_tax_id": "", "metadata": {"key": "", "key1": "", "key2": ""}, "product": {"created_at": "2024-07-28T19:04:48.565Z", "modified_at": "2023-10-17T10:52:42.015Z", "id": "", "name": "", "description": "hydrolyze for drat underneath sticky", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2023-01-13T16:52:57.274Z", "modified_at": "2024-12-22T15:27:45.882Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 488852, "maximum_amount": 984008, "preset_amount": 54062}], "benefits": [{"created_at": "2023-01-18T02:16:35.227Z", "modified_at": "2023-03-19T19:37:57.642Z", "id": "", "type": "license_keys", "description": "qualified cycle woot abseil perfumed fisherman with duh", "selectable": true, "deletable": true, "organization_id": ""}, {"created_at": "2022-01-23T15:34:13.017Z", "modified_at": "2023-07-24T20:53:49.881Z", "id": "", "type": "downloadables", "description": "urgently voluntarily scale gut", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2023-12-06T20:36:03.050Z", "modified_at": "2022-11-28T09:21:21.867Z", "id": "", "type": "discord", "description": "concerning statement nice consequently provided when rim league", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/srv", "mime_type": "", "size": 249923, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-05-14T05:25:13.723Z", "version": "", "is_uploaded": true, "created_at": "2023-11-11T05:00:44.440Z", "size_readable": "", "public_url": "https://exotic-importance.info/"}, {"id": "", "organization_id": "", "name": "", "path": "/boot", "mime_type": "", "size": 472933, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-08-03T05:43:47.592Z", "version": "", "is_uploaded": false, "created_at": "2022-10-01T21:33:23.746Z", "size_readable": "", "public_url": "https://gigantic-reconsideration.info/"}]}, "product_price": {"created_at": "2022-12-08T09:52:54.805Z", "modified_at": "2022-10-01T09:16:09.932Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 789275, "maximum_amount": 889838, "preset_amount": 302461}, "discount": {"duration": "forever", "type": "fixed", "basis_points": 756247, "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-04-25T05:43:42.397Z", "modified_at": "2024-01-31T02:01:14.461Z", "id": "", "metadata": {"key": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 810877, "required": true}], "customer_metadata": {"key": true, "key1": 111158, "key2": ""}} + application/json: {"created_at": "2024-07-28T19:04:48.565Z", "modified_at": "2023-10-17T10:52:42.015Z", "id": "", "payment_processor": "stripe", "status": "expired", "client_secret": "", "url": "https://joyful-knight.com", "expires_at": "2024-12-22T15:27:45.882Z", "success_url": "https://lumbering-wheel.com", "embed_origin": "", "amount": 896501, "tax_amount": 446863, "currency": "Gibraltar Pound", "subtotal_amount": 857478, "total_amount": 249440, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": false, "is_discount_applicable": true, "is_free_product_price": false, "is_payment_required": true, "is_payment_setup_required": false, "is_payment_form_required": true, "customer_id": "", "customer_name": "", "customer_email": "Sienna_Kohler@hotmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Antarctica"}, "customer_tax_id": "", "metadata": {"key": "", "key1": "", "key2": ""}, "product": {"created_at": "2024-07-28T19:04:48.565Z", "modified_at": "2023-10-17T10:52:42.015Z", "id": "", "name": "", "description": "hydrolyze for drat underneath sticky", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2024-01-13T16:52:57.274Z", "modified_at": "2025-12-22T15:27:45.882Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 488852, "maximum_amount": 984008, "preset_amount": 54062}], "benefits": [{"created_at": "2023-01-18T02:16:35.227Z", "modified_at": "2023-03-19T19:37:57.642Z", "id": "", "type": "license_keys", "description": "qualified cycle woot abseil perfumed fisherman with duh", "selectable": true, "deletable": true, "organization_id": ""}, {"created_at": "2022-01-23T15:34:13.017Z", "modified_at": "2023-07-24T20:53:49.881Z", "id": "", "type": "downloadables", "description": "urgently voluntarily scale gut", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2023-12-06T20:36:03.050Z", "modified_at": "2022-11-28T09:21:21.867Z", "id": "", "type": "discord", "description": "concerning statement nice consequently provided when rim league", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/srv", "mime_type": "", "size": 249923, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-05-14T05:25:13.723Z", "version": "", "is_uploaded": true, "created_at": "2023-11-11T05:00:44.440Z", "size_readable": "", "public_url": "https://exotic-importance.info/"}, {"id": "", "organization_id": "", "name": "", "path": "/boot", "mime_type": "", "size": 472933, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-08-03T05:43:47.592Z", "version": "", "is_uploaded": false, "created_at": "2022-10-01T21:33:23.746Z", "size_readable": "", "public_url": "https://gigantic-reconsideration.info/"}]}, "product_price": {"created_at": "2023-12-08T09:52:54.805Z", "modified_at": "2023-10-01T09:16:09.932Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 789275, "maximum_amount": 889838, "preset_amount": 302461}, "discount": {"duration": "forever", "type": "fixed", "basis_points": 756247, "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2025-04-25T05:43:42.397Z", "modified_at": "2025-01-30T02:01:14.461Z", "id": "", "metadata": {"key": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 810877, "required": true}], "customer_metadata": {"key": true, "key1": 111158, "key2": ""}} "404": application/json: {"detail": ""} "422": @@ -2232,7 +2124,7 @@ examples: client_secret: "" responses: "200": - application/json: {"created_at": "2022-06-23T19:45:02.115Z", "modified_at": "2022-11-26T05:04:17.930Z", "id": "", "status": "succeeded", "client_secret": "", "url": "https://lumpy-jellyfish.com", "expires_at": "2023-08-07T16:01:01.665Z", "success_url": "https://obedient-operating.org/", "embed_origin": "", "amount": 553902, "tax_amount": 201138, "currency": "Seychelles Rupee", "subtotal_amount": 158597, "total_amount": 493334, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": true, "is_discount_applicable": false, "is_free_product_price": false, "is_payment_required": false, "is_payment_setup_required": true, "is_payment_form_required": false, "customer_id": "", "customer_name": "", "customer_email": "Coleman_Rutherford@hotmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Maldives"}, "customer_tax_id": "", "product": {"created_at": "2022-09-10T21:17:06.373Z", "modified_at": "2024-10-11T12:01:20.600Z", "id": "", "name": "", "description": "of grave parade whereas wherever", "is_recurring": false, "is_archived": false, "organization_id": "", "prices": [], "benefits": [{"created_at": "2022-11-26T05:04:17.930Z", "modified_at": "2024-04-14T21:02:40.457Z", "id": "", "type": "discord", "description": "given impolite how astride cap", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2024-07-23T16:17:04.686Z", "modified_at": "2024-10-15T01:25:33.429Z", "id": "", "type": "ads", "description": "definitive as fluffy", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2023-05-06T11:19:10.077Z", "modified_at": "2023-11-17T04:52:10.824Z", "id": "", "type": "downloadables", "description": "yum lecture against alienated meanwhile unabashedly", "selectable": true, "deletable": true, "organization_id": ""}], "medias": []}, "product_price": {"created_at": "2024-04-14T21:02:40.457Z", "modified_at": "2023-08-07T16:01:01.665Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 564186, "recurring_interval": "year"}, "discount": {"duration": "forever", "duration_in_months": 818651, "type": "fixed", "amount": 643894, "currency": "Leone", "id": "", "name": "", "code": ""}, "organization": {"created_at": "2024-10-05T02:43:03.106Z", "modified_at": "2023-08-31T01:50:30.615Z", "id": "", "name": "", "slug": "", "avatar_url": "https://shy-kettledrum.name/", "bio": "", "company": "Douglas, Nolan and Rutherford", "blog": "", "location": "", "email": "Gregoria.Littel92@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 528457, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 944792}, "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2023-08-31T01:50:30.615Z", "modified_at": "2022-08-09T10:44:49.155Z", "id": "", "metadata": {"key": 649087, "key1": true}, "slug": "", "name": "", "organization_id": ""}, "order": 250741, "required": false}, {"custom_field_id": "", "custom_field": {"created_at": "2024-04-27T22:21:52.955Z", "modified_at": "2024-01-07T03:44:33.409Z", "id": "", "metadata": {"key": 542382}, "slug": "", "name": "", "organization_id": "", "properties": {"options": []}}, "order": 113721, "required": false}, {"custom_field_id": "", "custom_field": {"created_at": "2022-12-09T12:49:04.135Z", "modified_at": "2023-08-03T04:31:36.942Z", "id": "", "metadata": {"key": true}, "slug": "", "name": "", "organization_id": ""}, "order": 241475, "required": true}]} + application/json: {"created_at": "2022-06-23T19:45:02.115Z", "modified_at": "2022-11-26T05:04:17.930Z", "id": "", "payment_processor": "stripe", "status": "succeeded", "client_secret": "", "url": "https://lumpy-jellyfish.com", "expires_at": "2023-08-07T16:01:01.665Z", "success_url": "https://obedient-operating.org/", "embed_origin": "", "amount": 553902, "tax_amount": 201138, "currency": "Seychelles Rupee", "subtotal_amount": 158597, "total_amount": 493334, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": true, "is_discount_applicable": false, "is_free_product_price": false, "is_payment_required": false, "is_payment_setup_required": true, "is_payment_form_required": false, "customer_id": "", "customer_name": "", "customer_email": "Coleman_Rutherford@hotmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Maldives"}, "customer_tax_id": "", "product": {"created_at": "2022-09-10T21:17:06.373Z", "modified_at": "2024-10-11T12:01:20.600Z", "id": "", "name": "", "description": "of grave parade whereas wherever", "is_recurring": false, "is_archived": false, "organization_id": "", "prices": [], "benefits": [{"created_at": "2022-11-26T05:04:17.930Z", "modified_at": "2024-04-14T21:02:40.457Z", "id": "", "type": "discord", "description": "given impolite how astride cap", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2024-07-23T16:17:04.686Z", "modified_at": "2024-10-15T01:25:33.429Z", "id": "", "type": "ads", "description": "definitive as fluffy", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2023-05-06T11:19:10.077Z", "modified_at": "2023-11-17T04:52:10.824Z", "id": "", "type": "downloadables", "description": "yum lecture against alienated meanwhile unabashedly", "selectable": true, "deletable": true, "organization_id": ""}], "medias": []}, "product_price": {"created_at": "2025-04-14T21:02:40.457Z", "modified_at": "2024-08-06T16:01:01.665Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 564186, "recurring_interval": "year"}, "discount": {"duration": "forever", "duration_in_months": 818651, "type": "fixed", "amount": 643894, "currency": "Leone", "id": "", "name": "", "code": ""}, "organization": {"created_at": "2024-10-05T02:43:03.106Z", "modified_at": "2023-08-31T01:50:30.615Z", "id": "", "name": "", "slug": "", "avatar_url": "https://shy-kettledrum.name/", "bio": "", "company": "Douglas, Nolan and Rutherford", "blog": "", "location": "", "email": "Gregoria.Littel92@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 528457, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 944792}, "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-08-30T01:50:30.615Z", "modified_at": "2023-08-09T10:44:49.155Z", "id": "", "metadata": {"key": 649087, "key1": true}, "slug": "", "name": "", "organization_id": ""}, "order": 250741, "required": false}, {"custom_field_id": "", "custom_field": {"created_at": "2025-04-27T22:21:52.955Z", "modified_at": "2025-01-06T03:44:33.409Z", "id": "", "metadata": {"key": 542382}, "slug": "", "name": "", "organization_id": "", "properties": {"options": []}}, "order": 113721, "required": false}, {"custom_field_id": "", "custom_field": {"created_at": "2023-12-09T12:49:04.135Z", "modified_at": "2024-08-02T04:31:36.942Z", "id": "", "metadata": {"key": true}, "slug": "", "name": "", "organization_id": ""}, "order": 241475, "required": true}]} "404": application/json: {"detail": ""} "422": @@ -2244,7 +2136,7 @@ examples: client_secret: "" responses: "200": - application/json: {"created_at": "2024-10-22T20:45:21.815Z", "modified_at": "2023-07-17T23:31:05.499Z", "id": "", "status": "expired", "client_secret": "", "url": "https://simple-flint.org/", "expires_at": "2023-07-14T01:44:24.320Z", "success_url": "https://passionate-understanding.com/", "embed_origin": "", "amount": 573767, "tax_amount": 903274, "currency": "Sudanese Pound", "subtotal_amount": 936008, "total_amount": 813143, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": false, "is_discount_applicable": true, "is_free_product_price": false, "is_payment_required": true, "is_payment_setup_required": true, "is_payment_form_required": false, "customer_id": "", "customer_name": "", "customer_email": "Leonie50@hotmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Bulgaria"}, "customer_tax_id": "", "product": {"created_at": "2023-09-04T23:39:15.429Z", "modified_at": "2022-06-30T18:11:17.062Z", "id": "", "name": "", "description": "ack notwithstanding lively into trusty", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2022-11-16T20:51:18.745Z", "modified_at": "2023-07-14T01:44:24.320Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 597177, "maximum_amount": 947630, "preset_amount": 166401}, {"created_at": "2024-04-03T02:37:24.726Z", "modified_at": "2024-06-10T04:54:08.615Z", "id": "", "is_archived": true, "product_id": ""}, {"created_at": "2024-07-08T15:45:04.860Z", "modified_at": "2023-09-22T09:06:50.882Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 508864, "maximum_amount": 744619, "preset_amount": 137234}], "benefits": [{"created_at": "2024-04-13T01:40:05.694Z", "modified_at": "2024-07-12T13:33:11.703Z", "id": "", "type": "discord", "description": "prohibition where although negative where psst", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2022-11-01T16:37:11.315Z", "modified_at": "2024-11-11T09:22:51.554Z", "id": "", "type": "ads", "description": "anenst meanwhile little", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2023-12-08T07:51:27.800Z", "modified_at": "2022-03-18T21:13:49.993Z", "id": "", "type": "discord", "description": "long-term relative singe urgently questionably", "selectable": false, "deletable": true, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/opt/share", "mime_type": "", "size": 389948, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-01-06T16:44:49.420Z", "version": "", "is_uploaded": false, "created_at": "2024-04-09T09:13:22.245Z", "size_readable": "", "public_url": "https://smoggy-graffiti.net/"}, {"id": "", "organization_id": "", "name": "", "path": "/usr/obj", "mime_type": "", "size": 503125, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-06-27T13:22:35.587Z", "version": "", "is_uploaded": false, "created_at": "2022-06-08T06:40:16.558Z", "size_readable": "", "public_url": "https://lumbering-charlatan.biz/"}, {"id": "", "organization_id": "", "name": "", "path": "/var/mail", "mime_type": "", "size": 126531, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-10-20T22:04:15.588Z", "version": "", "is_uploaded": false, "created_at": "2023-02-02T22:10:58.341Z", "size_readable": "", "public_url": "https://which-entry.biz/"}]}, "product_price": {"created_at": "2022-10-09T22:41:34.766Z", "modified_at": "2024-06-14T00:54:00.547Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 172495}, "discount": {"duration": "repeating", "type": "fixed", "amount": 659813, "currency": "Pound Sterling", "id": "", "name": "", "code": ""}, "organization": {"created_at": "2023-07-15T16:51:46.519Z", "modified_at": "2023-07-18T07:58:43.752Z", "id": "", "name": "", "slug": "", "avatar_url": "https://squiggly-conservative.name/", "bio": "", "company": "Parker - Funk", "blog": "", "location": "", "email": "Lelia.Lind1@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 359631, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 600341}, "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2023-07-18T07:58:43.752Z", "modified_at": "2022-01-25T05:31:14.324Z", "id": "", "metadata": {"key": "", "key1": 288739, "key2": true}, "slug": "", "name": "", "organization_id": ""}, "order": 278568, "required": false}, {"custom_field_id": "", "custom_field": {"created_at": "2023-10-26T18:06:03.198Z", "modified_at": "2023-04-17T00:02:14.300Z", "id": "", "metadata": {"key": "", "key1": ""}, "slug": "", "name": "", "organization_id": "", "properties": {"options": []}}, "order": 873793, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2023-05-05T04:20:49.023Z", "modified_at": "2023-10-20T23:21:29.133Z", "id": "", "metadata": {"key": false}, "slug": "", "name": "", "organization_id": ""}, "order": 458158, "required": true}]} + application/json: {"created_at": "2024-10-22T20:45:21.815Z", "modified_at": "2023-07-17T23:31:05.499Z", "id": "", "payment_processor": "stripe", "status": "expired", "client_secret": "", "url": "https://simple-flint.org/", "expires_at": "2023-07-14T01:44:24.320Z", "success_url": "https://passionate-understanding.com/", "embed_origin": "", "amount": 573767, "tax_amount": 903274, "currency": "Sudanese Pound", "subtotal_amount": 936008, "total_amount": 813143, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": false, "is_discount_applicable": true, "is_free_product_price": false, "is_payment_required": true, "is_payment_setup_required": true, "is_payment_form_required": false, "customer_id": "", "customer_name": "", "customer_email": "Leonie50@hotmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Bulgaria"}, "customer_tax_id": "", "product": {"created_at": "2023-09-04T23:39:15.429Z", "modified_at": "2022-06-30T18:11:17.062Z", "id": "", "name": "", "description": "ack notwithstanding lively into trusty", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2023-11-16T20:51:18.745Z", "modified_at": "2024-07-13T01:44:24.320Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 597177, "maximum_amount": 947630, "preset_amount": 166401}, {"created_at": "2025-04-03T02:37:24.726Z", "modified_at": "2025-06-10T04:54:08.615Z", "id": "", "is_archived": true, "product_id": ""}, {"created_at": "2025-07-08T15:45:04.860Z", "modified_at": "2024-09-21T09:06:50.882Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 508864, "maximum_amount": 744619, "preset_amount": 137234}], "benefits": [{"created_at": "2024-04-13T01:40:05.694Z", "modified_at": "2024-07-12T13:33:11.703Z", "id": "", "type": "discord", "description": "prohibition where although negative where psst", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2022-11-01T16:37:11.315Z", "modified_at": "2024-11-11T09:22:51.554Z", "id": "", "type": "ads", "description": "anenst meanwhile little", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2023-12-08T07:51:27.800Z", "modified_at": "2022-03-18T21:13:49.993Z", "id": "", "type": "discord", "description": "long-term relative singe urgently questionably", "selectable": false, "deletable": true, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/opt/share", "mime_type": "", "size": 389948, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-01-06T16:44:49.420Z", "version": "", "is_uploaded": false, "created_at": "2024-04-09T09:13:22.245Z", "size_readable": "", "public_url": "https://smoggy-graffiti.net/"}, {"id": "", "organization_id": "", "name": "", "path": "/usr/obj", "mime_type": "", "size": 503125, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-06-27T13:22:35.587Z", "version": "", "is_uploaded": false, "created_at": "2022-06-08T06:40:16.558Z", "size_readable": "", "public_url": "https://lumbering-charlatan.biz/"}, {"id": "", "organization_id": "", "name": "", "path": "/var/mail", "mime_type": "", "size": 126531, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-10-20T22:04:15.588Z", "version": "", "is_uploaded": false, "created_at": "2023-02-02T22:10:58.341Z", "size_readable": "", "public_url": "https://which-entry.biz/"}]}, "product_price": {"created_at": "2023-10-09T22:41:34.766Z", "modified_at": "2025-06-14T00:54:00.547Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 172495}, "discount": {"duration": "repeating", "type": "fixed", "amount": 659813, "currency": "Pound Sterling", "id": "", "name": "", "code": ""}, "organization": {"created_at": "2023-07-15T16:51:46.519Z", "modified_at": "2023-07-18T07:58:43.752Z", "id": "", "name": "", "slug": "", "avatar_url": "https://squiggly-conservative.name/", "bio": "", "company": "Parker - Funk", "blog": "", "location": "", "email": "Lelia.Lind1@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 359631, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 600341}, "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-07-17T07:58:43.752Z", "modified_at": "2023-01-25T05:31:14.324Z", "id": "", "metadata": {"key": "", "key1": 288739, "key2": true}, "slug": "", "name": "", "organization_id": ""}, "order": 278568, "required": false}, {"custom_field_id": "", "custom_field": {"created_at": "2024-10-25T18:06:03.198Z", "modified_at": "2024-04-16T00:02:14.300Z", "id": "", "metadata": {"key": "", "key1": ""}, "slug": "", "name": "", "organization_id": "", "properties": {"options": []}}, "order": 873793, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2024-05-04T04:20:49.023Z", "modified_at": "2024-10-19T23:21:29.133Z", "id": "", "metadata": {"key": false}, "slug": "", "name": "", "organization_id": ""}, "order": 458158, "required": true}]} "404": application/json: {"detail": ""} "422": @@ -2256,7 +2148,7 @@ examples: client_secret: "" responses: "200": - application/json: {"created_at": "2024-09-27T22:33:04.250Z", "modified_at": "2024-07-24T02:45:26.067Z", "id": "", "status": "confirmed", "client_secret": "", "url": "https://apt-devastation.biz/", "expires_at": "2022-07-30T06:29:51.767Z", "success_url": "https://secondary-gallery.net", "embed_origin": "", "amount": 662896, "tax_amount": 131007, "currency": "Nepalese Rupee", "subtotal_amount": 913267, "total_amount": 714568, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": false, "is_discount_applicable": false, "is_free_product_price": true, "is_payment_required": false, "is_payment_setup_required": false, "is_payment_form_required": false, "customer_id": "", "customer_name": "", "customer_email": "Maggie18@gmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Nigeria"}, "customer_tax_id": "", "product": {"created_at": "2023-01-28T03:25:59.665Z", "modified_at": "2022-01-24T16:41:51.515Z", "id": "", "name": "", "description": "potentially thread toady subsidy probable motionless obedience clear-cut", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2023-11-15T07:38:37.445Z", "modified_at": "2022-07-30T06:29:51.767Z", "id": "", "is_archived": false, "product_id": ""}], "benefits": [{"created_at": "2022-10-20T16:59:20.255Z", "modified_at": "2023-01-30T20:43:56.426Z", "id": "", "type": "downloadables", "description": "editor until ah daintily oof aw tarry impanel", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2024-07-26T21:52:00.436Z", "modified_at": "2024-03-11T23:49:19.061Z", "id": "", "type": "license_keys", "description": "forenenst aw or distorted legal cycle posh off", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2023-02-11T02:25:13.433Z", "modified_at": "2024-01-07T19:25:42.663Z", "id": "", "type": "discord", "description": "hovel yuck absentmindedly oh anti joyous psst tender", "selectable": false, "deletable": true, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/mnt", "mime_type": "", "size": 249646, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-06-10T13:10:48.480Z", "version": "", "is_uploaded": true, "created_at": "2022-02-28T04:49:04.106Z", "size_readable": "", "public_url": "https://glittering-confusion.biz/"}]}, "product_price": {"created_at": "2024-01-07T19:25:42.663Z", "modified_at": "2023-12-28T12:48:47.240Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 636092, "maximum_amount": 714568, "preset_amount": 682520}, "discount": {"duration": "forever", "type": "fixed", "basis_points": 613455, "id": "", "name": "", "code": ""}, "organization": {"created_at": "2024-01-09T08:11:20.495Z", "modified_at": "2024-08-15T01:27:14.128Z", "id": "", "name": "", "slug": "", "avatar_url": "https://clear-cut-deer.net", "bio": "", "company": "Hauck Inc", "blog": "", "location": "", "email": "Janae.Hirthe@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 851973, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 267069}, "attached_custom_fields": [], "customer_session_token": ""} + application/json: {"created_at": "2024-09-27T22:33:04.250Z", "modified_at": "2024-07-24T02:45:26.067Z", "id": "", "payment_processor": "stripe", "status": "confirmed", "client_secret": "", "url": "https://apt-devastation.biz/", "expires_at": "2022-07-30T06:29:51.767Z", "success_url": "https://secondary-gallery.net", "embed_origin": "", "amount": 662896, "tax_amount": 131007, "currency": "Nepalese Rupee", "subtotal_amount": 913267, "total_amount": 714568, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": false, "is_discount_applicable": false, "is_free_product_price": true, "is_payment_required": false, "is_payment_setup_required": false, "is_payment_form_required": false, "customer_id": "", "customer_name": "", "customer_email": "Maggie18@gmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Nigeria"}, "customer_tax_id": "", "product": {"created_at": "2023-01-28T03:25:59.665Z", "modified_at": "2022-01-24T16:41:51.515Z", "id": "", "name": "", "description": "potentially thread toady subsidy probable motionless obedience clear-cut", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2024-11-14T07:38:37.445Z", "modified_at": "2023-07-30T06:29:51.767Z", "id": "", "is_archived": false, "product_id": ""}], "benefits": [{"created_at": "2022-10-20T16:59:20.255Z", "modified_at": "2023-01-30T20:43:56.426Z", "id": "", "type": "downloadables", "description": "editor until ah daintily oof aw tarry impanel", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2024-07-26T21:52:00.436Z", "modified_at": "2024-03-11T23:49:19.061Z", "id": "", "type": "license_keys", "description": "forenenst aw or distorted legal cycle posh off", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2023-02-11T02:25:13.433Z", "modified_at": "2024-01-07T19:25:42.663Z", "id": "", "type": "discord", "description": "hovel yuck absentmindedly oh anti joyous psst tender", "selectable": false, "deletable": true, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/mnt", "mime_type": "", "size": 249646, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-06-10T13:10:48.480Z", "version": "", "is_uploaded": true, "created_at": "2022-02-28T04:49:04.106Z", "size_readable": "", "public_url": "https://glittering-confusion.biz/"}]}, "product_price": {"created_at": "2025-01-06T19:25:42.663Z", "modified_at": "2024-12-27T12:48:47.240Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 636092, "maximum_amount": 714568, "preset_amount": 682520}, "discount": {"duration": "forever", "type": "fixed", "basis_points": 613455, "id": "", "name": "", "code": ""}, "organization": {"created_at": "2024-01-09T08:11:20.495Z", "modified_at": "2024-08-15T01:27:14.128Z", "id": "", "name": "", "slug": "", "avatar_url": "https://clear-cut-deer.net", "bio": "", "company": "Hauck Inc", "blog": "", "location": "", "email": "Janae.Hirthe@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 851973, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 267069}, "attached_custom_fields": [], "customer_session_token": ""} "404": application/json: {"detail": ""} "422": @@ -2274,7 +2166,7 @@ examples: speakeasy-default-checkout-links:list: responses: "200": - application/json: {"items": [{"created_at": "2023-08-23T19:26:20.850Z", "modified_at": "2024-01-14T10:26:00.433Z", "id": "", "metadata": {}, "client_secret": "", "success_url": "https://crooked-overload.name/", "label": "", "allow_discount_codes": false, "product_id": "", "product_price_id": "", "discount_id": "", "product": {"created_at": "2023-08-23T19:26:20.850Z", "modified_at": "2024-01-14T10:26:00.433Z", "id": "", "name": "", "description": "bob inwardly beautifully comparison", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [], "benefits": [{"created_at": "2023-04-20T11:47:41.889Z", "modified_at": "2023-06-11T18:07:18.321Z", "id": "", "type": "custom", "description": "covenant safely briefly ugh fen phew reschedule", "selectable": false, "deletable": true, "organization_id": ""}], "medias": []}, "product_price": {"created_at": "2024-01-14T10:26:00.433Z", "modified_at": "2022-07-14T18:23:27.528Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 152837, "maximum_amount": 635532, "preset_amount": 639387}, "discount": {"duration": "repeating", "type": "fixed", "amount": 68504, "currency": "Zloty", "created_at": "2023-07-13T19:57:33.016Z", "modified_at": "2023-11-26T18:23:24.264Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2022-03-01T20:22:54.911Z", "ends_at": "2023-02-08T01:09:52.088Z", "max_redemptions": 485729, "redemptions_count": 73227, "organization_id": ""}, "url": "https://acidic-avalanche.info"}, {"created_at": "2023-06-17T08:36:51.636Z", "modified_at": "2022-03-22T06:10:55.267Z", "id": "", "metadata": {"key": "", "key1": "", "key2": ""}, "client_secret": "", "success_url": "https://ugly-jungle.com", "label": "", "allow_discount_codes": true, "product_id": "", "product_price_id": "", "discount_id": "", "product": {"created_at": "2022-07-23T04:36:11.110Z", "modified_at": "2022-08-16T08:48:23.679Z", "id": "", "name": "", "description": "meh yippee stigmatize minor", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [], "benefits": [], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/usr/src", "mime_type": "", "size": 24548, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-07-28T09:20:59.531Z", "version": "", "is_uploaded": true, "created_at": "2023-11-13T05:16:04.525Z", "size_readable": "", "public_url": "https://fantastic-toothpick.net/"}]}, "product_price": {"created_at": "2022-04-05T09:49:38.010Z", "modified_at": "2022-03-17T01:57:00.187Z", "id": "", "is_archived": false, "product_id": "", "recurring_interval": "year"}, "discount": {"duration": "once", "type": "fixed", "basis_points": 367745, "created_at": "2023-06-17T08:36:51.636Z", "modified_at": "2022-03-22T06:10:55.267Z", "id": "", "metadata": {"key": 876407, "key1": 51681, "key2": ""}, "name": "", "code": "", "starts_at": "2024-08-01T05:06:49.492Z", "ends_at": "2022-01-21T00:48:05.986Z", "max_redemptions": 897196, "redemptions_count": 424367, "organization_id": ""}, "url": "https://blue-technologist.com/"}, {"created_at": "2023-05-20T11:06:26.987Z", "modified_at": "2023-04-12T03:59:08.538Z", "id": "", "metadata": {"key": ""}, "client_secret": "", "success_url": "https://careless-lid.org/", "label": "", "allow_discount_codes": true, "product_id": "", "product_price_id": "", "discount_id": "", "product": {"created_at": "2022-06-09T01:19:27.771Z", "modified_at": "2023-09-20T19:57:30.820Z", "id": "", "name": "", "description": "early abseil noisily consequently husband since wonderfully ruin", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2022-03-24T06:20:14.879Z", "modified_at": "2024-09-10T04:30:13.188Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 460276}], "benefits": [{"created_at": "2024-07-30T17:58:06.895Z", "modified_at": "2023-06-28T18:50:42.778Z", "id": "", "type": "license_keys", "description": "owlishly which wonderfully CD whoa soap", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2023-04-20T11:47:41.889Z", "modified_at": "2023-06-11T18:07:18.321Z", "id": "", "type": "custom", "description": "covenant safely briefly ugh fen phew reschedule", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2023-08-28T04:17:07.015Z", "modified_at": "2022-04-26T06:24:09.264Z", "id": "", "type": "github_repository", "description": "stigmatize minor oh what steeple overheard swerve", "selectable": true, "deletable": true, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/home/user", "mime_type": "", "size": 841910, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-06-11T03:56:34.876Z", "version": "", "is_uploaded": true, "created_at": "2023-02-18T08:06:39.496Z", "size_readable": "", "public_url": "https://illustrious-design.org"}, {"id": "", "organization_id": "", "name": "", "path": "/sbin", "mime_type": "", "size": 20448, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-03-08T00:48:20.677Z", "version": "", "is_uploaded": false, "created_at": "2023-11-05T15:24:52.551Z", "size_readable": "", "public_url": "https://shiny-lift.biz/"}]}, "product_price": {"created_at": "2023-06-11T18:07:18.321Z", "modified_at": "2022-04-24T08:24:21.019Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 841031, "maximum_amount": 410206, "preset_amount": 863466, "recurring_interval": "month"}, "discount": {"duration": "forever", "type": "percentage", "amount": 65720, "currency": "Rial Omani", "created_at": "2023-03-24T19:09:17.797Z", "modified_at": "2022-09-28T14:04:50.967Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2024-11-11T02:33:24.486Z", "ends_at": "2023-02-07T13:50:00.322Z", "max_redemptions": 939917, "redemptions_count": 910479, "organization_id": ""}, "url": "https://animated-ostrich.org"}], "pagination": {"total_count": 918561, "max_page": 84189}} + application/json: {"items": [{"created_at": "2023-08-23T19:26:20.850Z", "modified_at": "2024-01-14T10:26:00.433Z", "id": "", "metadata": {}, "payment_processor": "stripe", "client_secret": "", "success_url": "https://crooked-overload.name/", "label": "", "allow_discount_codes": false, "product_id": "", "product_price_id": "", "discount_id": "", "product": {"created_at": "2023-08-23T19:26:20.850Z", "modified_at": "2024-01-14T10:26:00.433Z", "id": "", "name": "", "description": "bob inwardly beautifully comparison", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [], "benefits": [{"created_at": "2023-04-20T11:47:41.889Z", "modified_at": "2023-06-11T18:07:18.321Z", "id": "", "type": "custom", "description": "covenant safely briefly ugh fen phew reschedule", "selectable": false, "deletable": true, "organization_id": ""}], "medias": []}, "product_price": {"created_at": "2025-01-13T10:26:00.433Z", "modified_at": "2023-07-14T18:23:27.528Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 152837, "maximum_amount": 635532, "preset_amount": 639387}, "discount": {"duration": "repeating", "type": "fixed", "amount": 68504, "currency": "Zloty", "created_at": "2023-07-13T19:57:33.016Z", "modified_at": "2023-11-26T18:23:24.264Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2022-03-01T20:22:54.911Z", "ends_at": "2023-02-08T01:09:52.088Z", "max_redemptions": 485729, "redemptions_count": 73227, "organization_id": ""}, "url": "https://acidic-avalanche.info"}, {"created_at": "2023-06-17T08:36:51.636Z", "modified_at": "2022-03-22T06:10:55.267Z", "id": "", "metadata": {"key": "", "key1": "", "key2": ""}, "payment_processor": "stripe", "client_secret": "", "success_url": "https://ugly-jungle.com", "label": "", "allow_discount_codes": true, "product_id": "", "product_price_id": "", "discount_id": "", "product": {"created_at": "2022-07-23T04:36:11.110Z", "modified_at": "2022-08-16T08:48:23.679Z", "id": "", "name": "", "description": "meh yippee stigmatize minor", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [], "benefits": [], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/usr/src", "mime_type": "", "size": 24548, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-07-28T09:20:59.531Z", "version": "", "is_uploaded": true, "created_at": "2023-11-13T05:16:04.525Z", "size_readable": "", "public_url": "https://fantastic-toothpick.net/"}]}, "product_price": {"created_at": "2023-04-05T09:49:38.010Z", "modified_at": "2023-03-17T01:57:00.187Z", "id": "", "is_archived": false, "product_id": "", "recurring_interval": "year"}, "discount": {"duration": "once", "type": "fixed", "basis_points": 367745, "created_at": "2024-06-16T08:36:51.636Z", "modified_at": "2023-03-22T06:10:55.267Z", "id": "", "metadata": {"key": 876407, "key1": 51681, "key2": ""}, "name": "", "code": "", "starts_at": "2025-08-01T05:06:49.492Z", "ends_at": "2023-01-21T00:48:05.986Z", "max_redemptions": 897196, "redemptions_count": 424367, "organization_id": ""}, "url": "https://blue-technologist.com/"}, {"created_at": "2023-05-20T11:06:26.987Z", "modified_at": "2023-04-12T03:59:08.538Z", "id": "", "metadata": {"key": ""}, "payment_processor": "stripe", "client_secret": "", "success_url": "https://careless-lid.org/", "label": "", "allow_discount_codes": true, "product_id": "", "product_price_id": "", "discount_id": "", "product": {"created_at": "2022-06-09T01:19:27.771Z", "modified_at": "2023-09-20T19:57:30.820Z", "id": "", "name": "", "description": "early abseil noisily consequently husband since wonderfully ruin", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2023-03-24T06:20:14.879Z", "modified_at": "2025-09-10T04:30:13.188Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 460276}], "benefits": [{"created_at": "2024-07-30T17:58:06.895Z", "modified_at": "2023-06-28T18:50:42.778Z", "id": "", "type": "license_keys", "description": "owlishly which wonderfully CD whoa soap", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2023-04-20T11:47:41.889Z", "modified_at": "2023-06-11T18:07:18.321Z", "id": "", "type": "custom", "description": "covenant safely briefly ugh fen phew reschedule", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2023-08-28T04:17:07.015Z", "modified_at": "2022-04-26T06:24:09.264Z", "id": "", "type": "github_repository", "description": "stigmatize minor oh what steeple overheard swerve", "selectable": true, "deletable": true, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/home/user", "mime_type": "", "size": 841910, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-06-11T03:56:34.876Z", "version": "", "is_uploaded": true, "created_at": "2023-02-18T08:06:39.496Z", "size_readable": "", "public_url": "https://illustrious-design.org"}, {"id": "", "organization_id": "", "name": "", "path": "/sbin", "mime_type": "", "size": 20448, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-03-08T00:48:20.677Z", "version": "", "is_uploaded": false, "created_at": "2023-11-05T15:24:52.551Z", "size_readable": "", "public_url": "https://shiny-lift.biz/"}]}, "product_price": {"created_at": "2024-06-10T18:07:18.321Z", "modified_at": "2023-04-24T08:24:21.019Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 841031, "maximum_amount": 410206, "preset_amount": 863466, "recurring_interval": "month"}, "discount": {"duration": "forever", "type": "percentage", "amount": 65720, "currency": "Rial Omani", "created_at": "2023-03-24T19:09:17.797Z", "modified_at": "2022-09-28T14:04:50.967Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2024-11-11T02:33:24.486Z", "ends_at": "2023-02-07T13:50:00.322Z", "max_redemptions": 939917, "redemptions_count": 910479, "organization_id": ""}, "url": "https://animated-ostrich.org"}], "pagination": {"total_count": 918561, "max_page": 84189}} "422": application/json: {} checkout-links:create: @@ -2283,7 +2175,7 @@ examples: application/json: {"product_id": ""} responses: "201": - application/json: {"created_at": "2023-06-18T07:14:55.338Z", "modified_at": "2023-12-01T17:06:07.804Z", "id": "", "metadata": {"key": ""}, "client_secret": "", "success_url": "https://black-and-white-secrecy.org/", "label": "", "allow_discount_codes": false, "product_id": "", "product_price_id": "", "discount_id": "", "product": {"created_at": "2023-04-03T12:48:32.253Z", "modified_at": "2022-05-28T06:20:22.766Z", "id": "", "name": "", "description": "whereas geez pearl", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2022-05-28T06:20:22.766Z", "modified_at": "2022-03-17T15:39:20.911Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 951062, "maximum_amount": 86, "preset_amount": 169727}, {"created_at": "2024-06-13T23:30:51.782Z", "modified_at": "2023-10-05T11:56:21.731Z", "id": "", "is_archived": false, "product_id": "", "recurring_interval": "year"}], "benefits": [{"created_at": "2024-02-10T23:17:39.957Z", "modified_at": "2024-10-06T09:49:26.161Z", "id": "", "type": "downloadables", "description": "major misjudge yuck forager beneath please shadowy foodstuffs welcome", "selectable": true, "deletable": true, "organization_id": ""}, {"created_at": "2022-10-12T13:17:54.745Z", "modified_at": "2022-01-20T11:09:16.789Z", "id": "", "type": "discord", "description": "incidentally although whenever lively", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2023-06-23T14:29:34.219Z", "modified_at": "2023-06-22T12:00:27.656Z", "id": "", "type": "ads", "description": "aha while till lazily than clear-cut whoever defiantly indolent apud", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/media", "mime_type": "", "size": 455768, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-03-25T18:17:51.727Z", "version": "", "is_uploaded": true, "created_at": "2024-04-18T13:06:07.473Z", "size_readable": "", "public_url": "https://empty-crocodile.net/"}, {"id": "", "organization_id": "", "name": "", "path": "/etc", "mime_type": "", "size": 469637, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-04-17T03:46:14.915Z", "version": "", "is_uploaded": false, "created_at": "2024-06-08T10:10:45.569Z", "size_readable": "", "public_url": "https://frail-cash.net/"}, {"id": "", "organization_id": "", "name": "", "path": "/home/user", "mime_type": "", "size": 778234, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-03-19T20:27:20.803Z", "version": "", "is_uploaded": true, "created_at": "2024-11-04T15:57:11.475Z", "size_readable": "", "public_url": "https://gifted-verve.net/"}]}, "product_price": {"created_at": "2022-01-20T11:09:16.789Z", "modified_at": "2022-09-10T10:08:53.440Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 64738, "recurring_interval": "month"}, "discount": {"duration": "once", "type": "percentage", "amount": 339236, "currency": "Kwanza", "created_at": "2023-11-13T07:30:44.053Z", "modified_at": "2023-12-14T15:50:02.770Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2022-01-18T01:06:03.366Z", "ends_at": "2023-07-28T18:44:31.482Z", "max_redemptions": 27619, "redemptions_count": 659682, "organization_id": ""}, "url": "https://harmful-disposer.com"} + application/json: {"created_at": "2023-06-18T07:14:55.338Z", "modified_at": "2023-12-01T17:06:07.804Z", "id": "", "metadata": {"key": ""}, "payment_processor": "stripe", "client_secret": "", "success_url": "https://black-and-white-secrecy.org/", "label": "", "allow_discount_codes": false, "product_id": "", "product_price_id": "", "discount_id": "", "product": {"created_at": "2023-04-03T12:48:32.253Z", "modified_at": "2022-05-28T06:20:22.766Z", "id": "", "name": "", "description": "whereas geez pearl", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2023-05-28T06:20:22.766Z", "modified_at": "2023-03-17T15:39:20.911Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 951062, "maximum_amount": 86, "preset_amount": 169727}, {"created_at": "2025-06-13T23:30:51.782Z", "modified_at": "2024-10-04T11:56:21.731Z", "id": "", "is_archived": false, "product_id": "", "recurring_interval": "year"}], "benefits": [{"created_at": "2024-02-10T23:17:39.957Z", "modified_at": "2024-10-06T09:49:26.161Z", "id": "", "type": "downloadables", "description": "major misjudge yuck forager beneath please shadowy foodstuffs welcome", "selectable": true, "deletable": true, "organization_id": ""}, {"created_at": "2022-10-12T13:17:54.745Z", "modified_at": "2022-01-20T11:09:16.789Z", "id": "", "type": "discord", "description": "incidentally although whenever lively", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2023-06-23T14:29:34.219Z", "modified_at": "2023-06-22T12:00:27.656Z", "id": "", "type": "ads", "description": "aha while till lazily than clear-cut whoever defiantly indolent apud", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/media", "mime_type": "", "size": 455768, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-03-25T18:17:51.727Z", "version": "", "is_uploaded": true, "created_at": "2024-04-18T13:06:07.473Z", "size_readable": "", "public_url": "https://empty-crocodile.net/"}, {"id": "", "organization_id": "", "name": "", "path": "/etc", "mime_type": "", "size": 469637, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-04-17T03:46:14.915Z", "version": "", "is_uploaded": false, "created_at": "2024-06-08T10:10:45.569Z", "size_readable": "", "public_url": "https://frail-cash.net/"}, {"id": "", "organization_id": "", "name": "", "path": "/home/user", "mime_type": "", "size": 778234, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-03-19T20:27:20.803Z", "version": "", "is_uploaded": true, "created_at": "2024-11-04T15:57:11.475Z", "size_readable": "", "public_url": "https://gifted-verve.net/"}]}, "product_price": {"created_at": "2023-01-20T11:09:16.789Z", "modified_at": "2023-09-10T10:08:53.440Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 64738, "recurring_interval": "month"}, "discount": {"duration": "once", "type": "percentage", "amount": 339236, "currency": "Kwanza", "created_at": "2023-11-13T07:30:44.053Z", "modified_at": "2023-12-14T15:50:02.770Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2022-01-18T01:06:03.366Z", "ends_at": "2023-07-28T18:44:31.482Z", "max_redemptions": 27619, "redemptions_count": 659682, "organization_id": ""}, "url": "https://harmful-disposer.com"} "422": application/json: {} checkout-links:get: @@ -2293,7 +2185,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2024-02-07T13:54:48.821Z", "modified_at": "2023-09-05T11:33:52.011Z", "id": "", "metadata": {"key": "", "key1": ""}, "client_secret": "", "success_url": "https://willing-impostor.info", "label": "", "allow_discount_codes": false, "product_id": "", "product_price_id": "", "discount_id": "", "product": {"created_at": "2023-09-05T11:33:52.011Z", "modified_at": "2023-08-20T11:11:04.610Z", "id": "", "name": "", "description": "hundred whereas dimly unused cone restructure gadzooks", "is_recurring": false, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2023-08-20T11:11:04.610Z", "modified_at": "2023-07-26T06:33:15.810Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 458049, "maximum_amount": 450824, "preset_amount": 262795}, {"created_at": "2023-04-26T04:53:50.189Z", "modified_at": "2024-05-28T07:17:57.134Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "month"}, {"created_at": "2023-08-29T15:06:35.685Z", "modified_at": "2024-06-02T05:45:06.910Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 746585, "recurring_interval": "year"}], "benefits": [{"created_at": "2022-12-20T13:59:56.783Z", "modified_at": "2022-12-21T05:04:07.004Z", "id": "", "type": "github_repository", "description": "unused cone restructure gadzooks", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2023-08-08T22:42:08.632Z", "modified_at": "2022-08-06T23:04:38.947Z", "id": "", "type": "discord", "description": "given given even save amid", "selectable": false, "deletable": false, "organization_id": ""}], "medias": []}, "product_price": {"created_at": "2022-12-21T05:04:07.004Z", "modified_at": "2022-07-14T09:41:03.922Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 780262}, "discount": {"duration": "once", "duration_in_months": 831606, "type": "fixed", "basis_points": 609810, "created_at": "2023-10-15T11:09:33.114Z", "modified_at": "2022-12-03T01:17:26.514Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2022-12-16T03:27:58.537Z", "ends_at": "2023-09-19T16:10:36.165Z", "max_redemptions": 460547, "redemptions_count": 327906, "organization_id": ""}, "url": "https://burdensome-marketplace.net/"} + application/json: {"created_at": "2024-02-07T13:54:48.821Z", "modified_at": "2023-09-05T11:33:52.011Z", "id": "", "metadata": {"key": "", "key1": ""}, "payment_processor": "stripe", "client_secret": "", "success_url": "https://willing-impostor.info", "label": "", "allow_discount_codes": false, "product_id": "", "product_price_id": "", "discount_id": "", "product": {"created_at": "2023-09-05T11:33:52.011Z", "modified_at": "2023-08-20T11:11:04.610Z", "id": "", "name": "", "description": "hundred whereas dimly unused cone restructure gadzooks", "is_recurring": false, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2024-08-19T11:11:04.610Z", "modified_at": "2024-07-25T06:33:15.810Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 458049, "maximum_amount": 450824, "preset_amount": 262795}, {"created_at": "2024-04-25T04:53:50.189Z", "modified_at": "2025-05-28T07:17:57.134Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "month"}, {"created_at": "2024-08-28T15:06:35.685Z", "modified_at": "2025-06-02T05:45:06.910Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 746585, "recurring_interval": "year"}], "benefits": [{"created_at": "2022-12-20T13:59:56.783Z", "modified_at": "2022-12-21T05:04:07.004Z", "id": "", "type": "github_repository", "description": "unused cone restructure gadzooks", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2023-08-08T22:42:08.632Z", "modified_at": "2022-08-06T23:04:38.947Z", "id": "", "type": "discord", "description": "given given even save amid", "selectable": false, "deletable": false, "organization_id": ""}], "medias": []}, "product_price": {"created_at": "2023-12-21T05:04:07.004Z", "modified_at": "2023-07-14T09:41:03.922Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 780262}, "discount": {"duration": "once", "duration_in_months": 831606, "type": "fixed", "basis_points": 609810, "created_at": "2023-10-15T11:09:33.114Z", "modified_at": "2022-12-03T01:17:26.514Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2022-12-16T03:27:58.537Z", "ends_at": "2023-09-19T16:10:36.165Z", "max_redemptions": 460547, "redemptions_count": 327906, "organization_id": ""}, "url": "https://burdensome-marketplace.net/"} "404": application/json: {"detail": ""} "422": @@ -2305,7 +2197,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2024-07-28T19:04:48.565Z", "modified_at": "2023-10-17T10:52:42.015Z", "id": "", "metadata": {"key": ""}, "client_secret": "", "success_url": "https://powerless-juggernaut.org", "label": "", "allow_discount_codes": false, "product_id": "", "product_price_id": "", "discount_id": "", "product": {"created_at": "2023-10-17T10:52:42.015Z", "modified_at": "2023-01-13T16:52:57.274Z", "id": "", "name": "", "description": "happily scowl mostly rekindle bleak from that qualified cycle woot", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2023-01-13T16:52:57.274Z", "modified_at": "2024-12-22T15:27:45.882Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 488852, "maximum_amount": 984008, "preset_amount": 54062}, {"created_at": "2022-12-08T09:52:54.805Z", "modified_at": "2022-10-01T09:16:09.932Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 789275, "maximum_amount": 889838, "preset_amount": 302461}, {"created_at": "2024-01-31T02:01:14.461Z", "modified_at": "2023-03-20T01:46:46.018Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "year"}], "benefits": [{"created_at": "2023-04-01T23:04:03.133Z", "modified_at": "2022-03-06T08:10:15.601Z", "id": "", "type": "license_keys", "description": "hydrolyze lazily whenever how what", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2024-12-04T12:28:11.360Z", "modified_at": "2023-03-15T23:04:44.967Z", "id": "", "type": "ads", "description": "big into loyalty misguided configuration pop gah function repentant", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/lib", "mime_type": "", "size": 454586, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-01-25T20:29:41.475Z", "version": "", "is_uploaded": false, "created_at": "2023-01-17T09:41:03.229Z", "size_readable": "", "public_url": "https://late-fork.com/"}, {"id": "", "organization_id": "", "name": "", "path": "/private/tmp", "mime_type": "", "size": 195473, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-05-05T14:01:10.128Z", "version": "", "is_uploaded": true, "created_at": "2022-01-25T05:41:04.406Z", "size_readable": "", "public_url": "https://short-gradient.info/"}]}, "product_price": {"created_at": "2023-07-04T05:50:56.527Z", "modified_at": "2022-05-02T19:54:17.078Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 352933, "maximum_amount": 824679, "preset_amount": 834574}, "discount": {"duration": "repeating", "duration_in_months": 519881, "type": "fixed", "basis_points": 549807, "created_at": "2023-09-28T11:11:37.204Z", "modified_at": "2023-07-18T17:44:43.444Z", "id": "", "metadata": {"key": "", "key1": "", "key2": 656776}, "name": "", "code": "", "starts_at": "2022-05-11T11:35:19.480Z", "ends_at": "2023-10-30T12:26:21.815Z", "max_redemptions": 3515, "redemptions_count": 479889, "organization_id": ""}, "url": "https://uniform-euphonium.info"} + application/json: {"created_at": "2024-07-28T19:04:48.565Z", "modified_at": "2023-10-17T10:52:42.015Z", "id": "", "metadata": {"key": ""}, "payment_processor": "stripe", "client_secret": "", "success_url": "https://powerless-juggernaut.org", "label": "", "allow_discount_codes": false, "product_id": "", "product_price_id": "", "discount_id": "", "product": {"created_at": "2023-10-17T10:52:42.015Z", "modified_at": "2023-01-13T16:52:57.274Z", "id": "", "name": "", "description": "happily scowl mostly rekindle bleak from that qualified cycle woot", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2024-01-13T16:52:57.274Z", "modified_at": "2025-12-22T15:27:45.882Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 488852, "maximum_amount": 984008, "preset_amount": 54062}, {"created_at": "2023-12-08T09:52:54.805Z", "modified_at": "2023-10-01T09:16:09.932Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 789275, "maximum_amount": 889838, "preset_amount": 302461}, {"created_at": "2025-01-30T02:01:14.461Z", "modified_at": "2024-03-19T01:46:46.018Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "year"}], "benefits": [{"created_at": "2023-04-01T23:04:03.133Z", "modified_at": "2022-03-06T08:10:15.601Z", "id": "", "type": "license_keys", "description": "hydrolyze lazily whenever how what", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2024-12-04T12:28:11.360Z", "modified_at": "2023-03-15T23:04:44.967Z", "id": "", "type": "ads", "description": "big into loyalty misguided configuration pop gah function repentant", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/lib", "mime_type": "", "size": 454586, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-01-25T20:29:41.475Z", "version": "", "is_uploaded": false, "created_at": "2023-01-17T09:41:03.229Z", "size_readable": "", "public_url": "https://late-fork.com/"}, {"id": "", "organization_id": "", "name": "", "path": "/private/tmp", "mime_type": "", "size": 195473, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-05-05T14:01:10.128Z", "version": "", "is_uploaded": true, "created_at": "2022-01-25T05:41:04.406Z", "size_readable": "", "public_url": "https://short-gradient.info/"}]}, "product_price": {"created_at": "2024-07-03T05:50:56.527Z", "modified_at": "2023-05-02T19:54:17.078Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 352933, "maximum_amount": 824679, "preset_amount": 834574}, "discount": {"duration": "repeating", "duration_in_months": 519881, "type": "fixed", "basis_points": 549807, "created_at": "2024-09-27T11:11:37.204Z", "modified_at": "2024-07-17T17:44:43.444Z", "id": "", "metadata": {"key": "", "key1": "", "key2": 656776}, "name": "", "code": "", "starts_at": "2023-05-11T11:35:19.480Z", "ends_at": "2024-10-29T12:26:21.815Z", "max_redemptions": 3515, "redemptions_count": 479889, "organization_id": ""}, "url": "https://uniform-euphonium.info"} "404": application/json: {"detail": ""} "422": @@ -2324,7 +2216,7 @@ examples: speakeasy-default-custom-fields:list: responses: "200": - application/json: {"items": [{"created_at": "2023-08-23T19:26:20.850Z", "modified_at": "2024-01-14T10:26:00.433Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": "", "properties": {"options": []}}, {"created_at": "2023-11-28T13:02:27.296Z", "modified_at": "2023-12-02T18:25:37.169Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, {"created_at": "2022-04-05T09:49:38.010Z", "modified_at": "2022-03-17T01:57:00.187Z", "id": "", "metadata": {"key": 633911, "key1": ""}, "slug": "", "name": "", "organization_id": "", "properties": {"options": []}}], "pagination": {"total_count": 633911, "max_page": 7468}} + application/json: {"items": [{"created_at": "2024-08-22T19:26:20.850Z", "modified_at": "2025-01-13T10:26:00.433Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": "", "properties": {"options": []}}, {"created_at": "2024-11-27T13:02:27.296Z", "modified_at": "2024-12-01T18:25:37.169Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, {"created_at": "2023-04-05T09:49:38.010Z", "modified_at": "2023-03-17T01:57:00.187Z", "id": "", "metadata": {"key": 633911, "key1": ""}, "slug": "", "name": "", "organization_id": "", "properties": {"options": []}}], "pagination": {"total_count": 633911, "max_page": 7468}} "422": application/json: {} custom-fields:create: @@ -2333,7 +2225,7 @@ examples: application/json: {"slug": "", "name": ""} responses: "201": - application/json: {"created_at": "2023-04-03T12:48:32.253Z", "modified_at": "2022-05-28T06:20:22.766Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": "", "properties": {"options": [{"value": "", "label": ""}, {"value": "", "label": ""}, {"value": "", "label": ""}]}} + application/json: {"created_at": "2024-04-02T12:48:32.253Z", "modified_at": "2023-05-28T06:20:22.766Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": "", "properties": {"options": [{"value": "", "label": ""}, {"value": "", "label": ""}, {"value": "", "label": ""}]}} "422": application/json: {} custom-fields:get: @@ -2343,7 +2235,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2023-09-05T11:33:52.011Z", "modified_at": "2023-08-20T11:11:04.610Z", "id": "", "metadata": {"key": true, "key1": 262795}, "slug": "", "name": "", "organization_id": "", "properties": {"options": []}} + application/json: {"created_at": "2024-09-04T11:33:52.011Z", "modified_at": "2024-08-19T11:11:04.610Z", "id": "", "metadata": {"key": true, "key1": 262795}, "slug": "", "name": "", "organization_id": "", "properties": {"options": []}} "404": application/json: {"detail": ""} "422": @@ -2355,7 +2247,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2023-01-13T16:52:57.274Z", "modified_at": "2024-12-22T15:27:45.882Z", "id": "", "metadata": {"key": 984008, "key1": ""}, "slug": "", "name": "", "organization_id": ""} + application/json: {"created_at": "2024-01-13T16:52:57.274Z", "modified_at": "2025-12-22T15:27:45.882Z", "id": "", "metadata": {"key": 984008, "key1": ""}, "slug": "", "name": "", "organization_id": ""} "404": application/json: {"detail": ""} "422": @@ -2374,12 +2266,12 @@ examples: speakeasy-default-oauth2-:authorize: responses: "200": - application/json: {"client": {"created_at": "2022-05-14T00:33:15.801Z", "modified_at": "2022-01-08T10:23:26.945Z", "client_id": "", "client_name": "", "client_uri": "https://thrifty-excess.biz/", "logo_uri": "https://zany-morbidity.info/", "tos_uri": "https://noted-digit.com/", "policy_uri": "https://that-airmail.info"}, "sub": {"id": "", "email": "Frederic48@hotmail.com", "avatar_url": "https://burdensome-institute.info"}, "scopes": ["license_keys:read", "checkout_links:read"]} + application/json: {"client": {"created_at": "2023-05-14T00:33:15.801Z", "modified_at": "2023-01-08T10:23:26.945Z", "client_id": "", "client_name": "", "client_uri": "https://thrifty-excess.biz/", "logo_uri": "https://zany-morbidity.info/", "tos_uri": "https://noted-digit.com/", "policy_uri": "https://that-airmail.info"}, "sub": {"id": "", "email": "Frederic48@hotmail.com", "avatar_url": "https://burdensome-institute.info"}, "scopes": ["license_keys:read", "checkout_links:read"]} discounts:list: speakeasy-default-discounts:list: responses: "200": - application/json: {"items": [{"duration": "forever", "duration_in_months": 678317, "type": "fixed", "basis_points": 229716, "created_at": "2022-06-17T12:14:27.999Z", "modified_at": "2023-11-28T13:02:27.296Z", "id": "", "metadata": {"key": "", "key1": true}, "name": "", "code": "", "starts_at": "2022-03-17T01:57:00.187Z", "ends_at": "2024-01-25T00:05:25.844Z", "max_redemptions": 509883, "redemptions_count": 633911, "organization_id": "", "products": []}, {"duration": "forever", "type": "fixed", "amount": 73227, "currency": "Tala", "created_at": "2023-09-14T22:04:07.138Z", "modified_at": "2024-08-18T13:00:42.665Z", "id": "", "metadata": {"key": ""}, "name": "", "code": "", "starts_at": "2022-12-20T13:34:28.286Z", "ends_at": "2024-08-01T05:06:49.492Z", "max_redemptions": 18278, "redemptions_count": 897196, "organization_id": "", "products": [{"created_at": "2024-09-28T03:47:03.515Z", "modified_at": "2022-07-09T16:58:41.012Z", "id": "", "name": "", "description": "brook cleverly blossom", "is_recurring": false, "is_archived": false, "organization_id": ""}]}, {"duration": "repeating", "duration_in_months": 996014, "type": "fixed", "basis_points": 164965, "created_at": "2022-03-23T01:47:30.770Z", "modified_at": "2024-07-06T02:51:23.749Z", "id": "", "metadata": {"key": "", "key1": 284580, "key2": false}, "name": "", "code": "", "starts_at": "2022-03-15T10:11:56.132Z", "ends_at": "2022-03-08T17:05:22.411Z", "max_redemptions": 294083, "redemptions_count": 993305, "organization_id": "", "products": [{"created_at": "2022-10-11T19:17:33.283Z", "modified_at": "2022-12-22T07:54:29.563Z", "id": "", "name": "", "description": "memorise ruin apparatus", "is_recurring": false, "is_archived": true, "organization_id": ""}, {"created_at": "2023-03-22T09:41:56.524Z", "modified_at": "2022-03-28T18:28:26.777Z", "id": "", "name": "", "description": "tenement commonly softly", "is_recurring": false, "is_archived": true, "organization_id": ""}]}], "pagination": {"total_count": 551258, "max_page": 105170}} + application/json: {"items": [{"duration": "forever", "duration_in_months": 678317, "type": "fixed", "basis_points": 229716, "created_at": "2023-06-17T12:14:27.999Z", "modified_at": "2024-11-27T13:02:27.296Z", "id": "", "metadata": {"key": "", "key1": true}, "name": "", "code": "", "starts_at": "2023-03-17T01:57:00.187Z", "ends_at": "2025-01-24T00:05:25.844Z", "max_redemptions": 509883, "redemptions_count": 633911, "organization_id": "", "products": []}, {"duration": "forever", "type": "fixed", "amount": 73227, "currency": "Tala", "created_at": "2024-09-13T22:04:07.138Z", "modified_at": "2025-08-18T13:00:42.665Z", "id": "", "metadata": {"key": ""}, "name": "", "code": "", "starts_at": "2023-12-20T13:34:28.286Z", "ends_at": "2025-08-01T05:06:49.492Z", "max_redemptions": 18278, "redemptions_count": 897196, "organization_id": "", "products": [{"created_at": "2025-09-28T03:47:03.515Z", "modified_at": "2023-07-09T16:58:41.012Z", "id": "", "name": "", "description": "brook cleverly blossom", "is_recurring": false, "is_archived": false, "organization_id": ""}]}, {"duration": "repeating", "duration_in_months": 996014, "type": "fixed", "basis_points": 164965, "created_at": "2023-03-23T01:47:30.770Z", "modified_at": "2025-07-06T02:51:23.749Z", "id": "", "metadata": {"key": "", "key1": 284580, "key2": false}, "name": "", "code": "", "starts_at": "2023-03-15T10:11:56.132Z", "ends_at": "2023-03-08T17:05:22.411Z", "max_redemptions": 294083, "redemptions_count": 993305, "organization_id": "", "products": [{"created_at": "2023-10-11T19:17:33.283Z", "modified_at": "2023-12-22T07:54:29.563Z", "id": "", "name": "", "description": "memorise ruin apparatus", "is_recurring": false, "is_archived": true, "organization_id": ""}, {"created_at": "2024-03-21T09:41:56.524Z", "modified_at": "2023-03-28T18:28:26.777Z", "id": "", "name": "", "description": "tenement commonly softly", "is_recurring": false, "is_archived": true, "organization_id": ""}]}], "pagination": {"total_count": 551258, "max_page": 105170}} "422": application/json: {} discounts:create: @@ -2398,7 +2290,7 @@ examples: id: "" responses: "200": - application/json: {"duration": "forever", "type": "percentage", "basis_points": 521235, "created_at": "2024-11-29T01:50:48.954Z", "modified_at": "2023-05-18T00:32:02.244Z", "id": "", "metadata": {"key": ""}, "name": "", "code": "", "starts_at": "2022-08-22T22:47:10.166Z", "ends_at": "2024-10-24T02:41:21.259Z", "max_redemptions": 438142, "redemptions_count": 801373, "organization_id": "", "products": []} + application/json: {"duration": "forever", "type": "percentage", "basis_points": 521235, "created_at": "2025-11-29T01:50:48.954Z", "modified_at": "2024-05-17T00:32:02.244Z", "id": "", "metadata": {"key": ""}, "name": "", "code": "", "starts_at": "2023-08-22T22:47:10.166Z", "ends_at": "2025-10-24T02:41:21.259Z", "max_redemptions": 438142, "redemptions_count": 801373, "organization_id": "", "products": []} "404": application/json: {"detail": ""} "422": @@ -2428,7 +2320,7 @@ examples: _endpointcheckout_created_post: speakeasy-default-endpointcheckout-created-post: requestBody: - application/json: {"data": {"created_at": "2024-11-12T14:26:42.882Z", "modified_at": "2023-05-28T05:08:06.235Z", "id": "", "status": "failed", "client_secret": "", "url": "https://heavy-beret.com/", "expires_at": "2022-02-25T02:26:48.460Z", "success_url": "https://sardonic-final.info/", "embed_origin": "", "amount": 962818, "tax_amount": 6400, "currency": "Yen", "subtotal_amount": 648726, "total_amount": 210702, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": true, "is_discount_applicable": false, "is_free_product_price": false, "is_payment_required": false, "is_payment_setup_required": false, "is_payment_form_required": false, "customer_id": "", "customer_name": "", "customer_email": "Ryley_Erdman@hotmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "South Africa"}, "customer_tax_id": "", "metadata": {"key": 18677, "key1": 95370}, "product": {"created_at": "2022-04-02T00:05:42.586Z", "modified_at": "2023-12-16T03:02:38.803Z", "id": "", "name": "", "description": "for embarrassment untidy long-term near honestly separate yet", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2024-11-19T15:59:15.588Z", "modified_at": "2022-11-17T00:11:23.972Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 75876, "maximum_amount": 82334, "preset_amount": 50275}], "benefits": [{"created_at": "2023-08-22T00:47:02.059Z", "modified_at": "2023-06-04T10:32:44.101Z", "id": "", "type": "license_keys", "description": "within jacket unless", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/private/var", "mime_type": "", "size": 245189, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-11-03T15:00:03.276Z", "version": "", "is_uploaded": false, "created_at": "2024-06-07T13:47:02.365Z", "size_readable": "", "public_url": "https://webbed-experience.name/"}]}, "product_price": {"created_at": "2022-12-28T20:59:29.904Z", "modified_at": "2023-04-04T00:20:23.805Z", "id": "", "is_archived": false, "product_id": "", "recurring_interval": "month"}, "discount": {"duration": "repeating", "type": "fixed", "basis_points": 341163, "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2023-12-13T00:05:03.649Z", "modified_at": "2022-08-19T22:18:44.316Z", "id": "", "metadata": {"key": false}, "slug": "", "name": "", "organization_id": ""}, "order": 996863, "required": false}, {"custom_field_id": "", "custom_field": {"created_at": "2024-01-25T18:08:49.597Z", "modified_at": "2024-07-22T12:18:02.066Z", "id": "", "metadata": {"key": true, "key1": "", "key2": 385218}, "slug": "", "name": "", "organization_id": ""}, "order": 72589, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2024-06-25T22:47:14.264Z", "modified_at": "2024-01-28T19:10:37.564Z", "id": "", "metadata": {"key": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 161325, "required": true}], "customer_metadata": {"key": "", "key1": ""}}} + application/json: {"data": {"created_at": "2024-11-12T14:26:42.882Z", "modified_at": "2023-05-28T05:08:06.235Z", "id": "", "payment_processor": "stripe", "status": "failed", "client_secret": "", "url": "https://heavy-beret.com/", "expires_at": "2022-02-25T02:26:48.460Z", "success_url": "https://sardonic-final.info/", "embed_origin": "", "amount": 962818, "tax_amount": 6400, "currency": "Yen", "subtotal_amount": 648726, "total_amount": 210702, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": true, "is_discount_applicable": false, "is_free_product_price": false, "is_payment_required": false, "is_payment_setup_required": false, "is_payment_form_required": false, "customer_id": "", "customer_name": "", "customer_email": "Ryley_Erdman@hotmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "South Africa"}, "customer_tax_id": "", "metadata": {"key": 18677, "key1": 95370}, "product": {"created_at": "2022-04-02T00:05:42.586Z", "modified_at": "2023-12-16T03:02:38.803Z", "id": "", "name": "", "description": "for embarrassment untidy long-term near honestly separate yet", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2025-11-19T15:59:15.588Z", "modified_at": "2023-11-17T00:11:23.972Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 75876, "maximum_amount": 82334, "preset_amount": 50275}], "benefits": [{"created_at": "2023-08-22T00:47:02.059Z", "modified_at": "2023-06-04T10:32:44.101Z", "id": "", "type": "license_keys", "description": "within jacket unless", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/private/var", "mime_type": "", "size": 245189, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-11-03T15:00:03.276Z", "version": "", "is_uploaded": false, "created_at": "2024-06-07T13:47:02.365Z", "size_readable": "", "public_url": "https://webbed-experience.name/"}]}, "product_price": {"created_at": "2023-12-28T20:59:29.904Z", "modified_at": "2024-04-03T00:20:23.805Z", "id": "", "is_archived": false, "product_id": "", "recurring_interval": "month"}, "discount": {"duration": "repeating", "type": "fixed", "basis_points": 341163, "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-12-12T00:05:03.649Z", "modified_at": "2023-08-19T22:18:44.316Z", "id": "", "metadata": {"key": false}, "slug": "", "name": "", "organization_id": ""}, "order": 996863, "required": false}, {"custom_field_id": "", "custom_field": {"created_at": "2025-01-24T18:08:49.597Z", "modified_at": "2025-07-22T12:18:02.066Z", "id": "", "metadata": {"key": true, "key1": "", "key2": 385218}, "slug": "", "name": "", "organization_id": ""}, "order": 72589, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2025-06-25T22:47:14.264Z", "modified_at": "2025-01-27T19:10:37.564Z", "id": "", "metadata": {"key": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 161325, "required": true}], "customer_metadata": {"key": "", "key1": ""}}} responses: "200": application/json: "" @@ -2437,7 +2329,7 @@ examples: _endpointcheckout_updated_post: speakeasy-default-endpointcheckout-updated-post: requestBody: - application/json: {"data": {"created_at": "2024-10-04T13:06:10.658Z", "modified_at": "2023-10-03T21:25:15.366Z", "id": "", "status": "failed", "client_secret": "", "url": "https://square-cafe.biz/", "expires_at": "2024-03-25T08:55:11.873Z", "success_url": "https://physical-import.name/", "embed_origin": "", "amount": 245418, "tax_amount": 624213, "currency": "Naira", "subtotal_amount": 24587, "total_amount": 447013, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": true, "is_discount_applicable": true, "is_free_product_price": true, "is_payment_required": false, "is_payment_setup_required": false, "is_payment_form_required": true, "customer_id": "", "customer_name": "", "customer_email": "Jairo39@hotmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Greenland"}, "customer_tax_id": "", "metadata": {}, "product": {"created_at": "2024-01-25T14:28:29.444Z", "modified_at": "2024-09-21T12:18:51.327Z", "id": "", "name": "", "description": "engender reopen yahoo draft", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2024-10-20T04:48:05.954Z", "modified_at": "2023-03-13T21:45:21.173Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 108579, "maximum_amount": 316079, "preset_amount": 743040}], "benefits": [{"created_at": "2024-04-09T09:30:36.910Z", "modified_at": "2022-10-16T19:52:50.377Z", "id": "", "type": "github_repository", "description": "posh hm meatloaf politely ugh fidget to inborn putrid", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2023-12-31T03:17:46.406Z", "modified_at": "2022-11-12T16:32:46.306Z", "id": "", "type": "license_keys", "description": "blah likewise whose notwithstanding airline aboard frightened enfold colorfully", "selectable": true, "deletable": true, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/home/user", "mime_type": "", "size": 767806, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-01-15T18:22:33.094Z", "version": "", "is_uploaded": false, "created_at": "2023-02-14T06:20:54.950Z", "size_readable": "", "public_url": "https://pushy-tomatillo.org/"}, {"id": "", "organization_id": "", "name": "", "path": "/private", "mime_type": "", "size": 432333, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-03-08T18:51:14.729Z", "version": "", "is_uploaded": false, "created_at": "2022-11-18T09:33:10.032Z", "size_readable": "", "public_url": "https://affectionate-charm.net"}]}, "product_price": {"created_at": "2023-05-16T07:46:47.748Z", "modified_at": "2023-10-04T07:55:07.025Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 624213, "maximum_amount": 615580, "preset_amount": 24587, "recurring_interval": "month"}, "discount": {"duration": "once", "type": "percentage", "amount": 883154, "currency": "East Caribbean Dollar", "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2023-04-19T00:52:44.462Z", "modified_at": "2022-09-21T13:33:23.592Z", "id": "", "metadata": {"key": 226088, "key1": true, "key2": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 108303, "required": false}], "customer_metadata": {"key": 396660, "key1": true, "key2": ""}}} + application/json: {"data": {"created_at": "2024-10-04T13:06:10.658Z", "modified_at": "2023-10-03T21:25:15.366Z", "id": "", "payment_processor": "stripe", "status": "failed", "client_secret": "", "url": "https://square-cafe.biz/", "expires_at": "2024-03-25T08:55:11.873Z", "success_url": "https://physical-import.name/", "embed_origin": "", "amount": 245418, "tax_amount": 624213, "currency": "Naira", "subtotal_amount": 24587, "total_amount": 447013, "product_id": "", "product_price_id": "", "discount_id": "", "allow_discount_codes": true, "is_discount_applicable": true, "is_free_product_price": true, "is_payment_required": false, "is_payment_setup_required": false, "is_payment_form_required": true, "customer_id": "", "customer_name": "", "customer_email": "Jairo39@hotmail.com", "customer_ip_address": "", "customer_billing_address": {"country": "Greenland"}, "customer_tax_id": "", "metadata": {}, "product": {"created_at": "2024-01-25T14:28:29.444Z", "modified_at": "2024-09-21T12:18:51.327Z", "id": "", "name": "", "description": "engender reopen yahoo draft", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2025-10-20T04:48:05.954Z", "modified_at": "2024-03-12T21:45:21.173Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 108579, "maximum_amount": 316079, "preset_amount": 743040}], "benefits": [{"created_at": "2024-04-09T09:30:36.910Z", "modified_at": "2022-10-16T19:52:50.377Z", "id": "", "type": "github_repository", "description": "posh hm meatloaf politely ugh fidget to inborn putrid", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2023-12-31T03:17:46.406Z", "modified_at": "2022-11-12T16:32:46.306Z", "id": "", "type": "license_keys", "description": "blah likewise whose notwithstanding airline aboard frightened enfold colorfully", "selectable": true, "deletable": true, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/home/user", "mime_type": "", "size": 767806, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-01-15T18:22:33.094Z", "version": "", "is_uploaded": false, "created_at": "2023-02-14T06:20:54.950Z", "size_readable": "", "public_url": "https://pushy-tomatillo.org/"}, {"id": "", "organization_id": "", "name": "", "path": "/private", "mime_type": "", "size": 432333, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-03-08T18:51:14.729Z", "version": "", "is_uploaded": false, "created_at": "2022-11-18T09:33:10.032Z", "size_readable": "", "public_url": "https://affectionate-charm.net"}]}, "product_price": {"created_at": "2024-05-15T07:46:47.748Z", "modified_at": "2024-10-03T07:55:07.025Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 624213, "maximum_amount": 615580, "preset_amount": 24587, "recurring_interval": "month"}, "discount": {"duration": "once", "type": "percentage", "amount": 883154, "currency": "East Caribbean Dollar", "id": "", "name": "", "code": ""}, "subscription_id": "", "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-04-18T00:52:44.462Z", "modified_at": "2023-09-21T13:33:23.592Z", "id": "", "metadata": {"key": 226088, "key1": true, "key2": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 108303, "required": false}], "customer_metadata": {"key": 396660, "key1": true, "key2": ""}}} responses: "200": application/json: "" @@ -2446,7 +2338,7 @@ examples: _endpointorder_created_post: speakeasy-default-endpointorder-created-post: requestBody: - application/json: {"data": {"created_at": "2023-11-12T12:46:15.007Z", "modified_at": "2023-03-24T03:54:38.261Z", "id": "", "metadata": {"key": "", "key1": ""}, "amount": 485666, "tax_amount": 81588, "currency": "Metical", "billing_reason": "subscription_cycle", "billing_address": {"country": "Hungary"}, "customer_id": "", "product_id": "", "product_price_id": "", "discount_id": "", "subscription_id": "", "checkout_id": "", "customer": {"created_at": "2023-11-12T12:46:15.007Z", "modified_at": "2023-03-24T03:54:38.261Z", "id": "", "metadata": {"key": "", "key1": ""}, "email": "Arnaldo.Ritchie@yahoo.com", "email_verified": false, "name": "", "billing_address": {"country": "Wallis and Futuna"}, "tax_id": ["", "", "eu_vat"], "organization_id": "", "avatar_url": "https://burly-developing.org/"}, "user_id": "", "user": {"id": "", "email": "Karina_Wyman32@gmail.com", "public_name": ""}, "product": {"created_at": "2022-09-26T00:50:02.940Z", "modified_at": "2024-08-11T14:36:04.800Z", "id": "", "name": "", "description": "rich digit raw following unlike", "is_recurring": true, "is_archived": false, "organization_id": ""}, "product_price": {"created_at": "2024-03-27T08:15:55.821Z", "modified_at": "2022-11-08T15:41:27.758Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 485666, "maximum_amount": 81588, "preset_amount": 605593}, "discount": {"duration": "forever", "type": "fixed", "basis_points": 543579, "created_at": "2024-09-23T11:59:51.286Z", "modified_at": "2024-12-14T00:30:10.871Z", "id": "", "metadata": {"key": "", "key1": "", "key2": 386855}, "name": "", "code": "", "starts_at": "2022-01-27T10:40:59.012Z", "ends_at": "2022-04-15T20:14:00.592Z", "max_redemptions": 244557, "redemptions_count": 870081, "organization_id": ""}, "subscription": {"metadata": {"key": "", "key1": "", "key2": ""}, "created_at": "2022-12-14T21:08:51.727Z", "modified_at": "2022-08-24T00:05:31.570Z", "id": "", "amount": 133794, "currency": "Tugrik", "recurring_interval": "year", "status": "trialing", "current_period_start": "2024-07-08T11:23:20.087Z", "current_period_end": "2024-05-25T08:53:21.161Z", "cancel_at_period_end": true, "started_at": "2024-05-09T06:10:47.548Z", "ended_at": "2024-02-14T18:51:37.875Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": ""}}} + application/json: {"data": {"created_at": "2023-11-12T12:46:15.007Z", "modified_at": "2023-03-24T03:54:38.261Z", "id": "", "metadata": {"key": "", "key1": ""}, "amount": 485666, "tax_amount": 81588, "currency": "Metical", "billing_reason": "subscription_cycle", "billing_address": {"country": "Hungary"}, "customer_id": "", "product_id": "", "product_price_id": "", "discount_id": "", "subscription_id": "", "checkout_id": "", "customer": {"created_at": "2023-11-12T12:46:15.007Z", "modified_at": "2023-03-24T03:54:38.261Z", "id": "", "metadata": {"key": "", "key1": ""}, "email": "Arnaldo.Ritchie@yahoo.com", "email_verified": false, "name": "", "billing_address": {"country": "Wallis and Futuna"}, "tax_id": ["", "", "eu_vat"], "organization_id": "", "avatar_url": "https://burly-developing.org/"}, "user_id": "", "user": {"id": "", "email": "Karina_Wyman32@gmail.com", "public_name": ""}, "product": {"created_at": "2022-09-26T00:50:02.940Z", "modified_at": "2024-08-11T14:36:04.800Z", "id": "", "name": "", "description": "rich digit raw following unlike", "is_recurring": true, "is_archived": false, "organization_id": ""}, "product_price": {"created_at": "2025-03-27T08:15:55.821Z", "modified_at": "2023-11-08T15:41:27.758Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 485666, "maximum_amount": 81588, "preset_amount": 605593}, "discount": {"duration": "forever", "type": "fixed", "basis_points": 543579, "created_at": "2025-09-23T11:59:51.286Z", "modified_at": "2025-12-14T00:30:10.871Z", "id": "", "metadata": {"key": "", "key1": "", "key2": 386855}, "name": "", "code": "", "starts_at": "2023-01-27T10:40:59.012Z", "ends_at": "2023-04-15T20:14:00.592Z", "max_redemptions": 244557, "redemptions_count": 870081, "organization_id": ""}, "subscription": {"metadata": {"key": "", "key1": "", "key2": ""}, "created_at": "2022-12-14T21:08:51.727Z", "modified_at": "2022-08-24T00:05:31.570Z", "id": "", "amount": 133794, "currency": "Tugrik", "recurring_interval": "year", "status": "trialing", "current_period_start": "2024-07-08T11:23:20.087Z", "current_period_end": "2024-05-25T08:53:21.161Z", "cancel_at_period_end": true, "started_at": "2024-05-09T06:10:47.548Z", "ended_at": "2024-02-14T18:51:37.875Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": ""}}} responses: "200": application/json: "" @@ -2455,7 +2347,7 @@ examples: _endpointsubscription_created_post: speakeasy-default-endpointsubscription-created-post: requestBody: - application/json: {"data": {"created_at": "2023-07-04T01:29:40.920Z", "modified_at": "2022-02-20T03:35:25.500Z", "id": "", "amount": 78980, "currency": "Dong", "recurring_interval": "month", "status": "incomplete_expired", "current_period_start": "2024-01-26T02:46:12.208Z", "current_period_end": "2022-10-08T16:07:22.449Z", "cancel_at_period_end": false, "started_at": "2024-10-17T20:21:29.819Z", "ended_at": "2022-02-26T17:52:17.099Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "metadata": {}, "customer": {"created_at": "2023-07-04T01:29:40.920Z", "modified_at": "2022-02-20T03:35:25.500Z", "id": "", "metadata": {}, "email": "Heather74@hotmail.com", "email_verified": true, "name": "", "billing_address": {"country": "Cayman Islands"}, "tax_id": [], "organization_id": "", "avatar_url": "https://short-term-corporation.name"}, "user_id": "", "user": {"id": "", "email": "Paxton_Dickinson22@gmail.com", "public_name": ""}, "product": {"created_at": "2024-07-02T21:20:42.425Z", "modified_at": "2023-11-08T17:00:26.387Z", "id": "", "name": "", "description": "limply edge behest shoulder synthesise and whoa memorise fast", "is_recurring": false, "is_archived": true, "organization_id": "", "metadata": {"key": ""}, "prices": [], "benefits": [{"created_at": "2022-02-20T03:35:25.500Z", "modified_at": "2022-03-28T13:29:27.613Z", "id": "", "description": "average deer plagiarise carefree qua yippee by capitalise from than", "selectable": true, "deletable": true, "organization_id": "", "properties": {"repository_owner": "polarsource", "repository_name": "private_repo", "permission": "maintain"}}, {"created_at": "2024-08-04T21:33:41.088Z", "modified_at": "2023-01-18T07:13:43.618Z", "id": "", "description": "forenenst best oh save carelessly sheepishly incomparable even", "selectable": false, "deletable": true, "organization_id": "", "properties": {"prefix": "", "expires": {"ttl": 212274, "timeframe": "day"}, "activations": {"limit": 391483, "enable_customer_admin": true}, "limit_usage": 120645}}], "medias": [], "attached_custom_fields": []}, "price": {"created_at": "2024-04-26T06:50:11.633Z", "modified_at": "2022-06-21T22:51:37.278Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 411556, "recurring_interval": "month"}, "discount": {"duration": "once", "type": "percentage", "amount": 156891, "currency": "Armenian Dram", "created_at": "2023-03-28T01:34:09.042Z", "modified_at": "2022-11-06T04:00:51.558Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2024-08-27T08:53:33.064Z", "ends_at": "2023-12-28T19:45:50.280Z", "max_redemptions": 762760, "redemptions_count": 23462, "organization_id": ""}}} + application/json: {"data": {"created_at": "2023-07-04T01:29:40.920Z", "modified_at": "2022-02-20T03:35:25.500Z", "id": "", "amount": 78980, "currency": "Dong", "recurring_interval": "month", "status": "incomplete_expired", "current_period_start": "2024-01-26T02:46:12.208Z", "current_period_end": "2022-10-08T16:07:22.449Z", "cancel_at_period_end": false, "started_at": "2024-10-17T20:21:29.819Z", "ended_at": "2022-02-26T17:52:17.099Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "metadata": {}, "customer": {"created_at": "2023-07-04T01:29:40.920Z", "modified_at": "2022-02-20T03:35:25.500Z", "id": "", "metadata": {}, "email": "Heather74@hotmail.com", "email_verified": true, "name": "", "billing_address": {"country": "Cayman Islands"}, "tax_id": [], "organization_id": "", "avatar_url": "https://short-term-corporation.name"}, "user_id": "", "user": {"id": "", "email": "Paxton_Dickinson22@gmail.com", "public_name": ""}, "product": {"created_at": "2024-07-02T21:20:42.425Z", "modified_at": "2023-11-08T17:00:26.387Z", "id": "", "name": "", "description": "limply edge behest shoulder synthesise and whoa memorise fast", "is_recurring": false, "is_archived": true, "organization_id": "", "metadata": {"key": ""}, "prices": [], "benefits": [{"created_at": "2023-02-20T03:35:25.500Z", "modified_at": "2023-03-28T13:29:27.613Z", "id": "", "description": "average deer plagiarise carefree qua yippee by capitalise from than", "selectable": true, "deletable": true, "organization_id": "", "properties": {"repository_owner": "polarsource", "repository_name": "private_repo", "permission": "maintain"}}, {"created_at": "2025-08-04T21:33:41.088Z", "modified_at": "2024-01-18T07:13:43.618Z", "id": "", "description": "forenenst best oh save carelessly sheepishly incomparable even", "selectable": false, "deletable": true, "organization_id": "", "properties": {"prefix": "", "expires": {"ttl": 212274, "timeframe": "day"}, "activations": {"limit": 391483, "enable_customer_admin": true}, "limit_usage": 120645}}], "medias": [], "attached_custom_fields": []}, "price": {"created_at": "2025-04-26T06:50:11.633Z", "modified_at": "2023-06-21T22:51:37.278Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 411556, "recurring_interval": "month"}, "discount": {"duration": "once", "type": "percentage", "amount": 156891, "currency": "Armenian Dram", "created_at": "2023-03-28T01:34:09.042Z", "modified_at": "2022-11-06T04:00:51.558Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2024-08-27T08:53:33.064Z", "ends_at": "2023-12-28T19:45:50.280Z", "max_redemptions": 762760, "redemptions_count": 23462, "organization_id": ""}}} responses: "200": application/json: "" @@ -2464,7 +2356,7 @@ examples: _endpointsubscription_updated_post: speakeasy-default-endpointsubscription-updated-post: requestBody: - application/json: {"data": {"created_at": "2022-08-16T06:35:49.390Z", "modified_at": "2024-11-13T10:48:05.575Z", "id": "", "amount": 299644, "currency": "Baht", "recurring_interval": "year", "status": "trialing", "current_period_start": "2024-10-06T07:01:55.000Z", "current_period_end": "2024-01-21T06:59:31.349Z", "cancel_at_period_end": false, "started_at": "2022-10-04T04:56:04.382Z", "ended_at": "2022-01-22T12:57:07.430Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "metadata": {"key": "", "key1": 442859, "key2": 394013}, "customer": {"created_at": "2022-08-16T06:35:49.390Z", "modified_at": "2024-11-13T10:48:05.575Z", "id": "", "metadata": {"key": ""}, "email": "Thea1@gmail.com", "email_verified": true, "name": "", "billing_address": {"country": "Nepal"}, "tax_id": [""], "organization_id": "", "avatar_url": "https://unruly-release.org/"}, "user_id": "", "user": {"id": "", "email": "Napoleon_Crist@hotmail.com", "public_name": ""}, "product": {"created_at": "2024-09-03T02:13:58.900Z", "modified_at": "2022-01-06T20:49:48.804Z", "id": "", "name": "", "description": "tall sans now duh mysteriously", "is_recurring": true, "is_archived": false, "organization_id": "", "metadata": {}, "prices": [], "benefits": [], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/dev", "mime_type": "", "size": 128620, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-06-03T11:59:38.300Z", "version": "", "is_uploaded": true, "created_at": "2024-02-16T13:33:22.624Z", "size_readable": "", "public_url": "https://cute-schedule.com"}], "attached_custom_fields": []}, "price": {"created_at": "2024-11-13T10:48:05.575Z", "modified_at": "2022-11-25T09:50:52.301Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "price_amount": 830034, "recurring_interval": "month"}, "discount": {"duration": "repeating", "duration_in_months": 917422, "type": "fixed", "basis_points": 19653, "created_at": "2024-08-08T17:53:12.513Z", "modified_at": "2022-10-08T02:40:52.099Z", "id": "", "metadata": {"key": 435982, "key1": 900724}, "name": "", "code": "", "starts_at": "2024-03-24T00:03:13.207Z", "ends_at": "2024-08-03T15:54:12.951Z", "max_redemptions": 155569, "redemptions_count": 853807, "organization_id": ""}}} + application/json: {"data": {"created_at": "2022-08-16T06:35:49.390Z", "modified_at": "2024-11-13T10:48:05.575Z", "id": "", "amount": 299644, "currency": "Baht", "recurring_interval": "year", "status": "trialing", "current_period_start": "2024-10-06T07:01:55.000Z", "current_period_end": "2024-01-21T06:59:31.349Z", "cancel_at_period_end": false, "started_at": "2022-10-04T04:56:04.382Z", "ended_at": "2022-01-22T12:57:07.430Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "metadata": {"key": "", "key1": 442859, "key2": 394013}, "customer": {"created_at": "2022-08-16T06:35:49.390Z", "modified_at": "2024-11-13T10:48:05.575Z", "id": "", "metadata": {"key": ""}, "email": "Thea1@gmail.com", "email_verified": true, "name": "", "billing_address": {"country": "Nepal"}, "tax_id": [""], "organization_id": "", "avatar_url": "https://unruly-release.org/"}, "user_id": "", "user": {"id": "", "email": "Napoleon_Crist@hotmail.com", "public_name": ""}, "product": {"created_at": "2024-09-03T02:13:58.900Z", "modified_at": "2022-01-06T20:49:48.804Z", "id": "", "name": "", "description": "tall sans now duh mysteriously", "is_recurring": true, "is_archived": false, "organization_id": "", "metadata": {}, "prices": [], "benefits": [], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/dev", "mime_type": "", "size": 128620, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-06-03T11:59:38.300Z", "version": "", "is_uploaded": true, "created_at": "2024-02-16T13:33:22.624Z", "size_readable": "", "public_url": "https://cute-schedule.com"}], "attached_custom_fields": []}, "price": {"created_at": "2025-11-13T10:48:05.575Z", "modified_at": "2023-11-25T09:50:52.301Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "price_amount": 830034, "recurring_interval": "month"}, "discount": {"duration": "repeating", "duration_in_months": 917422, "type": "fixed", "basis_points": 19653, "created_at": "2025-08-08T17:53:12.513Z", "modified_at": "2023-10-08T02:40:52.099Z", "id": "", "metadata": {"key": 435982, "key1": 900724}, "name": "", "code": "", "starts_at": "2025-03-24T00:03:13.207Z", "ends_at": "2025-08-03T15:54:12.951Z", "max_redemptions": 155569, "redemptions_count": 853807, "organization_id": ""}}} responses: "200": application/json: "" @@ -2473,7 +2365,7 @@ examples: _endpointsubscription_active_post: speakeasy-default-endpointsubscription-active-post: requestBody: - application/json: {"data": {"created_at": "2022-09-17T11:03:44.679Z", "modified_at": "2024-07-24T20:02:17.426Z", "id": "", "amount": 116760, "currency": "Quetzal", "recurring_interval": "month", "status": "incomplete", "current_period_start": "2022-08-25T00:14:50.252Z", "current_period_end": "2022-12-10T18:25:01.577Z", "cancel_at_period_end": false, "started_at": "2023-07-06T14:07:23.099Z", "ended_at": "2023-07-01T08:12:48.355Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "metadata": {}, "customer": {"created_at": "2022-09-17T11:03:44.679Z", "modified_at": "2024-07-24T20:02:17.426Z", "id": "", "metadata": {}, "email": "Jedidiah.Emard@gmail.com", "email_verified": true, "name": "", "billing_address": {"country": "Cape Verde"}, "tax_id": ["", "ph_tin", ""], "organization_id": "", "avatar_url": "https://pure-object.com/"}, "user_id": "", "user": {"id": "", "email": "Jenifer.Rodriguez@hotmail.com", "public_name": ""}, "product": {"created_at": "2024-05-16T15:06:50.424Z", "modified_at": "2023-01-20T07:01:39.418Z", "id": "", "name": "", "description": "quickly worth consequently failing commodity sternly", "is_recurring": false, "is_archived": false, "organization_id": "", "metadata": {}, "prices": [{"created_at": "2022-05-08T23:16:06.519Z", "modified_at": "2022-12-23T21:06:29.057Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "month"}, {"created_at": "2023-09-05T07:05:35.451Z", "modified_at": "2023-07-06T14:07:23.099Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 163614, "recurring_interval": "year"}], "benefits": [], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/etc/periodic", "mime_type": "", "size": 368833, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-09-18T05:20:53.809Z", "version": "", "is_uploaded": false, "created_at": "2024-02-16T09:26:15.001Z", "size_readable": "", "public_url": "https://scornful-flood.org"}, {"id": "", "organization_id": "", "name": "", "path": "/private/var", "mime_type": "", "size": 135533, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-06-08T01:38:58.555Z", "version": "", "is_uploaded": true, "created_at": "2022-02-13T01:11:01.495Z", "size_readable": "", "public_url": "https://small-monocle.org"}], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-05-10T05:22:19.943Z", "modified_at": "2024-03-26T15:56:07.593Z", "id": "", "metadata": {"key": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 18363, "required": false}]}, "price": {"created_at": "2023-11-06T06:32:30.065Z", "modified_at": "2022-04-25T08:49:41.567Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 126766, "maximum_amount": 790721, "preset_amount": 350632, "recurring_interval": "month"}, "discount": {"duration": "forever", "duration_in_months": 818211, "type": "fixed", "amount": 389044, "currency": "Somoni", "created_at": "2023-04-29T01:15:02.469Z", "modified_at": "2024-09-13T20:09:33.336Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2024-03-26T02:49:47.801Z", "ends_at": "2023-03-25T21:51:07.916Z", "max_redemptions": 136705, "redemptions_count": 138888, "organization_id": ""}}} + application/json: {"data": {"created_at": "2022-09-17T11:03:44.679Z", "modified_at": "2024-07-24T20:02:17.426Z", "id": "", "amount": 116760, "currency": "Quetzal", "recurring_interval": "month", "status": "incomplete", "current_period_start": "2022-08-25T00:14:50.252Z", "current_period_end": "2022-12-10T18:25:01.577Z", "cancel_at_period_end": false, "started_at": "2023-07-06T14:07:23.099Z", "ended_at": "2023-07-01T08:12:48.355Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "metadata": {}, "customer": {"created_at": "2022-09-17T11:03:44.679Z", "modified_at": "2024-07-24T20:02:17.426Z", "id": "", "metadata": {}, "email": "Jedidiah.Emard@gmail.com", "email_verified": true, "name": "", "billing_address": {"country": "Cape Verde"}, "tax_id": ["", "ph_tin", ""], "organization_id": "", "avatar_url": "https://pure-object.com/"}, "user_id": "", "user": {"id": "", "email": "Jenifer.Rodriguez@hotmail.com", "public_name": ""}, "product": {"created_at": "2024-05-16T15:06:50.424Z", "modified_at": "2023-01-20T07:01:39.418Z", "id": "", "name": "", "description": "quickly worth consequently failing commodity sternly", "is_recurring": false, "is_archived": false, "organization_id": "", "metadata": {}, "prices": [{"created_at": "2023-05-08T23:16:06.519Z", "modified_at": "2023-12-23T21:06:29.057Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "month"}, {"created_at": "2024-09-04T07:05:35.451Z", "modified_at": "2024-07-05T14:07:23.099Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 163614, "recurring_interval": "year"}], "benefits": [], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/etc/periodic", "mime_type": "", "size": 368833, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-09-18T05:20:53.809Z", "version": "", "is_uploaded": false, "created_at": "2024-02-16T09:26:15.001Z", "size_readable": "", "public_url": "https://scornful-flood.org"}, {"id": "", "organization_id": "", "name": "", "path": "/private/var", "mime_type": "", "size": 135533, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-06-08T01:38:58.555Z", "version": "", "is_uploaded": true, "created_at": "2022-02-13T01:11:01.495Z", "size_readable": "", "public_url": "https://small-monocle.org"}], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2025-05-10T05:22:19.943Z", "modified_at": "2025-03-26T15:56:07.593Z", "id": "", "metadata": {"key": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 18363, "required": false}]}, "price": {"created_at": "2024-11-05T06:32:30.065Z", "modified_at": "2023-04-25T08:49:41.567Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 126766, "maximum_amount": 790721, "preset_amount": 350632, "recurring_interval": "month"}, "discount": {"duration": "forever", "duration_in_months": 818211, "type": "fixed", "amount": 389044, "currency": "Somoni", "created_at": "2023-04-29T01:15:02.469Z", "modified_at": "2024-09-13T20:09:33.336Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2024-03-26T02:49:47.801Z", "ends_at": "2023-03-25T21:51:07.916Z", "max_redemptions": 136705, "redemptions_count": 138888, "organization_id": ""}}} responses: "200": application/json: "" @@ -2482,7 +2374,7 @@ examples: _endpointsubscription_canceled_post: speakeasy-default-endpointsubscription-canceled-post: requestBody: - application/json: {"data": {"created_at": "2023-02-08T10:04:43.200Z", "modified_at": "2022-02-20T09:16:44.963Z", "id": "", "amount": 384017, "currency": "Nakfa", "recurring_interval": "month", "status": "canceled", "current_period_start": "2024-08-29T23:51:26.505Z", "current_period_end": "2023-01-30T14:57:29.126Z", "cancel_at_period_end": false, "started_at": "2022-05-31T10:57:35.559Z", "ended_at": "2023-11-01T08:13:37.012Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "metadata": {}, "customer": {"created_at": "2023-02-08T10:04:43.200Z", "modified_at": "2022-02-20T09:16:44.963Z", "id": "", "metadata": {"key": ""}, "email": "Queen_Hessel@yahoo.com", "email_verified": true, "name": "", "billing_address": {"country": "Chile"}, "tax_id": ["co_nit", ""], "organization_id": "", "avatar_url": "https://dismal-expansion.net/"}, "user_id": "", "user": {"id": "", "email": "Lisandro.Goodwin33@gmail.com", "public_name": ""}, "product": {"created_at": "2024-04-21T09:16:25.153Z", "modified_at": "2023-04-29T10:19:12.872Z", "id": "", "name": "", "description": "patiently t-shirt badly underneath an sizzle", "is_recurring": false, "is_archived": false, "organization_id": "", "metadata": {"key": "", "key1": 850234, "key2": true}, "prices": [{"created_at": "2023-02-25T21:11:48.890Z", "modified_at": "2022-10-06T06:04:45.294Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 803599, "recurring_interval": "year"}], "benefits": [{"created_at": "2023-11-08T11:19:25.895Z", "modified_at": "2022-05-31T10:57:35.559Z", "id": "", "description": "beyond meanwhile custody bah bungalow whether futon", "selectable": true, "deletable": true, "organization_id": "", "properties": {"guild_id": "", "role_id": "", "guild_token": ""}}, {"created_at": "2024-10-23T06:54:29.696Z", "modified_at": "2024-12-29T09:25:17.621Z", "id": "", "description": "neatly or distinct abaft amidst until", "selectable": true, "deletable": false, "organization_id": "", "properties": {"prefix": "", "expires": {"ttl": 533766, "timeframe": "year"}, "activations": {"limit": 683673, "enable_customer_admin": false}, "limit_usage": 448881}}, {"created_at": "2023-11-29T22:13:40.467Z", "modified_at": "2024-03-01T00:15:21.815Z", "id": "", "description": "sans dim very swine", "selectable": true, "deletable": false, "organization_id": "", "properties": {"repository_owner": "polarsource", "repository_name": "private_repo", "permission": "admin"}}], "medias": [], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2023-01-22T19:23:36.032Z", "modified_at": "2022-12-01T05:29:47.613Z", "id": "", "metadata": {"key": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 722899, "required": true}]}, "price": {"created_at": "2023-08-30T10:47:47.076Z", "modified_at": "2023-06-06T13:42:12.919Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "year"}, "discount": {"duration": "repeating", "type": "fixed", "basis_points": 826875, "created_at": "2023-12-15T03:17:11.315Z", "modified_at": "2024-01-20T22:32:35.094Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2022-05-20T13:10:25.210Z", "ends_at": "2024-01-02T05:05:20.582Z", "max_redemptions": 618338, "redemptions_count": 193834, "organization_id": ""}}} + application/json: {"data": {"created_at": "2023-02-08T10:04:43.200Z", "modified_at": "2022-02-20T09:16:44.963Z", "id": "", "amount": 384017, "currency": "Nakfa", "recurring_interval": "month", "status": "canceled", "current_period_start": "2024-08-29T23:51:26.505Z", "current_period_end": "2023-01-30T14:57:29.126Z", "cancel_at_period_end": false, "started_at": "2022-05-31T10:57:35.559Z", "ended_at": "2023-11-01T08:13:37.012Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "metadata": {}, "customer": {"created_at": "2023-02-08T10:04:43.200Z", "modified_at": "2022-02-20T09:16:44.963Z", "id": "", "metadata": {"key": ""}, "email": "Queen_Hessel@yahoo.com", "email_verified": true, "name": "", "billing_address": {"country": "Chile"}, "tax_id": ["co_nit", ""], "organization_id": "", "avatar_url": "https://dismal-expansion.net/"}, "user_id": "", "user": {"id": "", "email": "Lisandro.Goodwin33@gmail.com", "public_name": ""}, "product": {"created_at": "2024-04-21T09:16:25.153Z", "modified_at": "2023-04-29T10:19:12.872Z", "id": "", "name": "", "description": "patiently t-shirt badly underneath an sizzle", "is_recurring": false, "is_archived": false, "organization_id": "", "metadata": {"key": "", "key1": 850234, "key2": true}, "prices": [{"created_at": "2024-02-25T21:11:48.890Z", "modified_at": "2023-10-06T06:04:45.294Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 803599, "recurring_interval": "year"}], "benefits": [{"created_at": "2024-11-07T11:19:25.895Z", "modified_at": "2023-05-31T10:57:35.559Z", "id": "", "description": "beyond meanwhile custody bah bungalow whether futon", "selectable": true, "deletable": true, "organization_id": "", "properties": {"guild_id": "", "role_id": "", "guild_token": ""}}, {"created_at": "2025-10-23T06:54:29.696Z", "modified_at": "2025-12-29T09:25:17.621Z", "id": "", "description": "neatly or distinct abaft amidst until", "selectable": true, "deletable": false, "organization_id": "", "properties": {"prefix": "", "expires": {"ttl": 533766, "timeframe": "year"}, "activations": {"limit": 683673, "enable_customer_admin": false}, "limit_usage": 448881}}, {"created_at": "2024-11-28T22:13:40.467Z", "modified_at": "2025-03-01T00:15:21.815Z", "id": "", "description": "sans dim very swine", "selectable": true, "deletable": false, "organization_id": "", "properties": {"repository_owner": "polarsource", "repository_name": "private_repo", "permission": "admin"}}], "medias": [], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-01-22T19:23:36.032Z", "modified_at": "2023-12-01T05:29:47.613Z", "id": "", "metadata": {"key": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 722899, "required": true}]}, "price": {"created_at": "2024-08-29T10:47:47.076Z", "modified_at": "2024-06-05T13:42:12.919Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "year"}, "discount": {"duration": "repeating", "type": "fixed", "basis_points": 826875, "created_at": "2023-12-15T03:17:11.315Z", "modified_at": "2024-01-20T22:32:35.094Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2022-05-20T13:10:25.210Z", "ends_at": "2024-01-02T05:05:20.582Z", "max_redemptions": 618338, "redemptions_count": 193834, "organization_id": ""}}} responses: "200": application/json: "" @@ -2491,7 +2383,7 @@ examples: _endpointsubscription_revoked_post: speakeasy-default-endpointsubscription-revoked-post: requestBody: - application/json: {"data": {"created_at": "2024-11-29T12:00:55.925Z", "modified_at": "2022-03-13T04:36:55.320Z", "id": "", "amount": 780683, "currency": "CFP Franc", "recurring_interval": "year", "status": "trialing", "current_period_start": "2022-06-20T05:55:42.170Z", "current_period_end": "2023-05-17T17:55:53.899Z", "cancel_at_period_end": true, "started_at": "2024-10-25T10:04:20.460Z", "ended_at": "2023-09-30T18:36:35.285Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "metadata": {"key": 721489}, "customer": {"created_at": "2024-11-29T12:00:55.925Z", "modified_at": "2022-03-13T04:36:55.320Z", "id": "", "metadata": {"key": true, "key1": "", "key2": ""}, "email": "Jeremie35@yahoo.com", "email_verified": true, "name": "", "billing_address": {"country": "Timor-Leste"}, "tax_id": ["br_cnpj", "ca_pst_mb", "bh_vat"], "organization_id": "", "avatar_url": "https://valuable-rim.name"}, "user_id": "", "user": {"id": "", "email": "Sierra.Moore60@gmail.com", "public_name": ""}, "product": {"created_at": "2024-04-13T14:40:28.840Z", "modified_at": "2023-11-21T04:26:42.625Z", "id": "", "name": "", "description": "and blindly off except once", "is_recurring": true, "is_archived": true, "organization_id": "", "metadata": {"key": 892144, "key1": ""}, "prices": [], "benefits": [{"created_at": "2022-03-13T04:36:55.320Z", "modified_at": "2024-05-05T15:05:02.863Z", "id": "", "description": "mom nun up bar slime ghost in unfortunate nucleotidase yahoo", "selectable": false, "deletable": true, "organization_id": "", "properties": {"prefix": "", "expires": {"ttl": 409053, "timeframe": "month"}, "activations": {"limit": 85523, "enable_customer_admin": false}, "limit_usage": 528613}}, {"created_at": "2023-07-27T22:37:48.771Z", "modified_at": "2022-07-08T15:43:38.078Z", "id": "", "description": "comestible save spark accentuate", "selectable": false, "deletable": true, "organization_id": "", "properties": {"archived": {}, "files": [""]}}, {"created_at": "2024-06-06T16:36:59.904Z", "modified_at": "2023-12-15T07:14:12.681Z", "id": "", "description": "when submissive desk how", "selectable": false, "deletable": false, "organization_id": "", "properties": {"prefix": "", "expires": {"ttl": 620052, "timeframe": "month"}, "activations": {"limit": 77915, "enable_customer_admin": true}, "limit_usage": 893478}}], "medias": [], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-03-24T11:18:28.141Z", "modified_at": "2023-06-03T22:09:28.859Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 679852, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2024-08-02T21:30:57.659Z", "modified_at": "2022-10-18T08:45:20.322Z", "id": "", "metadata": {"key": 273261, "key1": 500371, "key2": true}, "slug": "", "name": "", "organization_id": "", "properties": {"options": [{"value": "", "label": ""}, {"value": "", "label": ""}, {"value": "", "label": ""}]}}, "order": 63475, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2024-04-07T09:34:20.163Z", "modified_at": "2023-04-24T06:28:00.706Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 436843, "required": true}]}, "price": {"created_at": "2022-04-15T20:44:08.164Z", "modified_at": "2022-05-20T15:08:40.297Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 206819, "maximum_amount": 54522, "preset_amount": 337977, "recurring_interval": "month"}, "discount": {"duration": "once", "duration_in_months": 602455, "type": "fixed", "basis_points": 157916, "created_at": "2024-12-02T06:57:31.584Z", "modified_at": "2024-04-06T17:31:04.776Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2022-04-03T10:04:32.370Z", "ends_at": "2024-08-11T06:28:29.006Z", "max_redemptions": 721627, "redemptions_count": 941681, "organization_id": ""}}} + application/json: {"data": {"created_at": "2024-11-29T12:00:55.925Z", "modified_at": "2022-03-13T04:36:55.320Z", "id": "", "amount": 780683, "currency": "CFP Franc", "recurring_interval": "year", "status": "trialing", "current_period_start": "2022-06-20T05:55:42.170Z", "current_period_end": "2023-05-17T17:55:53.899Z", "cancel_at_period_end": true, "started_at": "2024-10-25T10:04:20.460Z", "ended_at": "2023-09-30T18:36:35.285Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "metadata": {"key": 721489}, "customer": {"created_at": "2024-11-29T12:00:55.925Z", "modified_at": "2022-03-13T04:36:55.320Z", "id": "", "metadata": {"key": true, "key1": "", "key2": ""}, "email": "Jeremie35@yahoo.com", "email_verified": true, "name": "", "billing_address": {"country": "Timor-Leste"}, "tax_id": ["br_cnpj", "ca_pst_mb", "bh_vat"], "organization_id": "", "avatar_url": "https://valuable-rim.name"}, "user_id": "", "user": {"id": "", "email": "Sierra.Moore60@gmail.com", "public_name": ""}, "product": {"created_at": "2024-04-13T14:40:28.840Z", "modified_at": "2023-11-21T04:26:42.625Z", "id": "", "name": "", "description": "and blindly off except once", "is_recurring": true, "is_archived": true, "organization_id": "", "metadata": {"key": 892144, "key1": ""}, "prices": [], "benefits": [{"created_at": "2023-03-13T04:36:55.320Z", "modified_at": "2025-05-05T15:05:02.863Z", "id": "", "description": "mom nun up bar slime ghost in unfortunate nucleotidase yahoo", "selectable": false, "deletable": true, "organization_id": "", "properties": {"prefix": "", "expires": {"ttl": 409053, "timeframe": "month"}, "activations": {"limit": 85523, "enable_customer_admin": false}, "limit_usage": 528613}}, {"created_at": "2024-07-26T22:37:48.771Z", "modified_at": "2023-07-08T15:43:38.078Z", "id": "", "description": "comestible save spark accentuate", "selectable": false, "deletable": true, "organization_id": "", "properties": {"archived": {}, "files": [""]}}, {"created_at": "2025-06-06T16:36:59.904Z", "modified_at": "2024-12-14T07:14:12.681Z", "id": "", "description": "when submissive desk how", "selectable": false, "deletable": false, "organization_id": "", "properties": {"prefix": "", "expires": {"ttl": 620052, "timeframe": "month"}, "activations": {"limit": 77915, "enable_customer_admin": true}, "limit_usage": 893478}}], "medias": [], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2025-03-24T11:18:28.141Z", "modified_at": "2024-06-02T22:09:28.859Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 679852, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2025-08-02T21:30:57.659Z", "modified_at": "2023-10-18T08:45:20.322Z", "id": "", "metadata": {"key": 273261, "key1": 500371, "key2": true}, "slug": "", "name": "", "organization_id": "", "properties": {"options": [{"value": "", "label": ""}, {"value": "", "label": ""}, {"value": "", "label": ""}]}}, "order": 63475, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2025-04-07T09:34:20.163Z", "modified_at": "2024-04-23T06:28:00.706Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 436843, "required": true}]}, "price": {"created_at": "2023-04-15T20:44:08.164Z", "modified_at": "2023-05-20T15:08:40.297Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 206819, "maximum_amount": 54522, "preset_amount": 337977, "recurring_interval": "month"}, "discount": {"duration": "once", "duration_in_months": 602455, "type": "fixed", "basis_points": 157916, "created_at": "2024-12-02T06:57:31.584Z", "modified_at": "2024-04-06T17:31:04.776Z", "id": "", "metadata": {}, "name": "", "code": "", "starts_at": "2022-04-03T10:04:32.370Z", "ends_at": "2024-08-11T06:28:29.006Z", "max_redemptions": 721627, "redemptions_count": 941681, "organization_id": ""}}} responses: "200": application/json: "" @@ -2500,7 +2392,7 @@ examples: _endpointproduct_created_post: speakeasy-default-endpointproduct-created-post: requestBody: - application/json: {"data": {"created_at": "2022-03-27T06:36:20.130Z", "modified_at": "2024-04-21T12:05:16.637Z", "id": "", "name": "", "description": "into horst metal grimy clinch big grounded industrialize", "is_recurring": true, "is_archived": true, "organization_id": "", "metadata": {}, "prices": [{"created_at": "2023-12-08T23:31:39.577Z", "modified_at": "2023-04-26T10:21:28.587Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "year"}, {"created_at": "2023-10-10T12:20:00.039Z", "modified_at": "2023-08-02T06:11:52.894Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 66164, "maximum_amount": 215783, "preset_amount": 203043}], "benefits": [{"created_at": "2022-12-13T12:26:05.455Z", "modified_at": "2023-04-18T08:36:36.851Z", "id": "", "description": "before requite than throughout", "selectable": true, "deletable": true, "organization_id": ""}, {"created_at": "2024-01-30T06:25:40.029Z", "modified_at": "2024-05-25T20:52:15.774Z", "id": "", "description": "industrialize necklace meh innocent and", "selectable": true, "deletable": false, "organization_id": "", "properties": {"repository_owner": "polarsource", "repository_name": "private_repo", "permission": "maintain"}}, {"created_at": "2022-12-21T02:33:35.683Z", "modified_at": "2022-05-31T01:25:34.413Z", "id": "", "description": "super even about till what optimal slimy", "selectable": true, "deletable": true, "organization_id": "", "properties": {"prefix": "", "expires": {"ttl": 118349, "timeframe": "day"}, "activations": {"limit": 158822, "enable_customer_admin": false}, "limit_usage": 553531}}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/Users", "mime_type": "", "size": 692895, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-02-28T01:03:14.537Z", "version": "", "is_uploaded": true, "created_at": "2022-06-03T00:39:20.038Z", "size_readable": "", "public_url": "https://monstrous-cop-out.net"}, {"id": "", "organization_id": "", "name": "", "path": "/var/mail", "mime_type": "", "size": 843323, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-04-23T21:31:25.476Z", "version": "", "is_uploaded": true, "created_at": "2022-07-19T01:29:35.587Z", "size_readable": "", "public_url": "https://well-made-farm.com"}, {"id": "", "organization_id": "", "name": "", "path": "/root", "mime_type": "", "size": 849549, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-07-30T13:09:33.963Z", "version": "", "is_uploaded": false, "created_at": "2023-10-03T20:39:40.444Z", "size_readable": "", "public_url": "https://simplistic-devastation.com"}], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-07-07T02:17:46.592Z", "modified_at": "2023-01-06T06:37:37.257Z", "id": "", "metadata": {"key": 733716, "key1": 124295, "key2": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 317196, "required": false}, {"custom_field_id": "", "custom_field": {"created_at": "2023-01-22T17:57:22.350Z", "modified_at": "2023-07-20T04:28:49.429Z", "id": "", "metadata": {"key": 719843}, "slug": "", "name": "", "organization_id": ""}, "order": 492053, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2023-12-31T18:52:05.817Z", "modified_at": "2023-07-15T08:10:59.538Z", "id": "", "metadata": {"key": true}, "slug": "", "name": "", "organization_id": ""}, "order": 17631, "required": true}]}} + application/json: {"data": {"created_at": "2022-03-27T06:36:20.130Z", "modified_at": "2024-04-21T12:05:16.637Z", "id": "", "name": "", "description": "into horst metal grimy clinch big grounded industrialize", "is_recurring": true, "is_archived": true, "organization_id": "", "metadata": {}, "prices": [{"created_at": "2024-12-07T23:31:39.577Z", "modified_at": "2024-04-25T10:21:28.587Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "year"}, {"created_at": "2024-10-09T12:20:00.039Z", "modified_at": "2024-08-01T06:11:52.894Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 66164, "maximum_amount": 215783, "preset_amount": 203043}], "benefits": [{"created_at": "2023-12-13T12:26:05.455Z", "modified_at": "2024-04-17T08:36:36.851Z", "id": "", "description": "before requite than throughout", "selectable": true, "deletable": true, "organization_id": ""}, {"created_at": "2025-01-29T06:25:40.029Z", "modified_at": "2025-05-25T20:52:15.774Z", "id": "", "description": "industrialize necklace meh innocent and", "selectable": true, "deletable": false, "organization_id": "", "properties": {"repository_owner": "polarsource", "repository_name": "private_repo", "permission": "maintain"}}, {"created_at": "2023-12-21T02:33:35.683Z", "modified_at": "2023-05-31T01:25:34.413Z", "id": "", "description": "super even about till what optimal slimy", "selectable": true, "deletable": true, "organization_id": "", "properties": {"prefix": "", "expires": {"ttl": 118349, "timeframe": "day"}, "activations": {"limit": 158822, "enable_customer_admin": false}, "limit_usage": 553531}}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/Users", "mime_type": "", "size": 692895, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-02-28T01:03:14.537Z", "version": "", "is_uploaded": true, "created_at": "2022-06-03T00:39:20.038Z", "size_readable": "", "public_url": "https://monstrous-cop-out.net"}, {"id": "", "organization_id": "", "name": "", "path": "/var/mail", "mime_type": "", "size": 843323, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-04-23T21:31:25.476Z", "version": "", "is_uploaded": true, "created_at": "2022-07-19T01:29:35.587Z", "size_readable": "", "public_url": "https://well-made-farm.com"}, {"id": "", "organization_id": "", "name": "", "path": "/root", "mime_type": "", "size": 849549, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-07-30T13:09:33.963Z", "version": "", "is_uploaded": false, "created_at": "2023-10-03T20:39:40.444Z", "size_readable": "", "public_url": "https://simplistic-devastation.com"}], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2025-07-07T02:17:46.592Z", "modified_at": "2024-01-06T06:37:37.257Z", "id": "", "metadata": {"key": 733716, "key1": 124295, "key2": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 317196, "required": false}, {"custom_field_id": "", "custom_field": {"created_at": "2024-01-22T17:57:22.350Z", "modified_at": "2024-07-19T04:28:49.429Z", "id": "", "metadata": {"key": 719843}, "slug": "", "name": "", "organization_id": ""}, "order": 492053, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2024-12-30T18:52:05.817Z", "modified_at": "2024-07-14T08:10:59.538Z", "id": "", "metadata": {"key": true}, "slug": "", "name": "", "organization_id": ""}, "order": 17631, "required": true}]}} responses: "200": application/json: "" @@ -2509,7 +2401,7 @@ examples: _endpointproduct_updated_post: speakeasy-default-endpointproduct-updated-post: requestBody: - application/json: {"data": {"created_at": "2023-06-26T03:46:32.479Z", "modified_at": "2022-06-04T01:47:33.158Z", "id": "", "name": "", "description": "er ick birdcage", "is_recurring": true, "is_archived": false, "organization_id": "", "metadata": {}, "prices": [{"created_at": "2022-04-14T23:22:06.974Z", "modified_at": "2022-11-27T16:49:54.775Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 147529, "recurring_interval": "month"}], "benefits": [{"created_at": "2023-03-01T01:53:23.154Z", "modified_at": "2024-10-01T01:25:21.739Z", "id": "", "description": "for kissingly countess", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2022-08-03T10:08:00.590Z", "modified_at": "2022-07-04T20:42:15.638Z", "id": "", "description": "along always modulo fidget inside lightly gigantic pigpen under", "selectable": true, "deletable": true, "organization_id": "", "properties": {"note": ""}, "is_tax_applicable": false}, {"created_at": "2023-12-22T18:08:53.429Z", "modified_at": "2023-04-06T15:47:57.618Z", "id": "", "description": "typify attest amid incidentally afore ultimately beloved seldom", "selectable": false, "deletable": false, "organization_id": "", "properties": {"archived": {"key": true}, "files": [""]}}], "medias": [], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2024-06-25T07:43:21.903Z", "modified_at": "2024-02-08T13:05:15.287Z", "id": "", "metadata": {"key": 81731, "key1": "", "key2": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 19557, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2024-08-19T11:13:30.301Z", "modified_at": "2023-11-12T22:19:55.213Z", "id": "", "metadata": {"key": "", "key1": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 753420, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2022-03-20T08:40:07.478Z", "modified_at": "2023-10-25T07:58:05.681Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 454407, "required": true}]}} + application/json: {"data": {"created_at": "2023-06-26T03:46:32.479Z", "modified_at": "2022-06-04T01:47:33.158Z", "id": "", "name": "", "description": "er ick birdcage", "is_recurring": true, "is_archived": false, "organization_id": "", "metadata": {}, "prices": [{"created_at": "2023-04-14T23:22:06.974Z", "modified_at": "2023-11-27T16:49:54.775Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 147529, "recurring_interval": "month"}], "benefits": [{"created_at": "2024-02-29T01:53:23.154Z", "modified_at": "2025-10-01T01:25:21.739Z", "id": "", "description": "for kissingly countess", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2023-08-03T10:08:00.590Z", "modified_at": "2023-07-04T20:42:15.638Z", "id": "", "description": "along always modulo fidget inside lightly gigantic pigpen under", "selectable": true, "deletable": true, "organization_id": "", "properties": {"note": ""}, "is_tax_applicable": false}, {"created_at": "2024-12-21T18:08:53.429Z", "modified_at": "2024-04-05T15:47:57.618Z", "id": "", "description": "typify attest amid incidentally afore ultimately beloved seldom", "selectable": false, "deletable": false, "organization_id": "", "properties": {"archived": {"key": true}, "files": [""]}}], "medias": [], "attached_custom_fields": [{"custom_field_id": "", "custom_field": {"created_at": "2025-06-25T07:43:21.903Z", "modified_at": "2025-02-07T13:05:15.287Z", "id": "", "metadata": {"key": 81731, "key1": "", "key2": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 19557, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2025-08-19T11:13:30.301Z", "modified_at": "2024-11-11T22:19:55.213Z", "id": "", "metadata": {"key": "", "key1": ""}, "slug": "", "name": "", "organization_id": ""}, "order": 753420, "required": true}, {"custom_field_id": "", "custom_field": {"created_at": "2023-03-20T08:40:07.478Z", "modified_at": "2024-10-24T07:58:05.681Z", "id": "", "metadata": {}, "slug": "", "name": "", "organization_id": ""}, "order": 454407, "required": true}]}} responses: "200": application/json: "" @@ -2518,7 +2410,7 @@ examples: _endpointpledge_created_post: speakeasy-default-endpointpledge-created-post: requestBody: - application/json: {"data": {"created_at": "2024-03-12T00:19:41.487Z", "modified_at": "2022-04-19T01:42:59.169Z", "id": "", "amount": 330877, "currency": "Jamaican Dollar", "state": "disputed", "type": "pay_directly", "issue": {"id": "66524b69-aa0b-47ac-bb9a-0cee5d3a9110", "number": 280857, "title": "", "state": "open", "issue_created_at": "2023-02-26T00:33:35.289Z", "needs_confirmation_solved": false, "repository": {"id": "356e14cb-87a4-484c-bcfa-ebfe50487706", "is_private": true, "name": "MyOrg", "description": "different premium tinderbox peter under often buzzing hastily", "stars": 1337, "license": "", "homepage": "", "organization": {"id": "29159f56-74c0-464d-b598-8d5bc3b9cdda", "name": "", "avatar_url": "https://frightened-poppy.com/", "is_personal": false, "bio": "", "pretty_name": "", "company": "Bailey - Towne", "blog": "", "location": "", "email": "Cortez_Stehr70@yahoo.com", "twitter_username": "", "organization_id": ""}, "internal_organization": {"created_at": "2024-01-04T15:27:13.109Z", "modified_at": "2023-02-15T22:10:17.041Z", "id": "", "name": "", "slug": "", "avatar_url": "https://hard-to-find-thyme.org", "bio": "", "company": "Schinner - Wiegand", "blog": "", "location": "", "email": "Pearline_Brekke@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 273260, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 976949}}, "pledge_badge_currently_embedded": true}}} + application/json: {"data": {"created_at": "2024-03-12T00:19:41.487Z", "modified_at": "2022-04-19T01:42:59.169Z", "id": "", "amount": 330877, "currency": "Jamaican Dollar", "state": "disputed", "type": "pay_directly", "issue": {"id": "66524b69-aa0b-47ac-bb9a-0cee5d3a9110", "platform": "github", "number": 280857, "title": "", "state": "open", "issue_created_at": "2023-02-26T00:33:35.289Z", "needs_confirmation_solved": false, "repository": {"id": "356e14cb-87a4-484c-bcfa-ebfe50487706", "platform": "github", "is_private": true, "name": "MyOrg", "description": "different premium tinderbox peter under often buzzing hastily", "stars": 1337, "license": "", "homepage": "", "organization": {"id": "29159f56-74c0-464d-b598-8d5bc3b9cdda", "platform": "github", "name": "", "avatar_url": "https://frightened-poppy.com/", "is_personal": false, "bio": "", "pretty_name": "", "company": "Bailey - Towne", "blog": "", "location": "", "email": "Cortez_Stehr70@yahoo.com", "twitter_username": "", "organization_id": ""}, "internal_organization": {"created_at": "2024-01-04T15:27:13.109Z", "modified_at": "2023-02-15T22:10:17.041Z", "id": "", "name": "", "slug": "", "avatar_url": "https://hard-to-find-thyme.org", "bio": "", "company": "Schinner - Wiegand", "blog": "", "location": "", "email": "Pearline_Brekke@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 273260, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 976949}}, "pledge_badge_currently_embedded": true}}} responses: "200": application/json: "" @@ -2527,7 +2419,7 @@ examples: _endpointpledge_updated_post: speakeasy-default-endpointpledge-updated-post: requestBody: - application/json: {"data": {"created_at": "2023-11-30T00:10:39.674Z", "modified_at": "2024-10-02T21:42:49.754Z", "id": "", "amount": 634567, "currency": "Singapore Dollar", "state": "refunded", "type": "pay_on_completion", "issue": {"id": "d2e1349d-085a-441c-abf4-379a1f21d0da", "number": 218372, "title": "", "state": "closed", "issue_created_at": "2023-08-13T14:08:31.083Z", "needs_confirmation_solved": true, "repository": {"id": "814bd7c6-3412-4f11-b523-7b38c659f44a", "is_private": false, "name": "MyOrg", "description": "hm however microchip", "stars": 1337, "license": "", "homepage": "", "organization": {"id": "3ddd5cc2-de10-41ef-baa1-7551cf671cc3", "name": "", "avatar_url": "https://gummy-interviewer.biz", "is_personal": false, "bio": "", "pretty_name": "", "company": "Ferry - Tremblay", "blog": "", "location": "", "email": "Reggie_Crist@yahoo.com", "twitter_username": "", "organization_id": ""}, "internal_organization": {"created_at": "2024-12-13T11:00:39.217Z", "modified_at": "2024-12-02T09:51:26.214Z", "id": "", "name": "", "slug": "", "avatar_url": "https://memorable-numeracy.com/", "bio": "", "company": "Schuster - Crooks", "blog": "", "location": "", "email": "Tatum.Block37@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 653584, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 175899}}, "pledge_badge_currently_embedded": false}}} + application/json: {"data": {"created_at": "2023-11-30T00:10:39.674Z", "modified_at": "2024-10-02T21:42:49.754Z", "id": "", "amount": 634567, "currency": "Singapore Dollar", "state": "refunded", "type": "pay_on_completion", "issue": {"id": "d2e1349d-085a-441c-abf4-379a1f21d0da", "platform": "github", "number": 218372, "title": "", "state": "closed", "issue_created_at": "2023-08-13T14:08:31.083Z", "needs_confirmation_solved": true, "repository": {"id": "814bd7c6-3412-4f11-b523-7b38c659f44a", "platform": "github", "is_private": false, "name": "MyOrg", "description": "hm however microchip", "stars": 1337, "license": "", "homepage": "", "organization": {"id": "3ddd5cc2-de10-41ef-baa1-7551cf671cc3", "platform": "github", "name": "", "avatar_url": "https://gummy-interviewer.biz", "is_personal": false, "bio": "", "pretty_name": "", "company": "Ferry - Tremblay", "blog": "", "location": "", "email": "Reggie_Crist@yahoo.com", "twitter_username": "", "organization_id": ""}, "internal_organization": {"created_at": "2024-12-13T11:00:39.217Z", "modified_at": "2024-12-02T09:51:26.214Z", "id": "", "name": "", "slug": "", "avatar_url": "https://memorable-numeracy.com/", "bio": "", "company": "Schuster - Crooks", "blog": "", "location": "", "email": "Tatum.Block37@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 653584, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 175899}}, "pledge_badge_currently_embedded": false}}} responses: "200": application/json: "" @@ -2545,7 +2437,7 @@ examples: _endpointbenefit_created_post: speakeasy-default-endpointbenefit-created-post: requestBody: - application/json: {"data": {"created_at": "2022-04-15T11:45:18.891Z", "modified_at": "2024-06-17T12:04:55.002Z", "id": "", "description": "vastly lest but", "selectable": true, "deletable": true, "organization_id": "", "properties": {"archived": {"key": true, "key1": true}, "files": [""]}}} + application/json: {"data": {"created_at": "2023-04-15T11:45:18.891Z", "modified_at": "2025-06-17T12:04:55.002Z", "id": "", "description": "vastly lest but", "selectable": true, "deletable": true, "organization_id": "", "properties": {"archived": {"key": true, "key1": true}, "files": [""]}}} responses: "200": application/json: "" @@ -2554,7 +2446,7 @@ examples: _endpointbenefit_updated_post: speakeasy-default-endpointbenefit-updated-post: requestBody: - application/json: {"data": {"created_at": "2024-11-19T14:31:03.333Z", "modified_at": "2022-08-21T02:54:25.671Z", "id": "", "description": "merge when gratefully sparse hmph throughout honesty untried gripping um", "selectable": false, "deletable": false, "organization_id": "", "properties": {"repository_owner": "polarsource", "repository_name": "private_repo", "permission": "pull"}}} + application/json: {"data": {"created_at": "2025-11-19T14:31:03.333Z", "modified_at": "2023-08-21T02:54:25.671Z", "id": "", "description": "merge when gratefully sparse hmph throughout honesty untried gripping um", "selectable": false, "deletable": false, "organization_id": "", "properties": {"repository_owner": "polarsource", "repository_name": "private_repo", "permission": "pull"}}} responses: "200": application/json: "" @@ -2563,7 +2455,7 @@ examples: _endpointbenefit_grant_created_post: speakeasy-default-endpointbenefit-grant-created-post: requestBody: - application/json: {"data": {"created_at": "2024-01-05T13:03:27.870Z", "modified_at": "2022-05-08T00:47:14.556Z", "id": "", "is_granted": true, "is_revoked": false, "subscription_id": "", "order_id": "", "customer_id": "", "user_id": "", "benefit_id": "", "properties": {"advertisement_campaign_id": ""}, "benefit": {"created_at": "2022-05-08T00:47:14.556Z", "modified_at": "2022-02-20T12:28:33.166Z", "id": "", "description": "ick form ack lest plus worriedly gifted", "selectable": true, "deletable": true, "organization_id": "", "properties": {"archived": {"key": true}, "files": [""]}}}} + application/json: {"data": {"created_at": "2024-01-05T13:03:27.870Z", "modified_at": "2022-05-08T00:47:14.556Z", "id": "", "is_granted": true, "is_revoked": false, "subscription_id": "", "order_id": "", "customer_id": "", "user_id": "", "benefit_id": "", "customer": {"created_at": "2025-01-04T13:03:27.870Z", "modified_at": "2023-05-08T00:47:14.556Z", "id": "", "metadata": {}, "email": "Shany_Erdman43@yahoo.com", "email_verified": false, "name": "", "billing_address": {"country": "Nigeria"}, "tax_id": [""], "organization_id": "", "avatar_url": "https://filthy-subexpression.info"}, "properties": {"advertisement_campaign_id": ""}, "benefit": {"created_at": "2023-01-21T02:30:40.127Z", "modified_at": "2025-08-20T09:28:52.535Z", "id": "", "description": "while mmm provided thorny geez sesame upwardly", "selectable": false, "deletable": false, "organization_id": "", "properties": {"prefix": "", "expires": {"ttl": 852325, "timeframe": "month"}, "activations": {"limit": 159123, "enable_customer_admin": false}, "limit_usage": 292502}}}} responses: "200": application/json: "" @@ -2572,7 +2464,7 @@ examples: _endpointbenefit_grant_updated_post: speakeasy-default-endpointbenefit-grant-updated-post: requestBody: - application/json: {"data": {"created_at": "2024-01-03T13:54:42.243Z", "modified_at": "2023-02-25T11:58:59.486Z", "id": "", "is_granted": false, "is_revoked": false, "subscription_id": "", "order_id": "", "customer_id": "", "user_id": "", "benefit_id": "", "properties": {"advertisement_campaign_id": ""}, "benefit": {"created_at": "2023-02-25T11:58:59.486Z", "modified_at": "2024-04-04T12:08:04.168Z", "id": "", "description": "oil painfully spring requirement import lest to tragic", "selectable": false, "deletable": true, "organization_id": "", "properties": {"archived": {"key": true}, "files": ["", ""]}}}} + application/json: {"data": {"created_at": "2024-01-03T13:54:42.243Z", "modified_at": "2023-02-25T11:58:59.486Z", "id": "", "is_granted": false, "is_revoked": false, "subscription_id": "", "order_id": "", "customer_id": "", "user_id": "", "benefit_id": "", "customer": {"created_at": "2025-01-02T13:54:42.243Z", "modified_at": "2024-02-25T11:58:59.486Z", "id": "", "metadata": {"key": false, "key1": 796606, "key2": ""}, "email": "Katherine_Kuvalis@yahoo.com", "email_verified": true, "name": "", "billing_address": {"country": "Andorra"}, "tax_id": ["kz_bin", ""], "organization_id": "", "avatar_url": "https://limp-duster.org/"}, "properties": {"advertisement_campaign_id": ""}, "benefit": {"created_at": "2023-01-07T18:32:26.157Z", "modified_at": "2024-04-08T20:06:47.611Z", "id": "", "description": "wonderfully phooey geez pish always inasmuch", "selectable": true, "deletable": false, "organization_id": "", "properties": {"guild_id": "", "role_id": "", "guild_token": ""}}}} responses: "200": application/json: "" @@ -2581,7 +2473,7 @@ examples: _endpointbenefit_grant_revoked_post: speakeasy-default-endpointbenefit-grant-revoked-post: requestBody: - application/json: {"data": {"created_at": "2024-03-12T10:35:36.881Z", "modified_at": "2024-04-12T13:10:16.426Z", "id": "", "is_granted": true, "is_revoked": false, "subscription_id": "", "order_id": "", "customer_id": "", "user_id": "", "benefit_id": "", "properties": {"advertisement_campaign_id": ""}, "benefit": {"created_at": "2024-04-12T13:10:16.426Z", "modified_at": "2023-03-09T05:20:11.943Z", "id": "", "description": "incidentally immense scotch meh quaff generously supposing however ugh kindly", "selectable": false, "deletable": false, "organization_id": "", "properties": {"archived": {"key": true, "key1": true, "key2": false}, "files": []}}}} + application/json: {"data": {"created_at": "2024-03-12T10:35:36.881Z", "modified_at": "2024-04-12T13:10:16.426Z", "id": "", "is_granted": true, "is_revoked": false, "subscription_id": "", "order_id": "", "customer_id": "", "user_id": "", "benefit_id": "", "customer": {"created_at": "2025-03-12T10:35:36.881Z", "modified_at": "2025-04-12T13:10:16.426Z", "id": "", "metadata": {"key": false}, "email": "Annie_Bergnaum@hotmail.com", "email_verified": true, "name": "", "billing_address": {"country": "United Kingdom"}, "tax_id": ["si_tin"], "organization_id": "", "avatar_url": "https://dramatic-rosemary.com/"}, "properties": {"advertisement_campaign_id": ""}, "benefit": {"created_at": "2023-04-02T09:33:07.666Z", "modified_at": "2024-03-07T14:00:14.922Z", "id": "", "description": "meh quaff generously supposing however ugh kindly finally what", "selectable": false, "deletable": false, "organization_id": "", "properties": {"repository_owner": "polarsource", "repository_name": "private_repo", "permission": "maintain"}}}} responses: "200": application/json: "" @@ -2641,7 +2533,7 @@ examples: speakeasy-default-customer-portal:benefit-grants:list: responses: "200": - application/json: {"items": [{"created_at": "2023-08-23T19:26:20.850Z", "modified_at": "2024-01-14T10:26:00.433Z", "id": "", "granted_at": "2022-07-14T18:23:27.528Z", "revoked_at": "2022-09-09T18:28:08.953Z", "customer_id": "", "benefit_id": "", "subscription_id": "", "order_id": "", "is_granted": true, "is_revoked": false, "benefit": {"created_at": "2023-12-02T18:25:37.169Z", "modified_at": "2022-01-20T06:21:22.156Z", "id": "", "description": "avalanche jungle unto meanwhile beside tromp worth reluctantly", "selectable": true, "deletable": false, "organization_id": "", "organization": {"created_at": "2023-08-20T22:29:27.736Z", "modified_at": "2022-03-15T10:11:56.132Z", "id": "", "name": "", "slug": "", "avatar_url": "https://free-yak.net/", "bio": "", "company": "Hane - Boyer", "blog": "", "location": "", "email": "Isabell_Schroeder@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 948614, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 20615}}, "properties": {"advertisement_campaign_id": ""}}, {"created_at": "2024-12-25T01:40:30.203Z", "modified_at": "2024-03-07T11:07:08.720Z", "id": "", "granted_at": "2024-04-21T16:08:32.154Z", "revoked_at": "2023-03-22T14:01:55.283Z", "customer_id": "", "benefit_id": "", "subscription_id": "", "order_id": "", "is_granted": true, "is_revoked": false, "benefit": {"created_at": "2024-01-25T21:46:28.752Z", "modified_at": "2023-10-26T03:45:41.195Z", "id": "", "description": "ick absent righteously reservation down dramatic", "selectable": true, "deletable": false, "organization_id": "", "organization": {"created_at": "2023-06-21T06:51:31.298Z", "modified_at": "2024-07-07T11:43:51.448Z", "id": "", "name": "", "slug": "", "avatar_url": "https://sorrowful-coil.biz", "bio": "", "company": "Howell - Tremblay", "blog": "", "location": "", "email": "Judah25@gmail.com", "twitter_username": "", "pledge_minimum_amount": 726951, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 895424}, "properties": {"active_files": ["", ""]}}}, {"created_at": "2023-06-11T07:32:02.289Z", "modified_at": "2024-03-21T06:52:57.825Z", "id": "", "granted_at": "2024-07-20T01:34:08.268Z", "revoked_at": "2022-11-06T04:06:54.106Z", "customer_id": "", "benefit_id": "", "subscription_id": "", "order_id": "", "is_granted": true, "is_revoked": true, "benefit": {"created_at": "2022-07-28T12:54:58.990Z", "modified_at": "2024-06-29T11:50:30.649Z", "id": "", "description": "never tooth swelter", "selectable": true, "deletable": false, "organization_id": "", "organization": {"created_at": "2023-03-24T19:09:17.797Z", "modified_at": "2022-09-28T14:04:50.967Z", "id": "", "name": "", "slug": "", "avatar_url": "https://well-lit-fund.org/", "bio": "", "company": "Feest, Johns and Legros", "blog": "", "location": "", "email": "Kaleb_Windler1@gmail.com", "twitter_username": "", "pledge_minimum_amount": 900213, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 536405}, "properties": {"guild_id": ""}}}], "pagination": {"total_count": 900213, "max_page": 29339}} + application/json: {"items": [{"created_at": "2024-08-22T19:26:20.850Z", "modified_at": "2025-01-13T10:26:00.433Z", "id": "", "granted_at": "2023-07-14T18:23:27.528Z", "revoked_at": "2023-09-09T18:28:08.953Z", "customer_id": "", "benefit_id": "", "subscription_id": "", "order_id": "", "is_granted": true, "is_revoked": false, "customer": {"created_at": "2024-12-01T18:25:37.169Z", "modified_at": "2023-01-20T06:21:22.156Z", "id": "", "email": "Aryanna_Pfeffer63@hotmail.com", "email_verified": true, "name": "", "billing_address": {"country": "Guatemala"}, "tax_id": [""], "oauth_accounts": {"key": {"account_id": "", "account_username": ""}, "key1": {"account_id": "", "account_username": ""}, "key2": {"account_id": "", "account_username": ""}}}, "benefit": {"created_at": "2024-09-13T22:04:07.138Z", "modified_at": "2025-08-18T13:00:42.665Z", "id": "", "description": "unto meanwhile beside tromp worth reluctantly", "selectable": true, "deletable": false, "organization_id": "", "organization": {"created_at": "2024-08-19T22:29:27.736Z", "modified_at": "2023-03-15T10:11:56.132Z", "id": "", "name": "", "slug": "", "avatar_url": "https://free-yak.net/", "bio": "", "company": "Hane - Boyer", "blog": "", "location": "", "email": "Isabell_Schroeder@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 948614, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 20615}}, "properties": {"advertisement_campaign_id": ""}}, {"created_at": "2025-12-25T01:40:30.203Z", "modified_at": "2025-03-07T11:07:08.720Z", "id": "", "granted_at": "2025-04-21T16:08:32.154Z", "revoked_at": "2024-03-21T14:01:55.283Z", "customer_id": "", "benefit_id": "", "subscription_id": "", "order_id": "", "is_granted": true, "is_revoked": false, "customer": {"created_at": "2025-01-24T21:46:28.752Z", "modified_at": "2024-10-25T03:45:41.195Z", "id": "", "email": "Allen.Harber7@yahoo.com", "email_verified": false, "name": "", "billing_address": {"country": "Yemen"}, "tax_id": [""], "oauth_accounts": {"key": {"account_id": "", "account_username": ""}}}, "benefit": {"created_at": "2023-08-22T08:40:22.005Z", "modified_at": "2025-09-14T09:33:23.636Z", "id": "", "description": "righteously reservation down", "selectable": false, "deletable": true, "organization_id": "", "organization": {"created_at": "2025-10-20T12:04:56.060Z", "modified_at": "2025-04-01T19:36:12.946Z", "id": "", "name": "", "slug": "", "avatar_url": "https://massive-cricket.biz", "bio": "", "company": "Kuhn, Smitham and Larson", "blog": "", "location": "", "email": "Carrie.Emard89@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 523166, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 621551}, "properties": {"active_files": [""]}}}, {"created_at": "2025-10-07T04:54:41.981Z", "modified_at": "2025-03-07T17:43:00.381Z", "id": "", "granted_at": "2025-06-02T11:43:36.892Z", "revoked_at": "2025-09-08T09:13:39.168Z", "customer_id": "", "benefit_id": "", "subscription_id": "", "order_id": "", "is_granted": false, "is_revoked": true, "customer": {"created_at": "2024-06-10T07:32:02.289Z", "modified_at": "2025-03-21T06:52:57.825Z", "id": "", "email": "Earnest.Heller83@hotmail.com", "email_verified": false, "name": "", "billing_address": {"country": "Benin"}, "tax_id": ["co_nit"], "oauth_accounts": {"key": {"account_id": "", "account_username": ""}}}, "benefit": {"created_at": "2024-07-23T23:46:23.843Z", "modified_at": "2025-09-09T09:50:03.003Z", "id": "", "description": "oddball pasta thread vestment", "selectable": false, "deletable": true, "organization_id": "", "organization": {"created_at": "2023-06-03T14:18:34.914Z", "modified_at": "2025-09-13T15:11:12.432Z", "id": "", "name": "", "slug": "", "avatar_url": "https://muted-hunger.biz/", "bio": "", "company": "Kiehn, MacGyver and Durgan", "blog": "", "location": "", "email": "Ignacio89@gmail.com", "twitter_username": "", "pledge_minimum_amount": 152303, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 844592}, "properties": {"repository_owner": "polarsource", "repository_name": "private_repo"}}}], "pagination": {"total_count": 900213, "max_page": 29339}} "422": application/json: {} customer_portal:benefit-grants:get: @@ -2651,7 +2543,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2023-09-05T11:33:52.011Z", "modified_at": "2023-08-20T11:11:04.610Z", "id": "", "granted_at": "2023-07-26T06:33:15.810Z", "revoked_at": "2024-11-29T01:50:48.954Z", "customer_id": "", "benefit_id": "", "subscription_id": "", "order_id": "", "is_granted": true, "is_revoked": true, "benefit": {"created_at": "2022-10-16T00:34:27.106Z", "modified_at": "2022-08-22T22:47:10.166Z", "id": "", "description": "only fellow scary but embarrassment metabolise last huddle after unless", "selectable": true, "deletable": false, "organization_id": "", "organization": {"created_at": "2022-11-11T01:19:41.687Z", "modified_at": "2022-09-18T20:12:25.613Z", "id": "", "name": "", "slug": "", "avatar_url": "https://fantastic-scholarship.net", "bio": "", "company": "Dickens, Koch and Boehm", "blog": "", "location": "", "email": "Tyson.Cummings54@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 491026, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 638700}}, "properties": {"advertisement_campaign_id": ""}} + application/json: {"created_at": "2024-09-04T11:33:52.011Z", "modified_at": "2024-08-19T11:11:04.610Z", "id": "", "granted_at": "2024-07-25T06:33:15.810Z", "revoked_at": "2025-11-29T01:50:48.954Z", "customer_id": "", "benefit_id": "", "subscription_id": "", "order_id": "", "is_granted": true, "is_revoked": true, "customer": {"created_at": "2023-10-16T00:34:27.106Z", "modified_at": "2023-08-22T22:47:10.166Z", "id": "", "email": "Ian.Block31@hotmail.com", "email_verified": false, "name": "", "billing_address": {"country": "Singapore"}, "tax_id": ["mx_rfc"], "oauth_accounts": {"key": {"account_id": "", "account_username": ""}, "key1": {"account_id": "", "account_username": ""}}}, "benefit": {"created_at": "2023-12-20T13:59:56.783Z", "modified_at": "2023-12-21T05:04:07.004Z", "id": "", "description": "unused cone restructure gadzooks", "selectable": false, "deletable": false, "organization_id": "", "organization": {"created_at": "2025-05-29T14:54:03.265Z", "modified_at": "2024-03-11T15:23:46.888Z", "id": "", "name": "", "slug": "", "avatar_url": "https://last-brook.net", "bio": "", "company": "Upton and Sons", "blog": "", "location": "", "email": "Hassan_Robel@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 72108, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 165215}}, "properties": {"advertisement_campaign_id": ""}} "404": application/json: {"detail": ""} "422": @@ -2663,7 +2555,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2023-01-13T16:52:57.274Z", "modified_at": "2024-12-22T15:27:45.882Z", "id": "", "granted_at": "2023-11-19T22:44:58.301Z", "revoked_at": "2023-06-20T18:46:17.643Z", "customer_id": "", "benefit_id": "", "subscription_id": "", "order_id": "", "is_granted": false, "is_revoked": true, "benefit": {"created_at": "2024-09-09T13:32:29.600Z", "modified_at": "2023-05-05T18:16:40.936Z", "id": "", "description": "scowl mostly rekindle bleak from", "selectable": true, "deletable": false, "organization_id": "", "organization": {"created_at": "2023-01-06T08:10:12.343Z", "modified_at": "2023-01-18T02:16:35.227Z", "id": "", "name": "", "slug": "", "avatar_url": "https://dazzling-paintwork.org/", "bio": "", "company": "Huel Inc", "blog": "", "location": "", "email": "Rosario20@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 243447, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 198183}, "properties": {"prefix": "", "expires": {"ttl": 338673, "timeframe": "day"}, "activations": {"limit": 175843, "enable_customer_admin": true}, "limit_usage": 332914}}} + application/json: {"created_at": "2024-01-13T16:52:57.274Z", "modified_at": "2025-12-22T15:27:45.882Z", "id": "", "granted_at": "2024-11-18T22:44:58.301Z", "revoked_at": "2024-06-19T18:46:17.643Z", "customer_id": "", "benefit_id": "", "subscription_id": "", "order_id": "", "is_granted": false, "is_revoked": true, "customer": {"created_at": "2025-09-09T13:32:29.600Z", "modified_at": "2024-05-04T18:16:40.936Z", "id": "", "email": "Delphia_Schamberger@gmail.com", "email_verified": false, "name": "", "billing_address": {"country": "Papua New Guinea"}, "tax_id": [""], "oauth_accounts": {"key": {"account_id": "", "account_username": ""}, "key1": {"account_id": "", "account_username": ""}, "key2": {"account_id": "", "account_username": ""}}}, "benefit": {"created_at": "2025-06-07T17:17:15.505Z", "modified_at": "2024-04-26T07:27:10.489Z", "id": "", "description": "rekindle bleak from that qualified cycle woot", "selectable": true, "deletable": true, "organization_id": "", "organization": {"created_at": "2025-08-25T18:26:56.554Z", "modified_at": "2024-04-04T03:41:48.272Z", "id": "", "name": "", "slug": "", "avatar_url": "https://rundown-abacus.info", "bio": "", "company": "Mertz and Sons", "blog": "", "location": "", "email": "Una.Greenfelder@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 249026, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 335191}, "properties": {"prefix": "", "expires": {"ttl": 532806, "timeframe": "day"}, "activations": {"limit": 556706, "enable_customer_admin": true}, "limit_usage": 416023}}} "403": application/json: {"detail": ""} "404": @@ -2759,7 +2651,7 @@ examples: speakeasy-default-customer-portal:orders:list: responses: "200": - application/json: {"items": [{"created_at": "2023-08-23T19:26:20.850Z", "modified_at": "2024-01-14T10:26:00.433Z", "id": "", "amount": 177706, "tax_amount": 229716, "currency": "Belize Dollar", "customer_id": "", "product_id": "", "product_price_id": "", "subscription_id": "", "user_id": "", "product": {"created_at": "2023-11-28T13:02:27.296Z", "modified_at": "2023-12-02T18:25:37.169Z", "id": "", "name": "", "description": "accountability pish likewise", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [], "benefits": [{"created_at": "2022-05-29T14:05:29.727Z", "modified_at": "2023-05-20T11:06:26.987Z", "id": "", "type": "discord", "description": "beside tromp worth reluctantly wound accompanist", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2024-05-02T01:42:40.060Z", "modified_at": "2023-07-09T07:59:15.466Z", "id": "", "type": "license_keys", "description": "angrily inasmuch irritably finally round alongside whoever jump joyfully discourse", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2024-06-02T11:43:36.892Z", "modified_at": "2024-09-08T09:13:39.168Z", "id": "", "type": "downloadables", "description": "finally earth that early", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [], "organization": {"created_at": "2023-12-12T21:57:01.257Z", "modified_at": "2023-03-24T19:09:17.797Z", "id": "", "name": "", "slug": "", "avatar_url": "https://acceptable-validity.info/", "bio": "", "company": "Vandervort, Feest and Johns", "blog": "", "location": "", "email": "Aimee_DAmore62@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 140142, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 29339}}, "product_price": {"created_at": "2024-01-14T10:26:00.433Z", "modified_at": "2022-07-14T18:23:27.528Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 152837, "maximum_amount": 635532, "preset_amount": 639387}, "subscription": {"created_at": "2023-04-28T12:09:29.137Z", "modified_at": "2023-03-31T01:03:36.657Z", "id": "", "amount": 253529, "currency": "Tugrik", "recurring_interval": "year", "status": "canceled", "current_period_start": "2022-06-16T22:11:32.719Z", "current_period_end": "2024-10-03T23:44:36.269Z", "cancel_at_period_end": false, "started_at": "2023-06-19T04:12:45.071Z", "ended_at": "2024-12-03T09:47:00.347Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": ""}}, {"created_at": "2022-09-13T06:39:19.968Z", "modified_at": "2022-01-21T07:06:12.853Z", "id": "", "amount": 197777, "tax_amount": 621450, "currency": "Manat", "customer_id": "", "product_id": "", "product_price_id": "", "subscription_id": "", "user_id": "", "product": {"created_at": "2024-08-19T10:34:27.488Z", "modified_at": "2024-04-21T05:31:02.040Z", "id": "", "name": "", "description": "what married owlishly which wonderfully CD", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2022-04-05T09:49:38.010Z", "modified_at": "2022-03-17T01:57:00.187Z", "id": "", "is_archived": false, "product_id": "", "recurring_interval": "year"}], "benefits": [{"created_at": "2024-07-09T08:01:51.932Z", "modified_at": "2024-11-27T17:23:02.117Z", "id": "", "type": "custom", "description": "till boo ack solicit weakly segregate boo", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2024-10-06T07:08:41.329Z", "modified_at": "2024-12-31T08:16:04.009Z", "id": "", "type": "custom", "description": "opposite amnesty tomography how until to onto ouch shrilly ramp", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2022-09-15T23:31:11.246Z", "modified_at": "2024-10-29T11:50:25.062Z", "id": "", "type": "discord", "description": "icy council meanwhile except following ick verbally drat", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/etc/mail", "mime_type": "", "size": 993741, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-11-16T01:22:49.169Z", "version": "", "is_uploaded": false, "created_at": "2023-12-09T05:38:21.152Z", "size_readable": "", "public_url": "https://tender-squid.org"}, {"id": "", "organization_id": "", "name": "", "path": "/usr", "mime_type": "", "size": 440830, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-06-16T08:19:05.026Z", "version": "", "is_uploaded": false, "created_at": "2024-07-16T11:55:05.618Z", "size_readable": "", "public_url": "https://unwelcome-license.org"}], "organization": {"created_at": "2024-05-28T03:27:06.201Z", "modified_at": "2024-08-23T10:37:24.845Z", "id": "", "name": "", "slug": "", "avatar_url": "https://plump-horde.com", "bio": "", "company": "Pfeffer - Bruen", "blog": "", "location": "", "email": "Adolf17@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 73002, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 443316}}, "product_price": {"created_at": "2022-03-01T20:22:54.911Z", "modified_at": "2023-02-08T01:09:52.088Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 73227}, "subscription": {"created_at": "2024-01-16T02:12:31.415Z", "modified_at": "2024-04-24T19:54:59.989Z", "id": "", "amount": 537373, "currency": "Moldovan Leu", "recurring_interval": "year", "status": "past_due", "current_period_start": "2023-09-01T03:57:12.777Z", "current_period_end": "2024-03-30T11:09:26.643Z", "cancel_at_period_end": false, "started_at": "2024-03-07T05:10:23.090Z", "ended_at": "2023-06-12T11:22:18.392Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": ""}}, {"created_at": "2023-04-27T04:18:19.309Z", "modified_at": "2023-01-21T09:29:51.966Z", "id": "", "amount": 213662, "tax_amount": 898170, "currency": "Comoro Franc", "customer_id": "", "product_id": "", "product_price_id": "", "subscription_id": "", "user_id": "", "product": {"created_at": "2023-07-09T08:27:04.982Z", "modified_at": "2024-03-05T15:08:11.722Z", "id": "", "name": "", "description": "boo larva homely commonly grass", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [], "benefits": [{"created_at": "2024-10-22T23:23:39.791Z", "modified_at": "2023-05-30T02:21:30.439Z", "id": "", "type": "ads", "description": "blowgun zowie yahoo on drum dusk rightfully finally", "selectable": true, "deletable": true, "organization_id": ""}, {"created_at": "2023-11-26T06:16:53.741Z", "modified_at": "2022-02-25T14:48:29.331Z", "id": "", "type": "license_keys", "description": "technician jaggedly scarcely honestly submitter", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2024-05-26T16:28:35.656Z", "modified_at": "2022-08-22T17:51:41.532Z", "id": "", "type": "custom", "description": "aw ew once underneath mid impressionable jovially", "selectable": true, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/mnt", "mime_type": "", "size": 196134, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-04-13T21:18:45.526Z", "version": "", "is_uploaded": true, "created_at": "2024-01-14T08:44:55.565Z", "size_readable": "", "public_url": "https://oddball-cricket.name"}], "organization": {"created_at": "2022-06-11T01:25:26.848Z", "modified_at": "2022-04-01T21:39:44.500Z", "id": "", "name": "", "slug": "", "avatar_url": "https://helpful-barracks.org/", "bio": "", "company": "Schmidt, Ferry and Cormier", "blog": "", "location": "", "email": "Irma_McCullough30@gmail.com", "twitter_username": "", "pledge_minimum_amount": 974, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 206014}}, "product_price": {"created_at": "2024-08-18T13:00:42.665Z", "modified_at": "2023-06-22T03:00:04.393Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 322596, "maximum_amount": 860596, "preset_amount": 18278}, "subscription": {"created_at": "2023-01-19T21:34:42.876Z", "modified_at": "2024-08-07T03:26:01.283Z", "id": "", "amount": 772002, "currency": "Malaysian Ringgit", "recurring_interval": "year", "status": "past_due", "current_period_start": "2022-02-25T21:21:59.049Z", "current_period_end": "2024-02-14T12:44:36.784Z", "cancel_at_period_end": true, "started_at": "2023-06-19T20:01:25.362Z", "ended_at": "2022-11-08T22:14:18.852Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": ""}}], "pagination": {"total_count": 584415, "max_page": 883301}} + application/json: {"items": [{"created_at": "2023-08-23T19:26:20.850Z", "modified_at": "2024-01-14T10:26:00.433Z", "id": "", "amount": 177706, "tax_amount": 229716, "currency": "Belize Dollar", "customer_id": "", "product_id": "", "product_price_id": "", "subscription_id": "", "user_id": "", "product": {"created_at": "2023-11-28T13:02:27.296Z", "modified_at": "2023-12-02T18:25:37.169Z", "id": "", "name": "", "description": "accountability pish likewise", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [], "benefits": [{"created_at": "2022-05-29T14:05:29.727Z", "modified_at": "2023-05-20T11:06:26.987Z", "id": "", "type": "discord", "description": "beside tromp worth reluctantly wound accompanist", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2024-05-02T01:42:40.060Z", "modified_at": "2023-07-09T07:59:15.466Z", "id": "", "type": "license_keys", "description": "angrily inasmuch irritably finally round alongside whoever jump joyfully discourse", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2024-06-02T11:43:36.892Z", "modified_at": "2024-09-08T09:13:39.168Z", "id": "", "type": "downloadables", "description": "finally earth that early", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [], "organization": {"created_at": "2023-12-12T21:57:01.257Z", "modified_at": "2023-03-24T19:09:17.797Z", "id": "", "name": "", "slug": "", "avatar_url": "https://acceptable-validity.info/", "bio": "", "company": "Vandervort, Feest and Johns", "blog": "", "location": "", "email": "Aimee_DAmore62@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 140142, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 29339}}, "product_price": {"created_at": "2025-01-13T10:26:00.433Z", "modified_at": "2023-07-14T18:23:27.528Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 152837, "maximum_amount": 635532, "preset_amount": 639387}, "subscription": {"created_at": "2023-04-28T12:09:29.137Z", "modified_at": "2023-03-31T01:03:36.657Z", "id": "", "amount": 253529, "currency": "Tugrik", "recurring_interval": "year", "status": "canceled", "current_period_start": "2022-06-16T22:11:32.719Z", "current_period_end": "2024-10-03T23:44:36.269Z", "cancel_at_period_end": false, "started_at": "2023-06-19T04:12:45.071Z", "ended_at": "2024-12-03T09:47:00.347Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": ""}}, {"created_at": "2022-09-13T06:39:19.968Z", "modified_at": "2022-01-21T07:06:12.853Z", "id": "", "amount": 197777, "tax_amount": 621450, "currency": "Manat", "customer_id": "", "product_id": "", "product_price_id": "", "subscription_id": "", "user_id": "", "product": {"created_at": "2024-08-19T10:34:27.488Z", "modified_at": "2024-04-21T05:31:02.040Z", "id": "", "name": "", "description": "what married owlishly which wonderfully CD", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2023-04-05T09:49:38.010Z", "modified_at": "2023-03-17T01:57:00.187Z", "id": "", "is_archived": false, "product_id": "", "recurring_interval": "year"}], "benefits": [{"created_at": "2024-07-09T08:01:51.932Z", "modified_at": "2024-11-27T17:23:02.117Z", "id": "", "type": "custom", "description": "till boo ack solicit weakly segregate boo", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2024-10-06T07:08:41.329Z", "modified_at": "2024-12-31T08:16:04.009Z", "id": "", "type": "custom", "description": "opposite amnesty tomography how until to onto ouch shrilly ramp", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2022-09-15T23:31:11.246Z", "modified_at": "2024-10-29T11:50:25.062Z", "id": "", "type": "discord", "description": "icy council meanwhile except following ick verbally drat", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/etc/mail", "mime_type": "", "size": 993741, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-11-16T01:22:49.169Z", "version": "", "is_uploaded": false, "created_at": "2023-12-09T05:38:21.152Z", "size_readable": "", "public_url": "https://tender-squid.org"}, {"id": "", "organization_id": "", "name": "", "path": "/usr", "mime_type": "", "size": 440830, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-06-16T08:19:05.026Z", "version": "", "is_uploaded": false, "created_at": "2024-07-16T11:55:05.618Z", "size_readable": "", "public_url": "https://unwelcome-license.org"}], "organization": {"created_at": "2024-05-28T03:27:06.201Z", "modified_at": "2024-08-23T10:37:24.845Z", "id": "", "name": "", "slug": "", "avatar_url": "https://plump-horde.com", "bio": "", "company": "Pfeffer - Bruen", "blog": "", "location": "", "email": "Adolf17@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 73002, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 443316}}, "product_price": {"created_at": "2023-03-01T20:22:54.911Z", "modified_at": "2024-02-08T01:09:52.088Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 73227}, "subscription": {"created_at": "2024-01-16T02:12:31.415Z", "modified_at": "2024-04-24T19:54:59.989Z", "id": "", "amount": 537373, "currency": "Moldovan Leu", "recurring_interval": "year", "status": "past_due", "current_period_start": "2023-09-01T03:57:12.777Z", "current_period_end": "2024-03-30T11:09:26.643Z", "cancel_at_period_end": false, "started_at": "2024-03-07T05:10:23.090Z", "ended_at": "2023-06-12T11:22:18.392Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": ""}}, {"created_at": "2023-04-27T04:18:19.309Z", "modified_at": "2023-01-21T09:29:51.966Z", "id": "", "amount": 213662, "tax_amount": 898170, "currency": "Comoro Franc", "customer_id": "", "product_id": "", "product_price_id": "", "subscription_id": "", "user_id": "", "product": {"created_at": "2023-07-09T08:27:04.982Z", "modified_at": "2024-03-05T15:08:11.722Z", "id": "", "name": "", "description": "boo larva homely commonly grass", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [], "benefits": [{"created_at": "2024-10-22T23:23:39.791Z", "modified_at": "2023-05-30T02:21:30.439Z", "id": "", "type": "ads", "description": "blowgun zowie yahoo on drum dusk rightfully finally", "selectable": true, "deletable": true, "organization_id": ""}, {"created_at": "2023-11-26T06:16:53.741Z", "modified_at": "2022-02-25T14:48:29.331Z", "id": "", "type": "license_keys", "description": "technician jaggedly scarcely honestly submitter", "selectable": true, "deletable": false, "organization_id": ""}, {"created_at": "2024-05-26T16:28:35.656Z", "modified_at": "2022-08-22T17:51:41.532Z", "id": "", "type": "custom", "description": "aw ew once underneath mid impressionable jovially", "selectable": true, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/mnt", "mime_type": "", "size": 196134, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-04-13T21:18:45.526Z", "version": "", "is_uploaded": true, "created_at": "2024-01-14T08:44:55.565Z", "size_readable": "", "public_url": "https://oddball-cricket.name"}], "organization": {"created_at": "2022-06-11T01:25:26.848Z", "modified_at": "2022-04-01T21:39:44.500Z", "id": "", "name": "", "slug": "", "avatar_url": "https://helpful-barracks.org/", "bio": "", "company": "Schmidt, Ferry and Cormier", "blog": "", "location": "", "email": "Irma_McCullough30@gmail.com", "twitter_username": "", "pledge_minimum_amount": 974, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 206014}}, "product_price": {"created_at": "2025-08-18T13:00:42.665Z", "modified_at": "2024-06-21T03:00:04.393Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 322596, "maximum_amount": 860596, "preset_amount": 18278}, "subscription": {"created_at": "2023-01-19T21:34:42.876Z", "modified_at": "2024-08-07T03:26:01.283Z", "id": "", "amount": 772002, "currency": "Malaysian Ringgit", "recurring_interval": "year", "status": "past_due", "current_period_start": "2022-02-25T21:21:59.049Z", "current_period_end": "2024-02-14T12:44:36.784Z", "cancel_at_period_end": true, "started_at": "2023-06-19T20:01:25.362Z", "ended_at": "2022-11-08T22:14:18.852Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": ""}}], "pagination": {"total_count": 584415, "max_page": 883301}} "422": application/json: {} customer_portal:orders:get: @@ -2769,7 +2661,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2024-02-07T13:54:48.821Z", "modified_at": "2023-09-05T11:33:52.011Z", "id": "", "amount": 544221, "tax_amount": 521235, "currency": "Rand", "customer_id": "", "product_id": "", "product_price_id": "", "subscription_id": "", "user_id": "", "product": {"created_at": "2023-05-18T00:32:02.244Z", "modified_at": "2023-05-10T02:28:23.533Z", "id": "", "name": "", "description": "extract neaten qua meanwhile bah", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2023-08-20T11:11:04.610Z", "modified_at": "2023-07-26T06:33:15.810Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 458049, "maximum_amount": 450824, "preset_amount": 262795}, {"created_at": "2023-04-26T04:53:50.189Z", "modified_at": "2024-05-28T07:17:57.134Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "month"}], "benefits": [], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/opt/include", "mime_type": "", "size": 908293, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-04-06T10:37:18.493Z", "version": "", "is_uploaded": false, "created_at": "2023-04-01T04:11:43.083Z", "size_readable": "", "public_url": "https://shy-knuckle.org/"}, {"id": "", "organization_id": "", "name": "", "path": "/private/var", "mime_type": "", "size": 72108, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-03-31T04:26:02.125Z", "version": "", "is_uploaded": true, "created_at": "2023-12-13T10:59:52.193Z", "size_readable": "", "public_url": "https://writhing-airman.name"}], "organization": {"created_at": "2024-01-25T20:29:18.334Z", "modified_at": "2022-11-17T13:07:10.938Z", "id": "", "name": "", "slug": "", "avatar_url": "https://foolish-descendant.net", "bio": "", "company": "Schaefer - Sawayn", "blog": "", "location": "", "email": "Citlalli.Boehm@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 168726, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 546533}}, "product_price": {"created_at": "2023-08-29T15:06:35.685Z", "modified_at": "2024-06-02T05:45:06.910Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 746585, "recurring_interval": "year"}, "subscription": {"created_at": "2022-02-04T11:10:26.128Z", "modified_at": "2023-01-08T11:20:01.925Z", "id": "", "amount": 844917, "currency": "Moldovan Leu", "recurring_interval": "year", "status": "canceled", "current_period_start": "2023-01-20T11:46:53.929Z", "current_period_end": "2023-08-09T16:26:13.017Z", "cancel_at_period_end": false, "started_at": "2024-09-27T20:59:18.499Z", "ended_at": "2022-08-28T17:52:37.706Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": ""}} + application/json: {"created_at": "2024-02-07T13:54:48.821Z", "modified_at": "2023-09-05T11:33:52.011Z", "id": "", "amount": 544221, "tax_amount": 521235, "currency": "Rand", "customer_id": "", "product_id": "", "product_price_id": "", "subscription_id": "", "user_id": "", "product": {"created_at": "2023-05-18T00:32:02.244Z", "modified_at": "2023-05-10T02:28:23.533Z", "id": "", "name": "", "description": "extract neaten qua meanwhile bah", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2024-08-19T11:11:04.610Z", "modified_at": "2024-07-25T06:33:15.810Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 458049, "maximum_amount": 450824, "preset_amount": 262795}, {"created_at": "2024-04-25T04:53:50.189Z", "modified_at": "2025-05-28T07:17:57.134Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "month"}], "benefits": [], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/opt/include", "mime_type": "", "size": 908293, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-04-06T10:37:18.493Z", "version": "", "is_uploaded": false, "created_at": "2023-04-01T04:11:43.083Z", "size_readable": "", "public_url": "https://shy-knuckle.org/"}, {"id": "", "organization_id": "", "name": "", "path": "/private/var", "mime_type": "", "size": 72108, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-03-31T04:26:02.125Z", "version": "", "is_uploaded": true, "created_at": "2023-12-13T10:59:52.193Z", "size_readable": "", "public_url": "https://writhing-airman.name"}], "organization": {"created_at": "2024-01-25T20:29:18.334Z", "modified_at": "2022-11-17T13:07:10.938Z", "id": "", "name": "", "slug": "", "avatar_url": "https://foolish-descendant.net", "bio": "", "company": "Schaefer - Sawayn", "blog": "", "location": "", "email": "Citlalli.Boehm@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 168726, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 546533}}, "product_price": {"created_at": "2024-08-28T15:06:35.685Z", "modified_at": "2025-06-02T05:45:06.910Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 746585, "recurring_interval": "year"}, "subscription": {"created_at": "2022-02-04T11:10:26.128Z", "modified_at": "2023-01-08T11:20:01.925Z", "id": "", "amount": 844917, "currency": "Moldovan Leu", "recurring_interval": "year", "status": "canceled", "current_period_start": "2023-01-20T11:46:53.929Z", "current_period_end": "2023-08-09T16:26:13.017Z", "cancel_at_period_end": false, "started_at": "2024-09-27T20:59:18.499Z", "ended_at": "2022-08-28T17:52:37.706Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": ""}} "404": application/json: {"detail": ""} "422": @@ -2802,7 +2694,7 @@ examples: speakeasy-default-customer-portal:subscriptions:list: responses: "200": - application/json: {"items": [{"created_at": "2023-08-23T19:26:20.850Z", "modified_at": "2024-01-14T10:26:00.433Z", "id": "", "amount": 177706, "currency": "Danish Krone", "recurring_interval": "month", "status": "past_due", "current_period_start": "2023-12-02T18:25:37.169Z", "current_period_end": "2022-01-20T06:21:22.156Z", "cancel_at_period_end": false, "started_at": "2022-04-05T09:49:38.010Z", "ended_at": "2022-03-17T01:57:00.187Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": "", "product": {"created_at": "2024-01-25T00:05:25.844Z", "modified_at": "2023-07-13T19:57:33.016Z", "id": "", "name": "", "description": "since zowie loudly aha although gosh whenever as", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2024-01-14T10:26:00.433Z", "modified_at": "2022-07-14T18:23:27.528Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 152837, "maximum_amount": 635532, "preset_amount": 639387}, {"created_at": "2022-04-05T09:49:38.010Z", "modified_at": "2022-03-17T01:57:00.187Z", "id": "", "is_archived": false, "product_id": "", "recurring_interval": "year"}], "benefits": [], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/var/yp", "mime_type": "", "size": 726700, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-04-21T16:08:32.154Z", "version": "", "is_uploaded": true, "created_at": "2022-02-02T01:51:19.643Z", "size_readable": "", "public_url": "https://robust-nightlife.info"}], "organization": {"created_at": "2022-02-15T08:57:09.959Z", "modified_at": "2024-06-28T00:46:13.804Z", "id": "", "name": "", "slug": "", "avatar_url": "https://improbable-bin.com/", "bio": "", "company": "Yundt, Kassulke and Hilpert", "blog": "", "location": "", "email": "Craig_Beatty42@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 207451, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 123187}}, "price": {"created_at": "2022-03-01T20:22:54.911Z", "modified_at": "2023-02-08T01:09:52.088Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 73227}}, {"created_at": "2023-06-19T05:46:32.685Z", "modified_at": "2024-04-03T18:06:02.533Z", "id": "", "amount": 751563, "currency": "Fiji Dollar", "recurring_interval": "year", "status": "incomplete", "current_period_start": "2023-10-15T09:46:50.350Z", "current_period_end": "2023-09-15T02:22:04.749Z", "cancel_at_period_end": true, "started_at": "2023-03-16T17:53:52.024Z", "ended_at": "2023-10-23T07:49:38.272Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": "", "product": {"created_at": "2023-02-27T07:39:18.966Z", "modified_at": "2024-10-20T12:04:56.060Z", "id": "", "name": "", "description": "times uselessly toothpick silently aftermath never tooth swelter", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2024-08-18T13:00:42.665Z", "modified_at": "2023-06-22T03:00:04.393Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 322596, "maximum_amount": 860596, "preset_amount": 18278}], "benefits": [{"created_at": "2023-08-02T09:45:28.536Z", "modified_at": "2022-01-22T12:19:34.261Z", "id": "", "type": "github_repository", "description": "obnoxiously after crooked enthusiastically", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/usr/libexec", "mime_type": "", "size": 412854, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-10-29T17:09:20.090Z", "version": "", "is_uploaded": true, "created_at": "2023-01-25T00:59:27.422Z", "size_readable": "", "public_url": "https://oblong-inspection.net"}, {"id": "", "organization_id": "", "name": "", "path": "/etc/periodic", "mime_type": "", "size": 783071, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-02-15T10:16:55.982Z", "version": "", "is_uploaded": false, "created_at": "2023-06-28T18:50:42.778Z", "size_readable": "", "public_url": "https://married-presume.net"}, {"id": "", "organization_id": "", "name": "", "path": "/var/mail", "mime_type": "", "size": 674469, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-06-25T16:02:25.369Z", "version": "", "is_uploaded": true, "created_at": "2023-09-11T11:54:14.319Z", "size_readable": "", "public_url": "https://writhing-conversation.com"}], "organization": {"created_at": "2023-10-30T05:49:01.311Z", "modified_at": "2022-12-07T09:46:44.632Z", "id": "", "name": "", "slug": "", "avatar_url": "https://hateful-linseed.info", "bio": "", "company": "Powlowski - Ebert", "blog": "", "location": "", "email": "Timmy27@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 421, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 327973}}, "price": {"created_at": "2024-09-28T03:47:03.515Z", "modified_at": "2022-07-09T16:58:41.012Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 897069, "maximum_amount": 135572, "preset_amount": 460276}}, {"created_at": "2022-10-23T20:39:57.368Z", "modified_at": "2022-08-21T04:01:37.813Z", "id": "", "amount": 119137, "currency": "Manat", "recurring_interval": "year", "status": "unpaid", "current_period_start": "2022-04-04T09:25:47.730Z", "current_period_end": "2023-09-27T01:29:37.942Z", "cancel_at_period_end": true, "started_at": "2024-09-05T07:44:59.336Z", "ended_at": "2022-07-24T14:46:52.205Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": "", "product": {"created_at": "2022-04-28T15:20:19.317Z", "modified_at": "2023-06-28T02:37:34.714Z", "id": "", "name": "", "description": "and jaggedly aftermath after although while", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2023-06-11T18:07:18.321Z", "modified_at": "2022-04-24T08:24:21.019Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 841031, "maximum_amount": 410206, "preset_amount": 863466, "recurring_interval": "month"}, {"created_at": "2022-07-18T12:08:53.113Z", "modified_at": "2024-09-28T13:56:10.162Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 628106, "recurring_interval": "year"}], "benefits": [], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/etc/defaults", "mime_type": "", "size": 96811, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-02-08T12:01:40.965Z", "version": "", "is_uploaded": true, "created_at": "2024-07-17T07:32:23.211Z", "size_readable": "", "public_url": "https://unimportant-tusk.net/"}, {"id": "", "organization_id": "", "name": "", "path": "/var/log", "mime_type": "", "size": 714491, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-01-18T21:03:55.557Z", "version": "", "is_uploaded": false, "created_at": "2022-05-10T00:49:50.875Z", "size_readable": "", "public_url": "https://passionate-dream.net/"}], "organization": {"created_at": "2022-08-25T01:38:35.053Z", "modified_at": "2024-07-11T17:35:14.425Z", "id": "", "name": "", "slug": "", "avatar_url": "https://lovable-gift.net/", "bio": "", "company": "Fisher and Sons", "blog": "", "location": "", "email": "Akeem28@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 526688, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 201885}}, "price": {"created_at": "2024-01-30T10:30:11.361Z", "modified_at": "2023-09-15T04:48:08.824Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "price_amount": 816637}}], "pagination": {"total_count": 206196, "max_page": 741584}} + application/json: {"items": [{"created_at": "2023-08-23T19:26:20.850Z", "modified_at": "2024-01-14T10:26:00.433Z", "id": "", "amount": 177706, "currency": "Danish Krone", "recurring_interval": "month", "status": "past_due", "current_period_start": "2023-12-02T18:25:37.169Z", "current_period_end": "2022-01-20T06:21:22.156Z", "cancel_at_period_end": false, "started_at": "2022-04-05T09:49:38.010Z", "ended_at": "2022-03-17T01:57:00.187Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": "", "product": {"created_at": "2024-01-25T00:05:25.844Z", "modified_at": "2023-07-13T19:57:33.016Z", "id": "", "name": "", "description": "since zowie loudly aha although gosh whenever as", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2025-01-13T10:26:00.433Z", "modified_at": "2023-07-14T18:23:27.528Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 152837, "maximum_amount": 635532, "preset_amount": 639387}, {"created_at": "2023-04-05T09:49:38.010Z", "modified_at": "2023-03-17T01:57:00.187Z", "id": "", "is_archived": false, "product_id": "", "recurring_interval": "year"}], "benefits": [], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/var/yp", "mime_type": "", "size": 726700, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-04-21T16:08:32.154Z", "version": "", "is_uploaded": true, "created_at": "2022-02-02T01:51:19.643Z", "size_readable": "", "public_url": "https://robust-nightlife.info"}], "organization": {"created_at": "2022-02-15T08:57:09.959Z", "modified_at": "2024-06-28T00:46:13.804Z", "id": "", "name": "", "slug": "", "avatar_url": "https://improbable-bin.com/", "bio": "", "company": "Yundt, Kassulke and Hilpert", "blog": "", "location": "", "email": "Craig_Beatty42@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 207451, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 123187}}, "price": {"created_at": "2023-03-01T20:22:54.911Z", "modified_at": "2024-02-08T01:09:52.088Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 73227}}, {"created_at": "2023-06-19T05:46:32.685Z", "modified_at": "2024-04-03T18:06:02.533Z", "id": "", "amount": 751563, "currency": "Fiji Dollar", "recurring_interval": "year", "status": "incomplete", "current_period_start": "2023-10-15T09:46:50.350Z", "current_period_end": "2023-09-15T02:22:04.749Z", "cancel_at_period_end": true, "started_at": "2023-03-16T17:53:52.024Z", "ended_at": "2023-10-23T07:49:38.272Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": "", "product": {"created_at": "2023-02-27T07:39:18.966Z", "modified_at": "2024-10-20T12:04:56.060Z", "id": "", "name": "", "description": "times uselessly toothpick silently aftermath never tooth swelter", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2025-08-18T13:00:42.665Z", "modified_at": "2024-06-21T03:00:04.393Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 322596, "maximum_amount": 860596, "preset_amount": 18278}], "benefits": [{"created_at": "2023-08-02T09:45:28.536Z", "modified_at": "2022-01-22T12:19:34.261Z", "id": "", "type": "github_repository", "description": "obnoxiously after crooked enthusiastically", "selectable": false, "deletable": false, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/usr/libexec", "mime_type": "", "size": 412854, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-10-29T17:09:20.090Z", "version": "", "is_uploaded": true, "created_at": "2023-01-25T00:59:27.422Z", "size_readable": "", "public_url": "https://oblong-inspection.net"}, {"id": "", "organization_id": "", "name": "", "path": "/etc/periodic", "mime_type": "", "size": 783071, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2023-02-15T10:16:55.982Z", "version": "", "is_uploaded": false, "created_at": "2023-06-28T18:50:42.778Z", "size_readable": "", "public_url": "https://married-presume.net"}, {"id": "", "organization_id": "", "name": "", "path": "/var/mail", "mime_type": "", "size": 674469, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-06-25T16:02:25.369Z", "version": "", "is_uploaded": true, "created_at": "2023-09-11T11:54:14.319Z", "size_readable": "", "public_url": "https://writhing-conversation.com"}], "organization": {"created_at": "2023-10-30T05:49:01.311Z", "modified_at": "2022-12-07T09:46:44.632Z", "id": "", "name": "", "slug": "", "avatar_url": "https://hateful-linseed.info", "bio": "", "company": "Powlowski - Ebert", "blog": "", "location": "", "email": "Timmy27@hotmail.com", "twitter_username": "", "pledge_minimum_amount": 421, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 327973}}, "price": {"created_at": "2025-09-28T03:47:03.515Z", "modified_at": "2023-07-09T16:58:41.012Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 897069, "maximum_amount": 135572, "preset_amount": 460276}}, {"created_at": "2022-10-23T20:39:57.368Z", "modified_at": "2022-08-21T04:01:37.813Z", "id": "", "amount": 119137, "currency": "Manat", "recurring_interval": "year", "status": "unpaid", "current_period_start": "2022-04-04T09:25:47.730Z", "current_period_end": "2023-09-27T01:29:37.942Z", "cancel_at_period_end": true, "started_at": "2024-09-05T07:44:59.336Z", "ended_at": "2022-07-24T14:46:52.205Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": "", "product": {"created_at": "2022-04-28T15:20:19.317Z", "modified_at": "2023-06-28T02:37:34.714Z", "id": "", "name": "", "description": "and jaggedly aftermath after although while", "is_recurring": true, "is_archived": true, "organization_id": "", "prices": [{"created_at": "2024-06-10T18:07:18.321Z", "modified_at": "2023-04-24T08:24:21.019Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 841031, "maximum_amount": 410206, "preset_amount": 863466, "recurring_interval": "month"}, {"created_at": "2023-07-18T12:08:53.113Z", "modified_at": "2025-09-28T13:56:10.162Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "price_amount": 628106, "recurring_interval": "year"}], "benefits": [], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/etc/defaults", "mime_type": "", "size": 96811, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-02-08T12:01:40.965Z", "version": "", "is_uploaded": true, "created_at": "2024-07-17T07:32:23.211Z", "size_readable": "", "public_url": "https://unimportant-tusk.net/"}, {"id": "", "organization_id": "", "name": "", "path": "/var/log", "mime_type": "", "size": 714491, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-01-18T21:03:55.557Z", "version": "", "is_uploaded": false, "created_at": "2022-05-10T00:49:50.875Z", "size_readable": "", "public_url": "https://passionate-dream.net/"}], "organization": {"created_at": "2022-08-25T01:38:35.053Z", "modified_at": "2024-07-11T17:35:14.425Z", "id": "", "name": "", "slug": "", "avatar_url": "https://lovable-gift.net/", "bio": "", "company": "Fisher and Sons", "blog": "", "location": "", "email": "Akeem28@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 526688, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 201885}}, "price": {"created_at": "2025-01-29T10:30:11.361Z", "modified_at": "2024-09-14T04:48:08.824Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "price_amount": 816637}}], "pagination": {"total_count": 206196, "max_page": 741584}} "422": application/json: {} customer_portal:subscriptions:get: @@ -2812,7 +2704,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2024-02-07T13:54:48.821Z", "modified_at": "2023-09-05T11:33:52.011Z", "id": "", "amount": 544221, "currency": "Moroccan Dirham", "recurring_interval": "year", "status": "active", "current_period_start": "2023-05-10T02:28:23.533Z", "current_period_end": "2022-10-16T00:34:27.106Z", "cancel_at_period_end": true, "started_at": "2024-10-24T02:41:21.259Z", "ended_at": "2023-04-26T04:53:50.189Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": "", "product": {"created_at": "2024-05-28T07:17:57.134Z", "modified_at": "2022-03-28T11:05:23.685Z", "id": "", "name": "", "description": "notwithstanding however willfully toward", "is_recurring": false, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2023-08-20T11:11:04.610Z", "modified_at": "2023-07-26T06:33:15.810Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 458049, "maximum_amount": 450824, "preset_amount": 262795}], "benefits": [{"created_at": "2023-07-12T17:45:11.243Z", "modified_at": "2023-12-21T21:32:22.245Z", "id": "", "type": "github_repository", "description": "harangue once out effector determined backburn weary", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2024-12-01T14:44:00.985Z", "modified_at": "2022-02-04T11:10:26.128Z", "id": "", "type": "discord", "description": "unwilling disk modulo offset pacemaker violently plait trench guilt", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2022-12-12T23:35:27.798Z", "modified_at": "2022-10-07T02:56:50.564Z", "id": "", "type": "discord", "description": "upon triumphantly minus", "selectable": true, "deletable": true, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/root", "mime_type": "", "size": 413854, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-01-20T21:06:21.391Z", "version": "", "is_uploaded": true, "created_at": "2023-04-24T16:38:24.942Z", "size_readable": "", "public_url": "https://square-cash.org/"}, {"id": "", "organization_id": "", "name": "", "path": "/Network", "mime_type": "", "size": 418179, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-06-14T20:06:16.618Z", "version": "", "is_uploaded": true, "created_at": "2024-02-18T20:06:14.861Z", "size_readable": "", "public_url": "https://classic-netsuke.biz/"}, {"id": "", "organization_id": "", "name": "", "path": "/net", "mime_type": "", "size": 213989, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-12-17T03:14:33.642Z", "version": "", "is_uploaded": true, "created_at": "2022-06-13T06:21:37.012Z", "size_readable": "", "public_url": "https://strong-allocation.info"}], "organization": {"created_at": "2024-01-28T08:45:49.386Z", "modified_at": "2022-11-06T01:10:18.215Z", "id": "", "name": "", "slug": "", "avatar_url": "https://frilly-league.name", "bio": "", "company": "Lubowitz - Kirlin", "blog": "", "location": "", "email": "Jammie.Mayert79@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 443704, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 292089}}, "price": {"created_at": "2023-04-26T04:53:50.189Z", "modified_at": "2024-05-28T07:17:57.134Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "month"}} + application/json: {"created_at": "2024-02-07T13:54:48.821Z", "modified_at": "2023-09-05T11:33:52.011Z", "id": "", "amount": 544221, "currency": "Moroccan Dirham", "recurring_interval": "year", "status": "active", "current_period_start": "2023-05-10T02:28:23.533Z", "current_period_end": "2022-10-16T00:34:27.106Z", "cancel_at_period_end": true, "started_at": "2024-10-24T02:41:21.259Z", "ended_at": "2023-04-26T04:53:50.189Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": "", "product": {"created_at": "2024-05-28T07:17:57.134Z", "modified_at": "2022-03-28T11:05:23.685Z", "id": "", "name": "", "description": "notwithstanding however willfully toward", "is_recurring": false, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2024-08-19T11:11:04.610Z", "modified_at": "2024-07-25T06:33:15.810Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 458049, "maximum_amount": 450824, "preset_amount": 262795}], "benefits": [{"created_at": "2023-07-12T17:45:11.243Z", "modified_at": "2023-12-21T21:32:22.245Z", "id": "", "type": "github_repository", "description": "harangue once out effector determined backburn weary", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2024-12-01T14:44:00.985Z", "modified_at": "2022-02-04T11:10:26.128Z", "id": "", "type": "discord", "description": "unwilling disk modulo offset pacemaker violently plait trench guilt", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2022-12-12T23:35:27.798Z", "modified_at": "2022-10-07T02:56:50.564Z", "id": "", "type": "discord", "description": "upon triumphantly minus", "selectable": true, "deletable": true, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/root", "mime_type": "", "size": 413854, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-01-20T21:06:21.391Z", "version": "", "is_uploaded": true, "created_at": "2023-04-24T16:38:24.942Z", "size_readable": "", "public_url": "https://square-cash.org/"}, {"id": "", "organization_id": "", "name": "", "path": "/Network", "mime_type": "", "size": 418179, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-06-14T20:06:16.618Z", "version": "", "is_uploaded": true, "created_at": "2024-02-18T20:06:14.861Z", "size_readable": "", "public_url": "https://classic-netsuke.biz/"}, {"id": "", "organization_id": "", "name": "", "path": "/net", "mime_type": "", "size": 213989, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2024-12-17T03:14:33.642Z", "version": "", "is_uploaded": true, "created_at": "2022-06-13T06:21:37.012Z", "size_readable": "", "public_url": "https://strong-allocation.info"}], "organization": {"created_at": "2024-01-28T08:45:49.386Z", "modified_at": "2022-11-06T01:10:18.215Z", "id": "", "name": "", "slug": "", "avatar_url": "https://frilly-league.name", "bio": "", "company": "Lubowitz - Kirlin", "blog": "", "location": "", "email": "Jammie.Mayert79@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 443704, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 292089}}, "price": {"created_at": "2024-04-25T04:53:50.189Z", "modified_at": "2025-05-28T07:17:57.134Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "month"}} "404": application/json: {"detail": ""} "422": @@ -2826,7 +2718,7 @@ examples: application/json: {"product_price_id": ""} responses: "200": - application/json: {"created_at": "2024-07-28T19:04:48.565Z", "modified_at": "2023-10-17T10:52:42.015Z", "id": "", "amount": 344620, "currency": "Zambian Kwacha", "recurring_interval": "year", "status": "active", "current_period_start": "2024-12-14T11:19:45.098Z", "current_period_end": "2022-03-01T06:03:05.915Z", "cancel_at_period_end": false, "started_at": "2023-05-05T18:16:40.936Z", "ended_at": "2022-12-08T09:52:54.805Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": "", "product": {"created_at": "2022-10-01T09:16:09.932Z", "modified_at": "2022-06-02T23:29:52.263Z", "id": "", "name": "", "description": "about inquisitively ugh recklessly incidentally jubilantly doting boohoo pish", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2023-01-13T16:52:57.274Z", "modified_at": "2024-12-22T15:27:45.882Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 488852, "maximum_amount": 984008, "preset_amount": 54062}, {"created_at": "2022-12-08T09:52:54.805Z", "modified_at": "2022-10-01T09:16:09.932Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 789275, "maximum_amount": 889838, "preset_amount": 302461}], "benefits": [{"created_at": "2023-09-03T03:35:45.584Z", "modified_at": "2023-05-23T21:03:36.028Z", "id": "", "type": "discord", "description": "lest represent braid", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2023-07-07T17:41:05.826Z", "modified_at": "2022-04-19T21:35:13.447Z", "id": "", "type": "downloadables", "description": "ouch weary euphonium what", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2023-08-02T03:11:23.164Z", "modified_at": "2022-09-27T08:59:31.628Z", "id": "", "type": "discord", "description": "hm eminent sham excitedly following pro parched gah", "selectable": true, "deletable": true, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/home", "mime_type": "", "size": 780643, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-10-01T21:33:23.746Z", "version": "", "is_uploaded": true, "created_at": "2022-12-12T14:26:30.108Z", "size_readable": "", "public_url": "https://illiterate-kiss.com"}], "organization": {"created_at": "2023-09-04T16:16:36.463Z", "modified_at": "2022-06-09T10:57:26.043Z", "id": "", "name": "", "slug": "", "avatar_url": "https://pointed-angle.net/", "bio": "", "company": "Leffler - Heidenreich", "blog": "", "location": "", "email": "Greta94@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 611007, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 286835}}, "price": {"created_at": "2024-01-31T02:01:14.461Z", "modified_at": "2023-03-20T01:46:46.018Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "year"}} + application/json: {"created_at": "2024-07-28T19:04:48.565Z", "modified_at": "2023-10-17T10:52:42.015Z", "id": "", "amount": 344620, "currency": "Zambian Kwacha", "recurring_interval": "year", "status": "active", "current_period_start": "2024-12-14T11:19:45.098Z", "current_period_end": "2022-03-01T06:03:05.915Z", "cancel_at_period_end": false, "started_at": "2023-05-05T18:16:40.936Z", "ended_at": "2022-12-08T09:52:54.805Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": "", "product": {"created_at": "2022-10-01T09:16:09.932Z", "modified_at": "2022-06-02T23:29:52.263Z", "id": "", "name": "", "description": "about inquisitively ugh recklessly incidentally jubilantly doting boohoo pish", "is_recurring": true, "is_archived": false, "organization_id": "", "prices": [{"created_at": "2024-01-13T16:52:57.274Z", "modified_at": "2025-12-22T15:27:45.882Z", "id": "", "is_archived": false, "product_id": "", "price_currency": "", "minimum_amount": 488852, "maximum_amount": 984008, "preset_amount": 54062}, {"created_at": "2023-12-08T09:52:54.805Z", "modified_at": "2023-10-01T09:16:09.932Z", "id": "", "is_archived": true, "product_id": "", "price_currency": "", "minimum_amount": 789275, "maximum_amount": 889838, "preset_amount": 302461}], "benefits": [{"created_at": "2023-09-03T03:35:45.584Z", "modified_at": "2023-05-23T21:03:36.028Z", "id": "", "type": "discord", "description": "lest represent braid", "selectable": false, "deletable": false, "organization_id": ""}, {"created_at": "2023-07-07T17:41:05.826Z", "modified_at": "2022-04-19T21:35:13.447Z", "id": "", "type": "downloadables", "description": "ouch weary euphonium what", "selectable": false, "deletable": true, "organization_id": ""}, {"created_at": "2023-08-02T03:11:23.164Z", "modified_at": "2022-09-27T08:59:31.628Z", "id": "", "type": "discord", "description": "hm eminent sham excitedly following pro parched gah", "selectable": true, "deletable": true, "organization_id": ""}], "medias": [{"id": "", "organization_id": "", "name": "", "path": "/home", "mime_type": "", "size": 780643, "storage_version": "", "checksum_etag": "", "checksum_sha256_base64": "", "checksum_sha256_hex": "", "last_modified_at": "2022-10-01T21:33:23.746Z", "version": "", "is_uploaded": true, "created_at": "2022-12-12T14:26:30.108Z", "size_readable": "", "public_url": "https://illiterate-kiss.com"}], "organization": {"created_at": "2023-09-04T16:16:36.463Z", "modified_at": "2022-06-09T10:57:26.043Z", "id": "", "name": "", "slug": "", "avatar_url": "https://pointed-angle.net/", "bio": "", "company": "Leffler - Heidenreich", "blog": "", "location": "", "email": "Greta94@yahoo.com", "twitter_username": "", "pledge_minimum_amount": 611007, "pledge_badge_show_amount": false, "default_upfront_split_to_contributors": 286835}}, "price": {"created_at": "2025-01-30T02:01:14.461Z", "modified_at": "2024-03-19T01:46:46.018Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "year"}} "404": application/json: {"detail": ""} "422": @@ -2838,7 +2730,7 @@ examples: id: "" responses: "200": - application/json: {"created_at": "2022-01-28T04:39:19.513Z", "modified_at": "2024-12-24T10:36:51.473Z", "id": "", "amount": 473916, "currency": "Bulgarian Lev", "recurring_interval": "month", "status": "trialing", "current_period_start": "2022-02-14T08:23:52.236Z", "current_period_end": "2022-06-28T03:41:26.855Z", "cancel_at_period_end": false, "started_at": "2022-06-09T14:11:56.790Z", "ended_at": "2022-08-28T23:20:26.332Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": "", "product": {"created_at": "2022-08-29T10:04:34.451Z", "modified_at": "2022-03-26T15:01:55.926Z", "id": "", "name": "", "description": "lightly engender westernize for evince voluntarily carefully ah whether", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [], "benefits": [], "medias": [], "organization": {"created_at": "2024-10-31T13:48:30.383Z", "modified_at": "2023-06-29T22:23:08.521Z", "id": "", "name": "", "slug": "", "avatar_url": "https://steep-mentor.com", "bio": "", "company": "Bernier - Denesik", "blog": "", "location": "", "email": "Alvina_Gleichner@gmail.com", "twitter_username": "", "pledge_minimum_amount": 660092, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 979409}}, "price": {"created_at": "2023-06-04T09:53:22.758Z", "modified_at": "2022-04-04T13:59:58.090Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "month"}} + application/json: {"created_at": "2022-01-28T04:39:19.513Z", "modified_at": "2024-12-24T10:36:51.473Z", "id": "", "amount": 473916, "currency": "Bulgarian Lev", "recurring_interval": "month", "status": "trialing", "current_period_start": "2022-02-14T08:23:52.236Z", "current_period_end": "2022-06-28T03:41:26.855Z", "cancel_at_period_end": false, "started_at": "2022-06-09T14:11:56.790Z", "ended_at": "2022-08-28T23:20:26.332Z", "customer_id": "", "product_id": "", "price_id": "", "discount_id": "", "checkout_id": "", "user_id": "", "product": {"created_at": "2022-08-29T10:04:34.451Z", "modified_at": "2022-03-26T15:01:55.926Z", "id": "", "name": "", "description": "lightly engender westernize for evince voluntarily carefully ah whether", "is_recurring": false, "is_archived": true, "organization_id": "", "prices": [], "benefits": [], "medias": [], "organization": {"created_at": "2024-10-31T13:48:30.383Z", "modified_at": "2023-06-29T22:23:08.521Z", "id": "", "name": "", "slug": "", "avatar_url": "https://steep-mentor.com", "bio": "", "company": "Bernier - Denesik", "blog": "", "location": "", "email": "Alvina_Gleichner@gmail.com", "twitter_username": "", "pledge_minimum_amount": 660092, "pledge_badge_show_amount": true, "default_upfront_split_to_contributors": 979409}}, "price": {"created_at": "2024-06-03T09:53:22.758Z", "modified_at": "2023-04-04T13:59:58.090Z", "id": "", "is_archived": true, "product_id": "", "recurring_interval": "month"}} "403": application/json: {"detail": ""} "404": @@ -2851,7 +2743,7 @@ examples: application/json: {"customer_id": ""} responses: "201": - application/json: {"created_at": "2023-06-18T07:14:55.338Z", "modified_at": "2023-12-01T17:06:07.804Z", "id": "", "token": "", "expires_at": "2023-04-03T12:48:32.253Z", "customer_id": "", "customer": {"created_at": "2022-05-28T06:20:22.766Z", "modified_at": "2022-03-17T15:39:20.911Z", "id": "", "metadata": {"key": true, "key1": "", "key2": ""}, "email": "Raymundo_Rolfson35@hotmail.com", "email_verified": true, "name": "", "billing_address": {"country": "Cyprus"}, "tax_id": [], "organization_id": "", "avatar_url": "https://glorious-convection.com/"}} + application/json: {"created_at": "2023-06-18T07:14:55.338Z", "modified_at": "2023-12-01T17:06:07.804Z", "id": "", "token": "", "expires_at": "2023-04-03T12:48:32.253Z", "customer_portal_url": "https://probable-heating.com/", "customer_id": "", "customer": {"created_at": "2022-05-28T06:20:22.766Z", "modified_at": "2022-03-17T15:39:20.911Z", "id": "", "metadata": {"key": true, "key1": "", "key2": ""}, "email": "Raymundo_Rolfson35@hotmail.com", "email_verified": true, "name": "", "billing_address": {"country": "Cyprus"}, "tax_id": [], "organization_id": "", "avatar_url": "https://glorious-convection.com/"}} "422": application/json: {} generatedTests: {} diff --git a/.speakeasy/gen.yaml b/.speakeasy/gen.yaml index 0ae89ce9..0b63dd03 100644 --- a/.speakeasy/gen.yaml +++ b/.speakeasy/gen.yaml @@ -16,7 +16,7 @@ generation: oAuth2ClientCredentialsEnabled: true oAuth2PasswordEnabled: false typescript: - version: 0.19.2 + version: 0.20.0 additionalDependencies: dependencies: standardwebhooks: ^1.0.0 diff --git a/.speakeasy/workflow.lock b/.speakeasy/workflow.lock index 7c4fbd57..6e953e6d 100644 --- a/.speakeasy/workflow.lock +++ b/.speakeasy/workflow.lock @@ -1,21 +1,21 @@ -speakeasyVersion: 1.456.1 +speakeasyVersion: 1.460.3 sources: Polar-OAS: sourceNamespace: polar-oas - sourceRevisionDigest: sha256:cf26635b4fd268456aefef2efe3855f879071ba209cb8ea272fe057ec4dc8080 - sourceBlobDigest: sha256:2fcb4a497110dfacf53652f840b4586fd532f15ddfa11dc8329db9987c54371a + sourceRevisionDigest: sha256:b1f4a64aa71c96ebab871c01a8ae16aa7bb008f9782f54e65151d4e65f2d7c78 + sourceBlobDigest: sha256:6dbfe2107a5935633f4599b35f6b7ea72d04e2464bad60267066c53a1cc17e5c tags: - latest - - speakeasy-sdk-regen-1734654388 + - speakeasy-sdk-regen-1734740758 - 0.1.0 targets: polar: source: Polar-OAS sourceNamespace: polar-oas - sourceRevisionDigest: sha256:cf26635b4fd268456aefef2efe3855f879071ba209cb8ea272fe057ec4dc8080 - sourceBlobDigest: sha256:2fcb4a497110dfacf53652f840b4586fd532f15ddfa11dc8329db9987c54371a - codeSamplesNamespace: polar-oas-code-samples - codeSamplesRevisionDigest: sha256:d1b9a8d832074174ed260c651e217075056ca05c4dfa24aa047c6e5a32fcc696 + sourceRevisionDigest: sha256:b1f4a64aa71c96ebab871c01a8ae16aa7bb008f9782f54e65151d4e65f2d7c78 + sourceBlobDigest: sha256:6dbfe2107a5935633f4599b35f6b7ea72d04e2464bad60267066c53a1cc17e5c + codeSamplesNamespace: polar-oas-ts-code-samples + codeSamplesRevisionDigest: sha256:658b36cc453f743e38013d068bf88917ce19d1ba2364a4cf907ba42e40b04901 workflow: workflowVersion: 1.0.0 speakeasyVersion: latest @@ -40,4 +40,6 @@ workflow: codeSamples: output: codeSamples.yaml registry: - location: registry.speakeasyapi.dev/polar/polar/polar-oas-code-samples + location: registry.speakeasyapi.dev/polar/polar/polar-oas-ts-code-samples + labelOverride: + fixedValue: Typescript (SDK) diff --git a/.speakeasy/workflow.yaml b/.speakeasy/workflow.yaml index eade2bd3..928f4104 100644 --- a/.speakeasy/workflow.yaml +++ b/.speakeasy/workflow.yaml @@ -20,7 +20,7 @@ targets: token: $npm_token codeSamples: output: codeSamples.yaml - labelOverride: - fixedValue: Typescript (SDK) registry: location: registry.speakeasyapi.dev/polar/polar/polar-oas-ts-code-samples + labelOverride: + fixedValue: Typescript (SDK) diff --git a/README.md b/README.md index 2e290125..45f4e921 100644 --- a/README.md +++ b/README.md @@ -97,6 +97,7 @@ async function run() { createdAt: new Date("2024-11-12T14:26:42.882Z"), modifiedAt: new Date("2023-05-28T05:08:06.235Z"), id: "", + paymentProcessor: "stripe", status: "failed", clientSecret: "", url: "https://heavy-beret.com/", @@ -142,8 +143,8 @@ async function run() { organizationId: "", prices: [ { - createdAt: new Date("2024-11-19T15:59:15.588Z"), - modifiedAt: new Date("2022-11-17T00:11:23.972Z"), + createdAt: new Date("2025-11-19T15:59:15.588Z"), + modifiedAt: new Date("2023-11-17T00:11:23.972Z"), id: "", isArchived: false, productId: "", @@ -187,8 +188,8 @@ async function run() { ], }, productPrice: { - createdAt: new Date("2024-02-15T09:22:19.644Z"), - modifiedAt: new Date("2022-12-28T20:59:29.904Z"), + createdAt: new Date("2025-02-14T09:22:19.644Z"), + modifiedAt: new Date("2023-12-28T20:59:29.904Z"), id: "", isArchived: false, productId: "", @@ -211,8 +212,8 @@ async function run() { { customFieldId: "", customField: { - createdAt: new Date("2022-08-19T22:18:44.316Z"), - modifiedAt: new Date("2023-04-29T23:39:10.699Z"), + createdAt: new Date("2023-08-19T22:18:44.316Z"), + modifiedAt: new Date("2024-04-28T23:39:10.699Z"), id: "", metadata: { "key": false, @@ -235,8 +236,8 @@ async function run() { { customFieldId: "", customField: { - createdAt: new Date("2023-07-03T09:46:29.338Z"), - modifiedAt: new Date("2024-01-25T18:08:49.597Z"), + createdAt: new Date("2024-07-02T09:46:29.338Z"), + modifiedAt: new Date("2025-01-24T18:08:49.597Z"), id: "", metadata: { "key": false, @@ -252,8 +253,8 @@ async function run() { { customFieldId: "", customField: { - createdAt: new Date("2024-07-31T13:25:31.669Z"), - modifiedAt: new Date("2022-11-12T09:40:10.044Z"), + createdAt: new Date("2025-07-31T13:25:31.669Z"), + modifiedAt: new Date("2023-11-12T09:40:10.044Z"), id: "", metadata: { "key": "", diff --git a/RELEASES.md b/RELEASES.md index 9c658cdb..4ff6522e 100644 --- a/RELEASES.md +++ b/RELEASES.md @@ -328,4 +328,14 @@ Based on: ### Generated - [typescript v0.19.2] . ### Releases -- [NPM v0.19.2] https://www.npmjs.com/package/@polar-sh/sdk/v/0.19.2 - . \ No newline at end of file +- [NPM v0.19.2] https://www.npmjs.com/package/@polar-sh/sdk/v/0.19.2 - . + +## 2025-01-02 12:12:31 +### Changes +Based on: +- OpenAPI Doc +- Speakeasy CLI 1.460.3 (2.484.0) https://github.com/speakeasy-api/speakeasy +### Generated +- [typescript v0.20.0] . +### Releases +- [NPM v0.20.0] https://www.npmjs.com/package/@polar-sh/sdk/v/0.20.0 - . \ No newline at end of file diff --git a/RUNTIMES.md b/RUNTIMES.md index d08a0c07..db7ea942 100644 --- a/RUNTIMES.md +++ b/RUNTIMES.md @@ -1,6 +1,6 @@ # Supported JavaScript runtimes -This SDK is intended to be used in JavaScript runtimes that support the following features: +This SDK is intended to be used in JavaScript runtimes that support ECMAScript 2020 or newer. The SDK uses the following features: * [Web Fetch API][web-fetch] * [Web Streams API][web-streams] and in particular `ReadableStream` @@ -20,3 +20,29 @@ Runtime environments that are explicitly supported are: - Note that Deno does not currently have native support for streaming file uploads backed by the filesystem ([issue link][deno-file-streaming]) [deno-file-streaming]: https://github.com/denoland/deno/issues/11018 + +## Recommended TypeScript compiler options + +The following `tsconfig.json` options are recommended for projects using this +SDK in order to get static type support for features like async iterables, +streams and `fetch`-related APIs ([`for await...of`][for-await-of], +[`AbortSignal`][abort-signal], [`Request`][request], [`Response`][response] and +so on): + +[for-await-of]: https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Statements/for-await...of +[abort-signal]: https://developer.mozilla.org/en-US/docs/Web/API/AbortSignal +[request]: https://developer.mozilla.org/en-US/docs/Web/API/Request +[response]: https://developer.mozilla.org/en-US/docs/Web/API/Response + +```jsonc +{ + "compilerOptions": { + "target": "es2020", // or higher + "lib": ["es2020", "dom", "dom.iterable"], + } +} +``` + +While `target` can be set to older ECMAScript versions, it may result in extra, +unnecessary compatibility code being generated if you are not targeting old +runtimes. \ No newline at end of file diff --git a/codeSamples.yaml b/codeSamples.yaml index ace514be..0bc3e55e 100644 --- a/codeSamples.yaml +++ b/codeSamples.yaml @@ -7,671 +7,671 @@ actions: update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.advertisements.list({\n benefitId: \"\",\n });\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/advertisements/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.advertisements.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/benefits/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.benefits.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/benefits/"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "create" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.benefits.create({\n description: \"delightfully fumigate convection though zowie up bulky electronics\",\n properties: {\n guildToken: \"\",\n roleId: \"\",\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/benefits/{id}"]["delete"] update: "x-codeSamples": - "lang": "typescript" - "label": "delete" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n await polar.benefits.delete({\n id: \"\",\n });\n\n\n}\n\nrun();" - target: $["paths"]["/v1/benefits/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.benefits.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/benefits/{id}"]["patch"] update: "x-codeSamples": - "lang": "typescript" - "label": "update" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.benefits.update({\n id: \"\",\n requestBody: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/benefits/{id}/grants"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "grants" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.benefits.grants({\n id: \"\",\n });\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/checkout-links/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.checkoutLinks.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/checkout-links/"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "create" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.checkoutLinks.create({\n productId: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/checkout-links/{id}"]["delete"] update: "x-codeSamples": - "lang": "typescript" - "label": "delete" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n await polar.checkoutLinks.delete({\n id: \"\",\n });\n\n\n}\n\nrun();" - target: $["paths"]["/v1/checkout-links/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.checkoutLinks.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/checkout-links/{id}"]["patch"] update: "x-codeSamples": - "lang": "typescript" - "label": "update" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.checkoutLinks.update({\n id: \"\",\n checkoutLinkUpdate: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/checkouts/custom/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.checkouts.custom.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/checkouts/custom/"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "create" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.checkouts.custom.create({\n productId: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/checkouts/custom/client/{client_secret}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "client_get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.checkouts.custom.clientGet({\n clientSecret: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/checkouts/custom/client/{client_secret}"]["patch"] update: "x-codeSamples": - "lang": "typescript" - "label": "client_update" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.checkouts.custom.clientUpdate({\n clientSecret: \"\",\n checkoutUpdatePublic: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/checkouts/custom/client/{client_secret}/confirm"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "client_confirm" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.checkouts.custom.clientConfirm({\n clientSecret: \"\",\n checkoutConfirmStripe: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/checkouts/custom/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.checkouts.custom.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/checkouts/custom/{id}"]["patch"] update: "x-codeSamples": - "lang": "typescript" - "label": "update" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.checkouts.custom.update({\n id: \"\",\n checkoutUpdate: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/custom-fields/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customFields.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/custom-fields/"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "create" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customFields.create({\n slug: \"\",\n name: \"\",\n properties: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/custom-fields/{id}"]["delete"] update: "x-codeSamples": - "lang": "typescript" - "label": "delete" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n await polar.customFields.delete({\n id: \"\",\n });\n\n\n}\n\nrun();" - target: $["paths"]["/v1/custom-fields/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customFields.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/custom-fields/{id}"]["patch"] update: "x-codeSamples": - "lang": "typescript" - "label": "update" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customFields.update({\n id: \"\",\n customFieldUpdate: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/benefit-grants/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.benefitGrants.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/benefit-grants/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.benefitGrants.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/benefit-grants/{id}"]["patch"] update: "x-codeSamples": - "lang": "typescript" - "label": "update" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.benefitGrants.update({\n id: \"\",\n customerBenefitGrantUpdate: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/customers/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.customers.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/downloadables/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.downloadables.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/downloadables/{token}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.downloadables.get({\n token: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/license-keys/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.licenseKeys.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/license-keys/activate"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "activate" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.licenseKeys.activate({\n key: \"\",\n organizationId: \"\",\n label: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/license-keys/deactivate"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "deactivate" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n await polar.customerPortal.licenseKeys.deactivate({\n key: \"\",\n organizationId: \"\",\n activationId: \"\",\n });\n\n\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/license-keys/validate"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "validate" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.licenseKeys.validate({\n key: \"\",\n organizationId: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/license-keys/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.licenseKeys.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/orders/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.orders.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/orders/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.orders.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/orders/{id}/invoice"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "invoice" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.orders.invoice({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/organizations/{slug}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.organizations.get({\n slug: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/subscriptions/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.subscriptions.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/subscriptions/{id}"]["delete"] update: "x-codeSamples": - "lang": "typescript" - "label": "cancel" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.subscriptions.cancel({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/subscriptions/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.subscriptions.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customer-portal/subscriptions/{id}"]["patch"] update: "x-codeSamples": - "lang": "typescript" - "label": "update" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerPortal.subscriptions.update({\n id: \"\",\n customerSubscriptionUpdate: {\n productPriceId: \"\",\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customer-sessions/"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "create" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customerSessions.create({\n customerId: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customers/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customers.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/customers/"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "create" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customers.create({\n email: \"Loyal79@yahoo.com\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customers/{id}"]["delete"] update: "x-codeSamples": - "lang": "typescript" - "label": "delete" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n await polar.customers.delete({\n id: \"\",\n });\n\n\n}\n\nrun();" - target: $["paths"]["/v1/customers/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customers.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/customers/{id}"]["patch"] update: "x-codeSamples": - "lang": "typescript" - "label": "update" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.customers.update({\n id: \"\",\n customerUpdate: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/discounts/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.discounts.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/discounts/"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "create" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.discounts.create({\n duration: \"forever\",\n durationInMonths: 417458,\n type: \"fixed\",\n amount: 69025,\n name: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/discounts/{id}"]["delete"] update: "x-codeSamples": - "lang": "typescript" - "label": "delete" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n await polar.discounts.delete({\n id: \"\",\n });\n\n\n}\n\nrun();" - target: $["paths"]["/v1/discounts/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.discounts.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/discounts/{id}"]["patch"] update: "x-codeSamples": - "lang": "typescript" - "label": "update" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.discounts.update({\n id: \"\",\n discountUpdate: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/external_organizations/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.externalOrganizations.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/files/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.files.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/files/"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "create" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.files.create({\n name: \"\",\n mimeType: \"\",\n size: 638424,\n upload: {\n parts: [\n {\n number: 417458,\n chunkStart: 134365,\n chunkEnd: 69025,\n },\n ],\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/files/{id}"]["delete"] update: "x-codeSamples": - "lang": "typescript" - "label": "delete" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n await polar.files.delete({\n id: \"\",\n });\n\n\n}\n\nrun();" - target: $["paths"]["/v1/files/{id}"]["patch"] update: "x-codeSamples": - "lang": "typescript" - "label": "update" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.files.update({\n id: \"\",\n filePatch: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/files/{id}/uploaded"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "uploaded" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.files.uploaded({\n id: \"\",\n fileUploadCompleted: {\n id: \"\",\n path: \"/sys\",\n parts: [\n {\n number: 173116,\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n },\n {\n number: 894030,\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n },\n {\n number: 673715,\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n },\n ],\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/license-keys"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.licenseKeys.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/license-keys/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.licenseKeys.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/license-keys/{id}"]["patch"] update: "x-codeSamples": - "lang": "typescript" - "label": "update" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.licenseKeys.update({\n id: \"\",\n licenseKeyUpdate: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/license-keys/{id}/activations/{activation_id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get_activation" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.licenseKeys.getActivation({\n id: \"\",\n activationId: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/metrics/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" - "source": "import { Polar } from \"@polar-sh/sdk\";\nimport { RFCDate } from \"@polar-sh/sdk/types\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.metrics.get({\n startDate: new RFCDate(\"2024-02-07\"),\n endDate: new RFCDate(\"2023-09-05\"),\n interval: \"week\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\nimport { RFCDate } from \"@polar-sh/sdk/types\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.metrics.get({\n startDate: new RFCDate(\"2025-02-06\"),\n endDate: new RFCDate(\"2024-09-04\"),\n interval: \"week\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/metrics/limits"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "limits" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.metrics.limits();\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/oauth2/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.oauth2.clients.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/oauth2/authorize"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "authorize" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.oauth2.authorize();\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/oauth2/introspect"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "introspect_token" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.oauth2.introspect({\n token: \"\",\n clientId: \"\",\n clientSecret: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/oauth2/register"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "create_client" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.oauth2.clients.create({\n redirectUris: [\n \"https://inferior-chainstay.com\",\n ],\n clientName: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/oauth2/register/{client_id}"]["delete"] update: "x-codeSamples": - "lang": "typescript" - "label": "delete_client" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.oauth2.clients.delete({\n clientId: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/oauth2/register/{client_id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get_client" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.oauth2.clients.get({\n clientId: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/oauth2/register/{client_id}"]["put"] update: "x-codeSamples": - "lang": "typescript" - "label": "update_client" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.oauth2.clients.update({\n clientId: \"\",\n oAuth2ClientConfigurationUpdate: {\n redirectUris: [\n \"https://grown-worth.name\",\n \"https://worthwhile-avalanche.org/\",\n \"https://general-digit.com/\",\n ],\n clientName: \"\",\n clientId: \"\",\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/oauth2/revoke"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "revoke_token" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.oauth2.revoke({\n token: \"\",\n clientId: \"\",\n clientSecret: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/oauth2/token"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "request_token" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.oauth2.token({\n clientId: \"\",\n clientSecret: \"\",\n code: \"\",\n redirectUri: \"https://old-fort.name\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/oauth2/userinfo"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "userinfo" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.oauth2.userinfo();\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/orders/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.orders.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/orders/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.orders.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/orders/{id}/invoice"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "invoice" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.orders.invoice({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/organizations/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.organizations.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/organizations/"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "create" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.organizations.create({\n name: \"\",\n slug: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/organizations/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.organizations.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/organizations/{id}"]["patch"] update: "x-codeSamples": - "lang": "typescript" - "label": "update" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.organizations.update({\n id: \"\",\n organizationUpdate: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/products/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.products.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/products/"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "create" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.products.create({\n name: \"\",\n prices: [\n {\n recurringInterval: \"month\",\n },\n ],\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/products/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.products.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/products/{id}"]["patch"] update: "x-codeSamples": - "lang": "typescript" - "label": "update" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.products.update({\n id: \"\",\n productUpdate: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/products/{id}/benefits"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "update_benefits" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.products.updateBenefits({\n id: \"\",\n productBenefitsUpdate: {\n benefits: [\n \"\",\n ],\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/repositories/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.repositories.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/repositories/{id}"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "get" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.repositories.get({\n id: \"\",\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/repositories/{id}"]["patch"] update: "x-codeSamples": - "lang": "typescript" - "label": "update" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.repositories.update({\n id: \"\",\n repositoryUpdate: {},\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["/v1/subscriptions/"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "list" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.subscriptions.list({});\n\n for await (const page of result) {\n // Handle the page\n console.log(page);\n }\n}\n\nrun();" - target: $["paths"]["/v1/subscriptions/export"]["get"] update: "x-codeSamples": - "lang": "typescript" - "label": "export" + "label": "Typescript (SDK)" "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar({\n accessToken: process.env[\"POLAR_ACCESS_TOKEN\"] ?? \"\",\n});\n\nasync function run() {\n const result = await polar.subscriptions.export({});\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["benefit.created"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointbenefit_created_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointbenefitCreatedPost({\n data: {\n createdAt: new Date(\"2022-04-15T11:45:18.891Z\"),\n modifiedAt: new Date(\"2024-06-17T12:04:55.002Z\"),\n id: \"\",\n description: \"vastly lest but\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n archived: {\n \"key\": false,\n },\n files: [\n \"\",\n ],\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointbenefitCreatedPost({\n data: {\n createdAt: new Date(\"2023-04-15T11:45:18.891Z\"),\n modifiedAt: new Date(\"2025-06-17T12:04:55.002Z\"),\n id: \"\",\n description: \"vastly lest but\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n archived: {\n \"key\": false,\n },\n files: [\n \"\",\n ],\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["benefit.updated"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointbenefit_updated_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointbenefitUpdatedPost({\n data: {\n createdAt: new Date(\"2024-11-19T14:31:03.333Z\"),\n modifiedAt: new Date(\"2022-08-21T02:54:25.671Z\"),\n id: \"\",\n description: \"merge when gratefully sparse hmph throughout honesty untried gripping um\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n repositoryOwner: \"polarsource\",\n repositoryName: \"private_repo\",\n permission: \"push\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointbenefitUpdatedPost({\n data: {\n createdAt: new Date(\"2025-11-19T14:31:03.333Z\"),\n modifiedAt: new Date(\"2023-08-21T02:54:25.671Z\"),\n id: \"\",\n description: \"merge when gratefully sparse hmph throughout honesty untried gripping um\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n repositoryOwner: \"polarsource\",\n repositoryName: \"private_repo\",\n permission: \"push\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["benefit_grant.created"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointbenefit_grant_created_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointbenefitGrantCreatedPost({\n data: {\n createdAt: new Date(\"2024-01-05T13:03:27.870Z\"),\n modifiedAt: new Date(\"2022-05-08T00:47:14.556Z\"),\n id: \"\",\n isGranted: true,\n isRevoked: false,\n subscriptionId: \"\",\n orderId: \"\",\n customerId: \"\",\n userId: \"\",\n benefitId: \"\",\n properties: {\n advertisementCampaignId: \"\",\n },\n benefit: {\n createdAt: new Date(\"2022-02-20T12:28:33.166Z\"),\n modifiedAt: new Date(\"2023-07-19T18:10:25.895Z\"),\n id: \"\",\n description: \"though oof geez ha scuffle um inwardly narrow waterlogged normal\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {},\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointbenefitGrantCreatedPost({\n data: {\n createdAt: new Date(\"2025-01-04T13:03:27.870Z\"),\n modifiedAt: new Date(\"2023-05-08T00:47:14.556Z\"),\n id: \"\",\n isGranted: true,\n isRevoked: false,\n subscriptionId: \"\",\n orderId: \"\",\n customerId: \"\",\n userId: \"\",\n benefitId: \"\",\n customer: {\n createdAt: new Date(\"2025-08-25T12:22:42.430Z\"),\n modifiedAt: new Date(\"2023-03-03T22:39:55.256Z\"),\n id: \"\",\n metadata: {\n\n },\n email: \"Holden_Wilkinson@yahoo.com\",\n emailVerified: false,\n name: \"\",\n billingAddress: {\n country: \"El Salvador\",\n },\n taxId: [\n \"\",\n \"ae_trn\",\n \"is_vat\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://frightened-secrecy.biz\",\n },\n properties: {\n advertisementCampaignId: \"\",\n },\n benefit: {\n createdAt: new Date(\"2023-02-20T12:28:33.166Z\"),\n modifiedAt: new Date(\"2024-07-18T18:10:25.895Z\"),\n id: \"\",\n description: \"though oof geez ha scuffle um inwardly narrow waterlogged normal\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {},\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["benefit_grant.revoked"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointbenefit_grant_revoked_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointbenefitGrantRevokedPost({\n data: {\n createdAt: new Date(\"2024-03-12T10:35:36.881Z\"),\n modifiedAt: new Date(\"2024-04-12T13:10:16.426Z\"),\n id: \"\",\n isGranted: true,\n isRevoked: false,\n subscriptionId: \"\",\n orderId: \"\",\n customerId: \"\",\n userId: \"\",\n benefitId: \"\",\n properties: {\n advertisementCampaignId: \"\",\n },\n benefit: {\n createdAt: new Date(\"2024-04-12T13:10:16.426Z\"),\n modifiedAt: new Date(\"2023-03-09T05:20:11.943Z\"),\n id: \"\",\n description: \"incidentally immense scotch meh quaff generously supposing however ugh kindly\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n archived: {\n \"key\": false,\n },\n files: [\n \"\",\n ],\n },\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointbenefitGrantRevokedPost({\n data: {\n createdAt: new Date(\"2025-03-12T10:35:36.881Z\"),\n modifiedAt: new Date(\"2025-04-12T13:10:16.426Z\"),\n id: \"\",\n isGranted: true,\n isRevoked: false,\n subscriptionId: \"\",\n orderId: \"\",\n customerId: \"\",\n userId: \"\",\n benefitId: \"\",\n customer: {\n createdAt: new Date(\"2025-03-29T21:56:48.008Z\"),\n modifiedAt: new Date(\"2025-07-18T16:16:40.562Z\"),\n id: \"\",\n metadata: {\n\n },\n email: \"Anita21@hotmail.com\",\n emailVerified: true,\n name: \"\",\n billingAddress: {\n country: \"Poland\",\n },\n taxId: [\n \"\",\n \"\",\n \"au_arn\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://bouncy-granny.net\",\n },\n properties: {\n advertisementCampaignId: \"\",\n },\n benefit: {\n createdAt: new Date(\"2025-04-12T13:10:16.426Z\"),\n modifiedAt: new Date(\"2024-03-08T05:20:11.943Z\"),\n id: \"\",\n description: \"incidentally immense scotch meh quaff generously supposing however ugh kindly\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n archived: {\n \"key\": false,\n },\n files: [\n \"\",\n ],\n },\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["benefit_grant.updated"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointbenefit_grant_updated_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointbenefitGrantUpdatedPost({\n data: {\n createdAt: new Date(\"2024-01-03T13:54:42.243Z\"),\n modifiedAt: new Date(\"2023-02-25T11:58:59.486Z\"),\n id: \"\",\n isGranted: false,\n isRevoked: false,\n subscriptionId: \"\",\n orderId: \"\",\n customerId: \"\",\n userId: \"\",\n benefitId: \"\",\n properties: {\n advertisementCampaignId: \"\",\n },\n benefit: {\n createdAt: new Date(\"2024-04-04T12:08:04.168Z\"),\n modifiedAt: new Date(\"2024-02-23T02:27:57.903Z\"),\n id: \"\",\n description: \"meager merit by pish intermesh gah out muddy ah\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n guildId: \"\",\n roleId: \"\",\n guildToken: \"\",\n },\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointbenefitGrantUpdatedPost({\n data: {\n createdAt: new Date(\"2025-01-02T13:54:42.243Z\"),\n modifiedAt: new Date(\"2024-02-25T11:58:59.486Z\"),\n id: \"\",\n isGranted: false,\n isRevoked: false,\n subscriptionId: \"\",\n orderId: \"\",\n customerId: \"\",\n userId: \"\",\n benefitId: \"\",\n customer: {\n createdAt: new Date(\"2025-08-08T07:44:28.757Z\"),\n modifiedAt: new Date(\"2024-08-31T04:19:19.970Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": 549371,\n \"key2\": 502350,\n },\n email: \"Yvette.Bins@hotmail.com\",\n emailVerified: false,\n name: \"\",\n billingAddress: {\n country: \"Israel\",\n },\n taxId: [\n \"\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://teeming-formamide.com/\",\n },\n properties: {\n advertisementCampaignId: \"\",\n },\n benefit: {\n createdAt: new Date(\"2025-04-04T12:08:04.168Z\"),\n modifiedAt: new Date(\"2025-02-22T02:27:57.903Z\"),\n id: \"\",\n description: \"meager merit by pish intermesh gah out muddy ah\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n guildId: \"\",\n roleId: \"\",\n guildToken: \"\",\n },\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["checkout.created"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointcheckout_created_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointcheckoutCreatedPost({\n data: {\n createdAt: new Date(\"2024-11-12T14:26:42.882Z\"),\n modifiedAt: new Date(\"2023-05-28T05:08:06.235Z\"),\n id: \"\",\n status: \"failed\",\n clientSecret: \"\",\n url: \"https://heavy-beret.com/\",\n expiresAt: new Date(\"2022-02-25T02:26:48.460Z\"),\n successUrl: \"https://sardonic-final.info/\",\n embedOrigin: \"\",\n amount: 962818,\n taxAmount: 6400,\n currency: \"Yen\",\n subtotalAmount: 648726,\n totalAmount: 210702,\n productId: \"\",\n productPriceId: \"\",\n discountId: \"\",\n allowDiscountCodes: true,\n isDiscountApplicable: false,\n isFreeProductPrice: false,\n isPaymentRequired: false,\n isPaymentSetupRequired: false,\n isPaymentFormRequired: false,\n customerId: \"\",\n customerName: \"\",\n customerEmail: \"Ryley_Erdman@hotmail.com\",\n customerIpAddress: \"\",\n customerBillingAddress: {\n country: \"South Africa\",\n },\n customerTaxId: \"\",\n paymentProcessorMetadata: {},\n metadata: {\n \"key\": 18677,\n \"key1\": 95370,\n },\n product: {\n createdAt: new Date(\"2022-04-02T00:05:42.586Z\"),\n modifiedAt: new Date(\"2023-12-16T03:02:38.803Z\"),\n id: \"\",\n name: \"\",\n description: \"for embarrassment untidy long-term near honestly separate yet\",\n isRecurring: true,\n isArchived: false,\n organizationId: \"\",\n prices: [\n {\n createdAt: new Date(\"2024-11-19T15:59:15.588Z\"),\n modifiedAt: new Date(\"2022-11-17T00:11:23.972Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n minimumAmount: 363560,\n maximumAmount: 75876,\n presetAmount: 82334,\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2023-08-22T00:47:02.059Z\"),\n modifiedAt: new Date(\"2023-06-04T10:32:44.101Z\"),\n id: \"\",\n type: \"license_keys\",\n description: \"within jacket unless\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/private/var\",\n mimeType: \"\",\n size: 245189,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2022-11-03T15:00:03.276Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2024-06-07T13:47:02.365Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://webbed-experience.name/\",\n },\n ],\n },\n productPrice: {\n createdAt: new Date(\"2024-02-15T09:22:19.644Z\"),\n modifiedAt: new Date(\"2022-12-28T20:59:29.904Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n minimumAmount: 417896,\n maximumAmount: 962818,\n presetAmount: 6400,\n recurringInterval: \"month\",\n },\n discount: {\n duration: \"repeating\",\n type: \"fixed\",\n basisPoints: 341163,\n id: \"\",\n name: \"\",\n code: \"\",\n },\n subscriptionId: \"\",\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2022-08-19T22:18:44.316Z\"),\n modifiedAt: new Date(\"2023-04-29T23:39:10.699Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {\n options: [\n {\n value: \"\",\n label: \"\",\n },\n ],\n },\n },\n order: 996863,\n required: false,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-07-03T09:46:29.338Z\"),\n modifiedAt: new Date(\"2024-01-25T18:08:49.597Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 72589,\n required: true,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2024-07-31T13:25:31.669Z\"),\n modifiedAt: new Date(\"2022-11-12T09:40:10.044Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 161325,\n required: true,\n },\n ],\n customerMetadata: {\n \"key\": 385218,\n \"key1\": \"\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointcheckoutCreatedPost({\n data: {\n createdAt: new Date(\"2025-11-12T14:26:42.882Z\"),\n modifiedAt: new Date(\"2024-05-27T05:08:06.235Z\"),\n id: \"\",\n paymentProcessor: \"stripe\",\n status: \"failed\",\n clientSecret: \"\",\n url: \"https://heavy-beret.com/\",\n expiresAt: new Date(\"2023-02-25T02:26:48.460Z\"),\n successUrl: \"https://sardonic-final.info/\",\n embedOrigin: \"\",\n amount: 962818,\n taxAmount: 6400,\n currency: \"Yen\",\n subtotalAmount: 648726,\n totalAmount: 210702,\n productId: \"\",\n productPriceId: \"\",\n discountId: \"\",\n allowDiscountCodes: true,\n isDiscountApplicable: false,\n isFreeProductPrice: false,\n isPaymentRequired: false,\n isPaymentSetupRequired: false,\n isPaymentFormRequired: false,\n customerId: \"\",\n customerName: \"\",\n customerEmail: \"Ryley_Erdman@hotmail.com\",\n customerIpAddress: \"\",\n customerBillingAddress: {\n country: \"South Africa\",\n },\n customerTaxId: \"\",\n paymentProcessorMetadata: {},\n metadata: {\n \"key\": 18677,\n \"key1\": 95370,\n },\n product: {\n createdAt: new Date(\"2023-04-02T00:05:42.586Z\"),\n modifiedAt: new Date(\"2024-12-15T03:02:38.803Z\"),\n id: \"\",\n name: \"\",\n description: \"for embarrassment untidy long-term near honestly separate yet\",\n isRecurring: true,\n isArchived: false,\n organizationId: \"\",\n prices: [\n {\n createdAt: new Date(\"2025-11-19T15:59:15.588Z\"),\n modifiedAt: new Date(\"2023-11-17T00:11:23.972Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n minimumAmount: 363560,\n maximumAmount: 75876,\n presetAmount: 82334,\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2024-08-21T00:47:02.059Z\"),\n modifiedAt: new Date(\"2024-06-03T10:32:44.101Z\"),\n id: \"\",\n type: \"license_keys\",\n description: \"within jacket unless\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/private/var\",\n mimeType: \"\",\n size: 245189,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2023-11-03T15:00:03.276Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2025-06-07T13:47:02.365Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://webbed-experience.name/\",\n },\n ],\n },\n productPrice: {\n createdAt: new Date(\"2025-02-14T09:22:19.644Z\"),\n modifiedAt: new Date(\"2023-12-28T20:59:29.904Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n minimumAmount: 417896,\n maximumAmount: 962818,\n presetAmount: 6400,\n recurringInterval: \"month\",\n },\n discount: {\n duration: \"repeating\",\n type: \"fixed\",\n basisPoints: 341163,\n id: \"\",\n name: \"\",\n code: \"\",\n },\n subscriptionId: \"\",\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-08-19T22:18:44.316Z\"),\n modifiedAt: new Date(\"2024-04-28T23:39:10.699Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {\n options: [\n {\n value: \"\",\n label: \"\",\n },\n ],\n },\n },\n order: 996863,\n required: false,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2024-07-02T09:46:29.338Z\"),\n modifiedAt: new Date(\"2025-01-24T18:08:49.597Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 72589,\n required: true,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2025-07-31T13:25:31.669Z\"),\n modifiedAt: new Date(\"2023-11-12T09:40:10.044Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 161325,\n required: true,\n },\n ],\n customerMetadata: {\n \"key\": 385218,\n \"key1\": \"\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["checkout.updated"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointcheckout_updated_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointcheckoutUpdatedPost({\n data: {\n createdAt: new Date(\"2024-10-04T13:06:10.658Z\"),\n modifiedAt: new Date(\"2023-10-03T21:25:15.366Z\"),\n id: \"\",\n status: \"failed\",\n clientSecret: \"\",\n url: \"https://square-cafe.biz/\",\n expiresAt: new Date(\"2024-03-25T08:55:11.873Z\"),\n successUrl: \"https://physical-import.name/\",\n embedOrigin: \"\",\n amount: 245418,\n taxAmount: 624213,\n currency: \"Naira\",\n subtotalAmount: 24587,\n totalAmount: 447013,\n productId: \"\",\n productPriceId: \"\",\n discountId: \"\",\n allowDiscountCodes: true,\n isDiscountApplicable: true,\n isFreeProductPrice: true,\n isPaymentRequired: false,\n isPaymentSetupRequired: false,\n isPaymentFormRequired: true,\n customerId: \"\",\n customerName: \"\",\n customerEmail: \"Jairo39@hotmail.com\",\n customerIpAddress: \"\",\n customerBillingAddress: {\n country: \"Greenland\",\n },\n customerTaxId: \"\",\n paymentProcessorMetadata: {},\n metadata: {\n\n },\n product: {\n createdAt: new Date(\"2024-01-25T14:28:29.444Z\"),\n modifiedAt: new Date(\"2024-09-21T12:18:51.327Z\"),\n id: \"\",\n name: \"\",\n description: \"engender reopen yahoo draft\",\n isRecurring: false,\n isArchived: true,\n organizationId: \"\",\n prices: [\n {\n createdAt: new Date(\"2024-10-20T04:48:05.954Z\"),\n modifiedAt: new Date(\"2023-03-13T21:45:21.173Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n minimumAmount: 789773,\n maximumAmount: 108579,\n presetAmount: 316079,\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2024-04-09T09:30:36.910Z\"),\n modifiedAt: new Date(\"2022-10-16T19:52:50.377Z\"),\n id: \"\",\n type: \"github_repository\",\n description: \"posh hm meatloaf politely ugh fidget to inborn putrid\",\n selectable: false,\n deletable: true,\n organizationId: \"\",\n },\n {\n createdAt: new Date(\"2023-12-31T03:17:46.406Z\"),\n modifiedAt: new Date(\"2022-11-12T16:32:46.306Z\"),\n id: \"\",\n type: \"license_keys\",\n description: \"blah likewise whose notwithstanding airline aboard frightened enfold colorfully\",\n selectable: true,\n deletable: true,\n organizationId: \"\",\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/home/user\",\n mimeType: \"\",\n size: 767806,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2023-01-15T18:22:33.094Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2023-02-14T06:20:54.950Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://pushy-tomatillo.org/\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/private\",\n mimeType: \"\",\n size: 432333,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2023-03-08T18:51:14.729Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2022-11-18T09:33:10.032Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://affectionate-charm.net\",\n },\n ],\n },\n productPrice: {\n createdAt: new Date(\"2023-10-29T13:46:29.597Z\"),\n modifiedAt: new Date(\"2023-05-16T07:46:47.748Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n priceAmount: 585155,\n },\n discount: {\n duration: \"once\",\n type: \"percentage\",\n amount: 883154,\n currency: \"East Caribbean Dollar\",\n id: \"\",\n name: \"\",\n code: \"\",\n },\n subscriptionId: \"\",\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-11-16T03:18:06.755Z\"),\n modifiedAt: new Date(\"2023-11-06T16:13:01.569Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 108303,\n required: false,\n },\n ],\n customerMetadata: {\n \"key\": 371362,\n \"key1\": true,\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointcheckoutUpdatedPost({\n data: {\n createdAt: new Date(\"2025-10-04T13:06:10.658Z\"),\n modifiedAt: new Date(\"2024-10-02T21:25:15.366Z\"),\n id: \"\",\n paymentProcessor: \"stripe\",\n status: \"failed\",\n clientSecret: \"\",\n url: \"https://square-cafe.biz/\",\n expiresAt: new Date(\"2025-03-25T08:55:11.873Z\"),\n successUrl: \"https://physical-import.name/\",\n embedOrigin: \"\",\n amount: 245418,\n taxAmount: 624213,\n currency: \"Naira\",\n subtotalAmount: 24587,\n totalAmount: 447013,\n productId: \"\",\n productPriceId: \"\",\n discountId: \"\",\n allowDiscountCodes: true,\n isDiscountApplicable: true,\n isFreeProductPrice: true,\n isPaymentRequired: false,\n isPaymentSetupRequired: false,\n isPaymentFormRequired: true,\n customerId: \"\",\n customerName: \"\",\n customerEmail: \"Jairo39@hotmail.com\",\n customerIpAddress: \"\",\n customerBillingAddress: {\n country: \"Greenland\",\n },\n customerTaxId: \"\",\n paymentProcessorMetadata: {},\n metadata: {\n\n },\n product: {\n createdAt: new Date(\"2025-01-24T14:28:29.444Z\"),\n modifiedAt: new Date(\"2025-09-21T12:18:51.327Z\"),\n id: \"\",\n name: \"\",\n description: \"engender reopen yahoo draft\",\n isRecurring: false,\n isArchived: true,\n organizationId: \"\",\n prices: [\n {\n createdAt: new Date(\"2025-10-20T04:48:05.954Z\"),\n modifiedAt: new Date(\"2024-03-12T21:45:21.173Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n minimumAmount: 789773,\n maximumAmount: 108579,\n presetAmount: 316079,\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2025-04-09T09:30:36.910Z\"),\n modifiedAt: new Date(\"2023-10-16T19:52:50.377Z\"),\n id: \"\",\n type: \"github_repository\",\n description: \"posh hm meatloaf politely ugh fidget to inborn putrid\",\n selectable: false,\n deletable: true,\n organizationId: \"\",\n },\n {\n createdAt: new Date(\"2024-12-30T03:17:46.406Z\"),\n modifiedAt: new Date(\"2023-11-12T16:32:46.306Z\"),\n id: \"\",\n type: \"license_keys\",\n description: \"blah likewise whose notwithstanding airline aboard frightened enfold colorfully\",\n selectable: true,\n deletable: true,\n organizationId: \"\",\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/home/user\",\n mimeType: \"\",\n size: 767806,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2024-01-15T18:22:33.094Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2024-02-14T06:20:54.950Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://pushy-tomatillo.org/\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/private\",\n mimeType: \"\",\n size: 432333,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2024-03-07T18:51:14.729Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2023-11-18T09:33:10.032Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://affectionate-charm.net\",\n },\n ],\n },\n productPrice: {\n createdAt: new Date(\"2024-10-28T13:46:29.597Z\"),\n modifiedAt: new Date(\"2024-05-15T07:46:47.748Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n priceAmount: 585155,\n },\n discount: {\n duration: \"once\",\n type: \"percentage\",\n amount: 883154,\n currency: \"East Caribbean Dollar\",\n id: \"\",\n name: \"\",\n code: \"\",\n },\n subscriptionId: \"\",\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2024-11-15T03:18:06.755Z\"),\n modifiedAt: new Date(\"2024-11-05T16:13:01.569Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 108303,\n required: false,\n },\n ],\n customerMetadata: {\n \"key\": 371362,\n \"key1\": true,\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["order.created"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointorder_created_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointorderCreatedPost({\n data: {\n createdAt: new Date(\"2023-11-12T12:46:15.007Z\"),\n modifiedAt: new Date(\"2023-03-24T03:54:38.261Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": \"\",\n },\n amount: 485666,\n taxAmount: 81588,\n currency: \"Metical\",\n billingReason: \"subscription_cycle\",\n billingAddress: {\n country: \"Hungary\",\n },\n customerId: \"\",\n productId: \"\",\n productPriceId: \"\",\n discountId: \"\",\n subscriptionId: \"\",\n checkoutId: \"\",\n customer: {\n createdAt: new Date(\"2022-09-09T08:07:10.665Z\"),\n modifiedAt: new Date(\"2023-08-19T18:18:41.438Z\"),\n id: \"\",\n metadata: {\n \"key\": 407995,\n \"key1\": \"\",\n \"key2\": \"\",\n },\n email: \"Gia.Boyer87@yahoo.com\",\n emailVerified: false,\n name: \"\",\n billingAddress: {\n country: \"Reunion\",\n },\n taxId: [\n \"\",\n \"my_sst\",\n \"br_cpf\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://darling-kit.org\",\n },\n userId: \"\",\n user: {\n id: \"\",\n email: \"Delphine_Weber@hotmail.com\",\n publicName: \"\",\n },\n product: {\n createdAt: new Date(\"2024-12-27T14:05:37.748Z\"),\n modifiedAt: new Date(\"2024-01-02T22:00:53.940Z\"),\n id: \"\",\n name: \"\",\n description: \"circle colorize given\",\n isRecurring: true,\n isArchived: true,\n organizationId: \"\",\n },\n productPrice: {\n createdAt: new Date(\"2022-08-04T05:13:22.817Z\"),\n modifiedAt: new Date(\"2023-06-17T06:57:11.062Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n priceAmount: 81588,\n },\n discount: {\n duration: \"repeating\",\n type: \"fixed\",\n basisPoints: 229323,\n createdAt: new Date(\"2023-08-19T18:18:41.438Z\"),\n modifiedAt: new Date(\"2024-09-23T11:59:51.286Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n name: \"\",\n code: \"\",\n startsAt: new Date(\"2024-12-09T16:33:38.176Z\"),\n endsAt: new Date(\"2022-12-26T14:42:24.925Z\"),\n maxRedemptions: 248386,\n redemptionsCount: 506985,\n organizationId: \"\",\n },\n subscription: {\n metadata: {\n \"key\": 838937,\n \"key1\": true,\n },\n createdAt: new Date(\"2024-05-09T06:10:47.548Z\"),\n modifiedAt: new Date(\"2024-02-14T18:51:37.875Z\"),\n id: \"\",\n amount: 420337,\n currency: \"New Zealand Dollar\",\n recurringInterval: \"year\",\n status: \"incomplete\",\n currentPeriodStart: new Date(\"2024-12-01T13:27:57.927Z\"),\n currentPeriodEnd: new Date(\"2022-06-23T18:54:19.334Z\"),\n cancelAtPeriodEnd: false,\n startedAt: new Date(\"2023-11-16T11:53:36.436Z\"),\n endedAt: new Date(\"2024-11-18T03:47:21.756Z\"),\n customerId: \"\",\n productId: \"\",\n priceId: \"\",\n discountId: \"\",\n checkoutId: \"\",\n userId: \"\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointorderCreatedPost({\n data: {\n createdAt: new Date(\"2024-11-11T12:46:15.007Z\"),\n modifiedAt: new Date(\"2024-03-23T03:54:38.261Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": \"\",\n },\n amount: 485666,\n taxAmount: 81588,\n currency: \"Metical\",\n billingReason: \"subscription_cycle\",\n billingAddress: {\n country: \"Hungary\",\n },\n customerId: \"\",\n productId: \"\",\n productPriceId: \"\",\n discountId: \"\",\n subscriptionId: \"\",\n checkoutId: \"\",\n customer: {\n createdAt: new Date(\"2023-09-09T08:07:10.665Z\"),\n modifiedAt: new Date(\"2024-08-18T18:18:41.438Z\"),\n id: \"\",\n metadata: {\n \"key\": 407995,\n \"key1\": \"\",\n \"key2\": \"\",\n },\n email: \"Gia.Boyer87@yahoo.com\",\n emailVerified: false,\n name: \"\",\n billingAddress: {\n country: \"Reunion\",\n },\n taxId: [\n \"\",\n \"my_sst\",\n \"br_cpf\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://darling-kit.org\",\n },\n userId: \"\",\n user: {\n id: \"\",\n email: \"Delphine_Weber@hotmail.com\",\n publicName: \"\",\n },\n product: {\n createdAt: new Date(\"2025-12-27T14:05:37.748Z\"),\n modifiedAt: new Date(\"2025-01-01T22:00:53.940Z\"),\n id: \"\",\n name: \"\",\n description: \"circle colorize given\",\n isRecurring: true,\n isArchived: true,\n organizationId: \"\",\n },\n productPrice: {\n createdAt: new Date(\"2023-08-04T05:13:22.817Z\"),\n modifiedAt: new Date(\"2024-06-16T06:57:11.062Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n priceAmount: 81588,\n },\n discount: {\n duration: \"repeating\",\n type: \"fixed\",\n basisPoints: 229323,\n createdAt: new Date(\"2024-08-18T18:18:41.438Z\"),\n modifiedAt: new Date(\"2025-09-23T11:59:51.286Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n name: \"\",\n code: \"\",\n startsAt: new Date(\"2025-12-09T16:33:38.176Z\"),\n endsAt: new Date(\"2023-12-26T14:42:24.925Z\"),\n maxRedemptions: 248386,\n redemptionsCount: 506985,\n organizationId: \"\",\n },\n subscription: {\n metadata: {\n \"key\": 838937,\n \"key1\": true,\n },\n createdAt: new Date(\"2025-05-09T06:10:47.548Z\"),\n modifiedAt: new Date(\"2025-02-13T18:51:37.875Z\"),\n id: \"\",\n amount: 420337,\n currency: \"New Zealand Dollar\",\n recurringInterval: \"year\",\n status: \"incomplete\",\n currentPeriodStart: new Date(\"2025-12-01T13:27:57.927Z\"),\n currentPeriodEnd: new Date(\"2023-06-23T18:54:19.334Z\"),\n cancelAtPeriodEnd: false,\n startedAt: new Date(\"2024-11-15T11:53:36.436Z\"),\n endedAt: new Date(\"2025-11-18T03:47:21.756Z\"),\n customerId: \"\",\n productId: \"\",\n priceId: \"\",\n discountId: \"\",\n checkoutId: \"\",\n userId: \"\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["organization.updated"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointorganization_updated_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointorganizationUpdatedPost({\n data: {\n createdAt: new Date(\"2022-08-12T18:45:04.236Z\"),\n modifiedAt: new Date(\"2024-12-29T16:35:25.119Z\"),\n id: \"\",\n name: \"\",\n slug: \"\",\n avatarUrl: \"https://devoted-bump.net\",\n bio: \"\",\n company: \"Torp, Kuhlman and Howell\",\n blog: \"\",\n location: \"\",\n email: \"Dock_Friesen57@yahoo.com\",\n twitterUsername: \"\",\n pledgeMinimumAmount: 105265,\n pledgeBadgeShowAmount: true,\n defaultUpfrontSplitToContributors: 907160,\n profileSettings: {},\n featureSettings: {},\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointorganizationUpdatedPost({\n data: {\n createdAt: new Date(\"2023-08-12T18:45:04.236Z\"),\n modifiedAt: new Date(\"2025-12-29T16:35:25.119Z\"),\n id: \"\",\n name: \"\",\n slug: \"\",\n avatarUrl: \"https://devoted-bump.net\",\n bio: \"\",\n company: \"Torp, Kuhlman and Howell\",\n blog: \"\",\n location: \"\",\n email: \"Dock_Friesen57@yahoo.com\",\n twitterUsername: \"\",\n pledgeMinimumAmount: 105265,\n pledgeBadgeShowAmount: true,\n defaultUpfrontSplitToContributors: 907160,\n profileSettings: {},\n featureSettings: {},\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["pledge.created"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointpledge_created_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointpledgeCreatedPost({\n data: {\n createdAt: new Date(\"2024-03-12T00:19:41.487Z\"),\n modifiedAt: new Date(\"2022-04-19T01:42:59.169Z\"),\n id: \"\",\n amount: 330877,\n currency: \"Jamaican Dollar\",\n state: \"disputed\",\n type: \"pay_directly\",\n issue: {\n id: \"66524b69-aa0b-47ac-bb9a-0cee5d3a9110\",\n number: 280857,\n title: \"\",\n state: \"open\",\n issueCreatedAt: new Date(\"2023-02-26T00:33:35.289Z\"),\n needsConfirmationSolved: false,\n funding: {},\n repository: {\n id: \"356e14cb-87a4-484c-bcfa-ebfe50487706\",\n isPrivate: true,\n name: \"MyOrg\",\n description: \"different premium tinderbox peter under often buzzing hastily\",\n stars: 1337,\n license: \"\",\n homepage: \"\",\n profileSettings: {},\n organization: {\n id: \"29159f56-74c0-464d-b598-8d5bc3b9cdda\",\n name: \"\",\n avatarUrl: \"https://frightened-poppy.com/\",\n isPersonal: false,\n bio: \"\",\n prettyName: \"\",\n company: \"Bailey - Towne\",\n blog: \"\",\n location: \"\",\n email: \"Cortez_Stehr70@yahoo.com\",\n twitterUsername: \"\",\n organizationId: \"\",\n },\n internalOrganization: {\n createdAt: new Date(\"2024-01-04T15:27:13.109Z\"),\n modifiedAt: new Date(\"2023-02-15T22:10:17.041Z\"),\n id: \"\",\n name: \"\",\n slug: \"\",\n avatarUrl: \"https://hard-to-find-thyme.org\",\n bio: \"\",\n company: \"Schinner - Wiegand\",\n blog: \"\",\n location: \"\",\n email: \"Pearline_Brekke@hotmail.com\",\n twitterUsername: \"\",\n pledgeMinimumAmount: 273260,\n pledgeBadgeShowAmount: false,\n defaultUpfrontSplitToContributors: 976949,\n profileSettings: {},\n featureSettings: {},\n },\n },\n pledgeBadgeCurrentlyEmbedded: true,\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointpledgeCreatedPost({\n data: {\n createdAt: new Date(\"2025-03-12T00:19:41.487Z\"),\n modifiedAt: new Date(\"2023-04-19T01:42:59.169Z\"),\n id: \"\",\n amount: 330877,\n currency: \"Jamaican Dollar\",\n state: \"disputed\",\n type: \"pay_directly\",\n issue: {\n id: \"66524b69-aa0b-47ac-bb9a-0cee5d3a9110\",\n platform: \"github\",\n number: 280857,\n title: \"\",\n state: \"open\",\n issueCreatedAt: new Date(\"2024-02-26T00:33:35.289Z\"),\n needsConfirmationSolved: false,\n funding: {},\n repository: {\n id: \"356e14cb-87a4-484c-bcfa-ebfe50487706\",\n platform: \"github\",\n isPrivate: true,\n name: \"MyOrg\",\n description: \"different premium tinderbox peter under often buzzing hastily\",\n stars: 1337,\n license: \"\",\n homepage: \"\",\n profileSettings: {},\n organization: {\n id: \"29159f56-74c0-464d-b598-8d5bc3b9cdda\",\n platform: \"github\",\n name: \"\",\n avatarUrl: \"https://frightened-poppy.com/\",\n isPersonal: false,\n bio: \"\",\n prettyName: \"\",\n company: \"Bailey - Towne\",\n blog: \"\",\n location: \"\",\n email: \"Cortez_Stehr70@yahoo.com\",\n twitterUsername: \"\",\n organizationId: \"\",\n },\n internalOrganization: {\n createdAt: new Date(\"2025-01-03T15:27:13.109Z\"),\n modifiedAt: new Date(\"2024-02-15T22:10:17.041Z\"),\n id: \"\",\n name: \"\",\n slug: \"\",\n avatarUrl: \"https://hard-to-find-thyme.org\",\n bio: \"\",\n company: \"Schinner - Wiegand\",\n blog: \"\",\n location: \"\",\n email: \"Pearline_Brekke@hotmail.com\",\n twitterUsername: \"\",\n pledgeMinimumAmount: 273260,\n pledgeBadgeShowAmount: false,\n defaultUpfrontSplitToContributors: 976949,\n profileSettings: {},\n featureSettings: {},\n },\n },\n pledgeBadgeCurrentlyEmbedded: true,\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["pledge.updated"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointpledge_updated_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointpledgeUpdatedPost({\n data: {\n createdAt: new Date(\"2023-11-30T00:10:39.674Z\"),\n modifiedAt: new Date(\"2024-10-02T21:42:49.754Z\"),\n id: \"\",\n amount: 634567,\n currency: \"Singapore Dollar\",\n state: \"refunded\",\n type: \"pay_on_completion\",\n issue: {\n id: \"d2e1349d-085a-441c-abf4-379a1f21d0da\",\n number: 218372,\n title: \"\",\n state: \"closed\",\n issueCreatedAt: new Date(\"2023-08-13T14:08:31.083Z\"),\n needsConfirmationSolved: true,\n funding: {},\n repository: {\n id: \"814bd7c6-3412-4f11-b523-7b38c659f44a\",\n isPrivate: false,\n name: \"MyOrg\",\n description: \"hm however microchip\",\n stars: 1337,\n license: \"\",\n homepage: \"\",\n profileSettings: {},\n organization: {\n id: \"3ddd5cc2-de10-41ef-baa1-7551cf671cc3\",\n name: \"\",\n avatarUrl: \"https://gummy-interviewer.biz\",\n isPersonal: false,\n bio: \"\",\n prettyName: \"\",\n company: \"Ferry - Tremblay\",\n blog: \"\",\n location: \"\",\n email: \"Reggie_Crist@yahoo.com\",\n twitterUsername: \"\",\n organizationId: \"\",\n },\n internalOrganization: {\n createdAt: new Date(\"2024-12-13T11:00:39.217Z\"),\n modifiedAt: new Date(\"2024-12-02T09:51:26.214Z\"),\n id: \"\",\n name: \"\",\n slug: \"\",\n avatarUrl: \"https://memorable-numeracy.com/\",\n bio: \"\",\n company: \"Schuster - Crooks\",\n blog: \"\",\n location: \"\",\n email: \"Tatum.Block37@yahoo.com\",\n twitterUsername: \"\",\n pledgeMinimumAmount: 653584,\n pledgeBadgeShowAmount: false,\n defaultUpfrontSplitToContributors: 175899,\n profileSettings: {},\n featureSettings: {},\n },\n },\n pledgeBadgeCurrentlyEmbedded: false,\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointpledgeUpdatedPost({\n data: {\n createdAt: new Date(\"2024-11-29T00:10:39.674Z\"),\n modifiedAt: new Date(\"2025-10-02T21:42:49.754Z\"),\n id: \"\",\n amount: 634567,\n currency: \"Singapore Dollar\",\n state: \"refunded\",\n type: \"pay_on_completion\",\n issue: {\n id: \"d2e1349d-085a-441c-abf4-379a1f21d0da\",\n platform: \"github\",\n number: 218372,\n title: \"\",\n state: \"closed\",\n issueCreatedAt: new Date(\"2024-08-12T14:08:31.083Z\"),\n needsConfirmationSolved: true,\n funding: {},\n repository: {\n id: \"814bd7c6-3412-4f11-b523-7b38c659f44a\",\n platform: \"github\",\n isPrivate: false,\n name: \"MyOrg\",\n description: \"hm however microchip\",\n stars: 1337,\n license: \"\",\n homepage: \"\",\n profileSettings: {},\n organization: {\n id: \"3ddd5cc2-de10-41ef-baa1-7551cf671cc3\",\n platform: \"github\",\n name: \"\",\n avatarUrl: \"https://gummy-interviewer.biz\",\n isPersonal: false,\n bio: \"\",\n prettyName: \"\",\n company: \"Ferry - Tremblay\",\n blog: \"\",\n location: \"\",\n email: \"Reggie_Crist@yahoo.com\",\n twitterUsername: \"\",\n organizationId: \"\",\n },\n internalOrganization: {\n createdAt: new Date(\"2025-12-13T11:00:39.217Z\"),\n modifiedAt: new Date(\"2025-12-02T09:51:26.214Z\"),\n id: \"\",\n name: \"\",\n slug: \"\",\n avatarUrl: \"https://memorable-numeracy.com/\",\n bio: \"\",\n company: \"Schuster - Crooks\",\n blog: \"\",\n location: \"\",\n email: \"Tatum.Block37@yahoo.com\",\n twitterUsername: \"\",\n pledgeMinimumAmount: 653584,\n pledgeBadgeShowAmount: false,\n defaultUpfrontSplitToContributors: 175899,\n profileSettings: {},\n featureSettings: {},\n },\n },\n pledgeBadgeCurrentlyEmbedded: false,\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["product.created"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointproduct_created_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointproductCreatedPost({\n data: {\n createdAt: new Date(\"2022-03-27T06:36:20.130Z\"),\n modifiedAt: new Date(\"2024-04-21T12:05:16.637Z\"),\n id: \"\",\n name: \"\",\n description: \"into horst metal grimy clinch big grounded industrialize\",\n isRecurring: true,\n isArchived: true,\n organizationId: \"\",\n metadata: {\n\n },\n prices: [\n {\n createdAt: new Date(\"2023-12-08T23:31:39.577Z\"),\n modifiedAt: new Date(\"2023-04-26T10:21:28.587Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n recurringInterval: \"month\",\n },\n {\n createdAt: new Date(\"2023-09-07T02:23:36.299Z\"),\n modifiedAt: new Date(\"2023-10-10T12:20:00.039Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n minimumAmount: 527608,\n maximumAmount: 32202,\n presetAmount: 66164,\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2022-08-11T12:50:57.278Z\"),\n modifiedAt: new Date(\"2022-03-26T05:55:13.113Z\"),\n id: \"\",\n description: \"tromp these near throughout shear\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n note: \"\",\n },\n isTaxApplicable: false,\n },\n {\n createdAt: new Date(\"2024-05-03T09:49:30.012Z\"),\n modifiedAt: new Date(\"2024-02-20T10:03:27.777Z\"),\n id: \"\",\n description: \"creature think tuber best\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n guildId: \"\",\n roleId: \"\",\n guildToken: \"\",\n },\n },\n {\n createdAt: new Date(\"2023-04-18T11:46:21.794Z\"),\n modifiedAt: new Date(\"2022-04-09T12:26:58.282Z\"),\n id: \"\",\n description: \"massage super even\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n prefix: \"\",\n expires: {\n ttl: 935647,\n timeframe: \"month\",\n },\n activations: {\n limit: 136136,\n enableCustomerAdmin: false,\n },\n limitUsage: 923812,\n },\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/Users\",\n mimeType: \"\",\n size: 692895,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2022-02-28T01:03:14.537Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2022-06-03T00:39:20.038Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://monstrous-cop-out.net\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/var/mail\",\n mimeType: \"\",\n size: 843323,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2022-04-23T21:31:25.476Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2022-07-19T01:29:35.587Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://well-made-farm.com\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/root\",\n mimeType: \"\",\n size: 849549,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2022-07-30T13:09:33.963Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2023-10-03T20:39:40.444Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://simplistic-devastation.com\",\n },\n ],\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2022-03-24T09:30:48.572Z\"),\n modifiedAt: new Date(\"2022-02-09T00:26:32.257Z\"),\n id: \"\",\n metadata: {\n \"key\": 657365,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {\n options: [\n {\n value: \"\",\n label: \"\",\n },\n ],\n },\n },\n order: 317196,\n required: false,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2022-11-16T07:29:59.811Z\"),\n modifiedAt: new Date(\"2022-04-09T18:35:32.219Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 492053,\n required: true,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2022-03-07T07:24:39.165Z\"),\n modifiedAt: new Date(\"2024-01-26T07:31:37.106Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 17631,\n required: true,\n },\n ],\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointproductCreatedPost({\n data: {\n createdAt: new Date(\"2023-03-27T06:36:20.130Z\"),\n modifiedAt: new Date(\"2025-04-21T12:05:16.637Z\"),\n id: \"\",\n name: \"\",\n description: \"into horst metal grimy clinch big grounded industrialize\",\n isRecurring: true,\n isArchived: true,\n organizationId: \"\",\n metadata: {\n\n },\n prices: [\n {\n createdAt: new Date(\"2024-12-07T23:31:39.577Z\"),\n modifiedAt: new Date(\"2024-04-25T10:21:28.587Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n recurringInterval: \"month\",\n },\n {\n createdAt: new Date(\"2024-09-06T02:23:36.299Z\"),\n modifiedAt: new Date(\"2024-10-09T12:20:00.039Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n minimumAmount: 527608,\n maximumAmount: 32202,\n presetAmount: 66164,\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2023-08-11T12:50:57.278Z\"),\n modifiedAt: new Date(\"2023-03-26T05:55:13.113Z\"),\n id: \"\",\n description: \"tromp these near throughout shear\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n note: \"\",\n },\n isTaxApplicable: false,\n },\n {\n createdAt: new Date(\"2025-05-03T09:49:30.012Z\"),\n modifiedAt: new Date(\"2025-02-19T10:03:27.777Z\"),\n id: \"\",\n description: \"creature think tuber best\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n guildId: \"\",\n roleId: \"\",\n guildToken: \"\",\n },\n },\n {\n createdAt: new Date(\"2024-04-17T11:46:21.794Z\"),\n modifiedAt: new Date(\"2023-04-09T12:26:58.282Z\"),\n id: \"\",\n description: \"massage super even\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n prefix: \"\",\n expires: {\n ttl: 935647,\n timeframe: \"month\",\n },\n activations: {\n limit: 136136,\n enableCustomerAdmin: false,\n },\n limitUsage: 923812,\n },\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/Users\",\n mimeType: \"\",\n size: 692895,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2023-02-28T01:03:14.537Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2023-06-03T00:39:20.038Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://monstrous-cop-out.net\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/var/mail\",\n mimeType: \"\",\n size: 843323,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2023-04-23T21:31:25.476Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2023-07-19T01:29:35.587Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://well-made-farm.com\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/root\",\n mimeType: \"\",\n size: 849549,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2023-07-30T13:09:33.963Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2024-10-02T20:39:40.444Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://simplistic-devastation.com\",\n },\n ],\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-03-24T09:30:48.572Z\"),\n modifiedAt: new Date(\"2023-02-09T00:26:32.257Z\"),\n id: \"\",\n metadata: {\n \"key\": 657365,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {\n options: [\n {\n value: \"\",\n label: \"\",\n },\n ],\n },\n },\n order: 317196,\n required: false,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-11-16T07:29:59.811Z\"),\n modifiedAt: new Date(\"2023-04-09T18:35:32.219Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 492053,\n required: true,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-03-07T07:24:39.165Z\"),\n modifiedAt: new Date(\"2025-01-25T07:31:37.106Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 17631,\n required: true,\n },\n ],\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["product.updated"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointproduct_updated_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointproductUpdatedPost({\n data: {\n createdAt: new Date(\"2023-06-26T03:46:32.479Z\"),\n modifiedAt: new Date(\"2022-06-04T01:47:33.158Z\"),\n id: \"\",\n name: \"\",\n description: \"er ick birdcage\",\n isRecurring: true,\n isArchived: false,\n organizationId: \"\",\n metadata: {\n\n },\n prices: [\n {\n createdAt: new Date(\"2022-04-14T23:22:06.974Z\"),\n modifiedAt: new Date(\"2022-11-27T16:49:54.775Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n priceAmount: 320395,\n recurringInterval: \"month\",\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2022-06-01T01:28:53.091Z\"),\n modifiedAt: new Date(\"2023-03-01T01:53:23.154Z\"),\n id: \"\",\n description: \"ick birdcage manage shark along always modulo fidget inside lightly\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n guildId: \"\",\n roleId: \"\",\n guildToken: \"\",\n },\n },\n {\n createdAt: new Date(\"2023-02-12T19:04:33.442Z\"),\n modifiedAt: new Date(\"2023-03-31T22:30:29.668Z\"),\n id: \"\",\n description: \"lotion role till by yuck terribly\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n repositoryOwner: \"polarsource\",\n repositoryName: \"private_repo\",\n permission: \"maintain\",\n },\n },\n {\n createdAt: new Date(\"2022-05-05T14:08:08.545Z\"),\n modifiedAt: new Date(\"2022-10-20T01:25:33.770Z\"),\n id: \"\",\n description: \"minor aha boohoo team\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n repositoryOwner: \"polarsource\",\n repositoryName: \"private_repo\",\n permission: \"pull\",\n },\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/usr/libexec\",\n mimeType: \"\",\n size: 151389,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2022-12-22T05:20:03.719Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2024-02-19T02:35:29.302Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://meager-dividend.biz\",\n },\n ],\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2022-10-31T20:54:51.973Z\"),\n modifiedAt: new Date(\"2024-06-25T07:43:21.903Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 19557,\n required: true,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-06-28T03:01:35.144Z\"),\n modifiedAt: new Date(\"2022-03-31T13:51:41.910Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 753420,\n required: true,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2022-12-10T00:18:34.847Z\"),\n modifiedAt: new Date(\"2024-08-19T11:13:30.301Z\"),\n id: \"\",\n metadata: {\n \"key\": 700832,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 454407,\n required: true,\n },\n ],\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointproductUpdatedPost({\n data: {\n createdAt: new Date(\"2024-06-25T03:46:32.479Z\"),\n modifiedAt: new Date(\"2023-06-04T01:47:33.158Z\"),\n id: \"\",\n name: \"\",\n description: \"er ick birdcage\",\n isRecurring: true,\n isArchived: false,\n organizationId: \"\",\n metadata: {\n\n },\n prices: [\n {\n createdAt: new Date(\"2023-04-14T23:22:06.974Z\"),\n modifiedAt: new Date(\"2023-11-27T16:49:54.775Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n priceAmount: 320395,\n recurringInterval: \"month\",\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2023-06-01T01:28:53.091Z\"),\n modifiedAt: new Date(\"2024-02-29T01:53:23.154Z\"),\n id: \"\",\n description: \"ick birdcage manage shark along always modulo fidget inside lightly\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n guildId: \"\",\n roleId: \"\",\n guildToken: \"\",\n },\n },\n {\n createdAt: new Date(\"2024-02-12T19:04:33.442Z\"),\n modifiedAt: new Date(\"2024-03-30T22:30:29.668Z\"),\n id: \"\",\n description: \"lotion role till by yuck terribly\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n repositoryOwner: \"polarsource\",\n repositoryName: \"private_repo\",\n permission: \"maintain\",\n },\n },\n {\n createdAt: new Date(\"2023-05-05T14:08:08.545Z\"),\n modifiedAt: new Date(\"2023-10-20T01:25:33.770Z\"),\n id: \"\",\n description: \"minor aha boohoo team\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n repositoryOwner: \"polarsource\",\n repositoryName: \"private_repo\",\n permission: \"pull\",\n },\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/usr/libexec\",\n mimeType: \"\",\n size: 151389,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2023-12-22T05:20:03.719Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2025-02-18T02:35:29.302Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://meager-dividend.biz\",\n },\n ],\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-10-31T20:54:51.973Z\"),\n modifiedAt: new Date(\"2025-06-25T07:43:21.903Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 19557,\n required: true,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2024-06-27T03:01:35.144Z\"),\n modifiedAt: new Date(\"2023-03-31T13:51:41.910Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 753420,\n required: true,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-12-10T00:18:34.847Z\"),\n modifiedAt: new Date(\"2025-08-19T11:13:30.301Z\"),\n id: \"\",\n metadata: {\n \"key\": 700832,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 454407,\n required: true,\n },\n ],\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["subscription.active"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointsubscription_active_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointsubscriptionActivePost({\n data: {\n createdAt: new Date(\"2022-09-17T11:03:44.679Z\"),\n modifiedAt: new Date(\"2024-07-24T20:02:17.426Z\"),\n id: \"\",\n amount: 116760,\n currency: \"Quetzal\",\n recurringInterval: \"month\",\n status: \"incomplete\",\n currentPeriodStart: new Date(\"2022-08-25T00:14:50.252Z\"),\n currentPeriodEnd: new Date(\"2022-12-10T18:25:01.577Z\"),\n cancelAtPeriodEnd: false,\n startedAt: new Date(\"2023-07-06T14:07:23.099Z\"),\n endedAt: new Date(\"2023-07-01T08:12:48.355Z\"),\n customerId: \"\",\n productId: \"\",\n priceId: \"\",\n discountId: \"\",\n checkoutId: \"\",\n metadata: {\n\n },\n customer: {\n createdAt: new Date(\"2024-10-30T02:51:06.576Z\"),\n modifiedAt: new Date(\"2023-06-21T14:46:16.535Z\"),\n id: \"\",\n metadata: {\n \"key\": true,\n \"key1\": \"\",\n \"key2\": 615212,\n },\n email: \"Sincere42@gmail.com\",\n emailVerified: false,\n name: \"\",\n billingAddress: {\n country: \"Tanzania\",\n },\n taxId: [\n \"\",\n \"\",\n \"mx_rfc\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://negative-tentacle.com\",\n },\n userId: \"\",\n user: {\n id: \"\",\n email: \"Zoey_Bahringer88@hotmail.com\",\n publicName: \"\",\n },\n product: {\n createdAt: new Date(\"2024-03-05T21:40:58.905Z\"),\n modifiedAt: new Date(\"2022-06-03T13:50:25.005Z\"),\n id: \"\",\n name: \"\",\n description: \"synthesise beautifully until below barring concerning\",\n isRecurring: true,\n isArchived: false,\n organizationId: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": 893296,\n },\n prices: [\n {\n createdAt: new Date(\"2022-12-23T21:06:29.057Z\"),\n modifiedAt: new Date(\"2023-06-19T07:32:20.859Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n priceAmount: 110303,\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2022-12-10T18:25:01.577Z\"),\n modifiedAt: new Date(\"2023-09-05T07:05:35.451Z\"),\n id: \"\",\n description: \"from suspiciously another bitter geez joyously courageously\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n note: \"\",\n },\n isTaxApplicable: false,\n },\n {\n createdAt: new Date(\"2022-07-07T22:15:53.860Z\"),\n modifiedAt: new Date(\"2022-02-27T05:34:22.707Z\"),\n id: \"\",\n description: \"newsprint toward like fast magnificent yippee\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {},\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/media\",\n mimeType: \"\",\n size: 931655,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2022-06-07T17:40:48.757Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2023-07-28T18:04:02.928Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://remorseful-hamburger.name\",\n },\n ],\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2022-12-20T17:12:38.621Z\"),\n modifiedAt: new Date(\"2022-05-15T20:51:57.377Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 769742,\n required: false,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2024-02-18T13:39:50.808Z\"),\n modifiedAt: new Date(\"2024-03-27T06:27:09.035Z\"),\n id: \"\",\n metadata: {\n \"key\": 775460,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 61975,\n required: false,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2022-01-21T03:01:14.288Z\"),\n modifiedAt: new Date(\"2024-03-03T05:42:43.472Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 531803,\n required: true,\n },\n ],\n },\n price: {\n createdAt: new Date(\"2024-11-26T01:05:50.319Z\"),\n modifiedAt: new Date(\"2022-03-31T14:01:05.007Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n minimumAmount: 212226,\n maximumAmount: 700283,\n presetAmount: 223374,\n recurringInterval: \"year\",\n },\n discount: {\n duration: \"repeating\",\n durationInMonths: 797898,\n type: \"percentage\",\n amount: 764641,\n currency: \"Hryvnia\",\n createdAt: new Date(\"2022-10-20T20:21:06.932Z\"),\n modifiedAt: new Date(\"2023-10-20T13:44:20.141Z\"),\n id: \"\",\n metadata: {\n \"key\": 630245,\n },\n name: \"\",\n code: \"\",\n startsAt: new Date(\"2023-07-12T07:27:00.073Z\"),\n endsAt: new Date(\"2022-10-29T18:42:02.439Z\"),\n maxRedemptions: 240424,\n redemptionsCount: 504359,\n organizationId: \"\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointsubscriptionActivePost({\n data: {\n createdAt: new Date(\"2023-09-17T11:03:44.679Z\"),\n modifiedAt: new Date(\"2025-07-24T20:02:17.426Z\"),\n id: \"\",\n amount: 116760,\n currency: \"Quetzal\",\n recurringInterval: \"month\",\n status: \"incomplete\",\n currentPeriodStart: new Date(\"2023-08-25T00:14:50.252Z\"),\n currentPeriodEnd: new Date(\"2023-12-10T18:25:01.577Z\"),\n cancelAtPeriodEnd: false,\n startedAt: new Date(\"2024-07-05T14:07:23.099Z\"),\n endedAt: new Date(\"2024-06-30T08:12:48.355Z\"),\n customerId: \"\",\n productId: \"\",\n priceId: \"\",\n discountId: \"\",\n checkoutId: \"\",\n metadata: {\n\n },\n customer: {\n createdAt: new Date(\"2025-10-30T02:51:06.576Z\"),\n modifiedAt: new Date(\"2024-06-20T14:46:16.535Z\"),\n id: \"\",\n metadata: {\n \"key\": true,\n \"key1\": \"\",\n \"key2\": 615212,\n },\n email: \"Sincere42@gmail.com\",\n emailVerified: false,\n name: \"\",\n billingAddress: {\n country: \"Tanzania\",\n },\n taxId: [\n \"\",\n \"\",\n \"mx_rfc\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://negative-tentacle.com\",\n },\n userId: \"\",\n user: {\n id: \"\",\n email: \"Zoey_Bahringer88@hotmail.com\",\n publicName: \"\",\n },\n product: {\n createdAt: new Date(\"2025-03-05T21:40:58.905Z\"),\n modifiedAt: new Date(\"2023-06-03T13:50:25.005Z\"),\n id: \"\",\n name: \"\",\n description: \"synthesise beautifully until below barring concerning\",\n isRecurring: true,\n isArchived: false,\n organizationId: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": 893296,\n },\n prices: [\n {\n createdAt: new Date(\"2023-12-23T21:06:29.057Z\"),\n modifiedAt: new Date(\"2024-06-18T07:32:20.859Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n priceAmount: 110303,\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2023-12-10T18:25:01.577Z\"),\n modifiedAt: new Date(\"2024-09-04T07:05:35.451Z\"),\n id: \"\",\n description: \"from suspiciously another bitter geez joyously courageously\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n note: \"\",\n },\n isTaxApplicable: false,\n },\n {\n createdAt: new Date(\"2023-07-07T22:15:53.860Z\"),\n modifiedAt: new Date(\"2023-02-27T05:34:22.707Z\"),\n id: \"\",\n description: \"newsprint toward like fast magnificent yippee\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {},\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/media\",\n mimeType: \"\",\n size: 931655,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2023-06-07T17:40:48.757Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2024-07-27T18:04:02.928Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://remorseful-hamburger.name\",\n },\n ],\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-12-20T17:12:38.621Z\"),\n modifiedAt: new Date(\"2023-05-15T20:51:57.377Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 769742,\n required: false,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2025-02-17T13:39:50.808Z\"),\n modifiedAt: new Date(\"2025-03-27T06:27:09.035Z\"),\n id: \"\",\n metadata: {\n \"key\": 775460,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 61975,\n required: false,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-01-21T03:01:14.288Z\"),\n modifiedAt: new Date(\"2025-03-03T05:42:43.472Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 531803,\n required: true,\n },\n ],\n },\n price: {\n createdAt: new Date(\"2025-11-26T01:05:50.319Z\"),\n modifiedAt: new Date(\"2023-03-31T14:01:05.007Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n minimumAmount: 212226,\n maximumAmount: 700283,\n presetAmount: 223374,\n recurringInterval: \"year\",\n },\n discount: {\n duration: \"repeating\",\n durationInMonths: 797898,\n type: \"percentage\",\n amount: 764641,\n currency: \"Hryvnia\",\n createdAt: new Date(\"2023-10-20T20:21:06.932Z\"),\n modifiedAt: new Date(\"2024-10-19T13:44:20.141Z\"),\n id: \"\",\n metadata: {\n \"key\": 630245,\n },\n name: \"\",\n code: \"\",\n startsAt: new Date(\"2024-07-11T07:27:00.073Z\"),\n endsAt: new Date(\"2023-10-29T18:42:02.439Z\"),\n maxRedemptions: 240424,\n redemptionsCount: 504359,\n organizationId: \"\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["subscription.canceled"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointsubscription_canceled_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointsubscriptionCanceledPost({\n data: {\n createdAt: new Date(\"2023-02-08T10:04:43.200Z\"),\n modifiedAt: new Date(\"2022-02-20T09:16:44.963Z\"),\n id: \"\",\n amount: 384017,\n currency: \"Nakfa\",\n recurringInterval: \"month\",\n status: \"canceled\",\n currentPeriodStart: new Date(\"2024-08-29T23:51:26.505Z\"),\n currentPeriodEnd: new Date(\"2023-01-30T14:57:29.126Z\"),\n cancelAtPeriodEnd: false,\n startedAt: new Date(\"2022-05-31T10:57:35.559Z\"),\n endedAt: new Date(\"2023-11-01T08:13:37.012Z\"),\n customerId: \"\",\n productId: \"\",\n priceId: \"\",\n discountId: \"\",\n checkoutId: \"\",\n metadata: {\n\n },\n customer: {\n createdAt: new Date(\"2022-07-13T20:08:34.251Z\"),\n modifiedAt: new Date(\"2023-11-18T03:48:04.429Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": \"\",\n \"key2\": 199269,\n },\n email: \"Marcella_Gislason@gmail.com\",\n emailVerified: false,\n name: \"\",\n billingAddress: {\n country: \"Kuwait\",\n },\n taxId: [\n \"\",\n \"ca_qst\",\n \"ua_vat\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://oily-juggernaut.com/\",\n },\n userId: \"\",\n user: {\n id: \"\",\n email: \"Sherwood.Murphy2@yahoo.com\",\n publicName: \"\",\n },\n product: {\n createdAt: new Date(\"2022-04-28T07:50:03.180Z\"),\n modifiedAt: new Date(\"2022-02-20T03:50:20.279Z\"),\n id: \"\",\n name: \"\",\n description: \"tenant indeed when distorted before excluding claw stool aw self-reliant\",\n isRecurring: true,\n isArchived: false,\n organizationId: \"\",\n metadata: {\n \"key\": 231419,\n },\n prices: [\n {\n createdAt: new Date(\"2023-02-25T21:11:48.890Z\"),\n modifiedAt: new Date(\"2022-10-06T06:04:45.294Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n priceAmount: 433194,\n recurringInterval: \"year\",\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2023-01-30T14:57:29.126Z\"),\n modifiedAt: new Date(\"2023-11-08T11:19:25.895Z\"),\n id: \"\",\n description: \"above phew splash because\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n prefix: \"\",\n expires: {\n ttl: 632248,\n timeframe: \"day\",\n },\n activations: {\n limit: 351735,\n enableCustomerAdmin: false,\n },\n limitUsage: 629264,\n },\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/usr/include\",\n mimeType: \"\",\n size: 778001,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2023-03-31T22:07:25.990Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2024-09-17T20:00:26.644Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://dim-tail.org\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/etc/namedb\",\n mimeType: \"\",\n size: 797228,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2022-12-03T23:14:09.199Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2024-10-11T05:55:27.601Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://tragic-castanet.biz/\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/private/tmp\",\n mimeType: \"\",\n size: 547184,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2024-08-24T04:18:58.722Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2023-07-31T11:34:39.128Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://cumbersome-forage.biz\",\n },\n ],\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2022-02-02T14:55:14.427Z\"),\n modifiedAt: new Date(\"2022-01-12T05:03:52.598Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 790486,\n required: true,\n },\n ],\n },\n price: {\n createdAt: new Date(\"2024-10-11T07:00:30.143Z\"),\n modifiedAt: new Date(\"2023-12-24T22:35:56.583Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n priceAmount: 257157,\n recurringInterval: \"month\",\n },\n discount: {\n duration: \"repeating\",\n durationInMonths: 881227,\n type: \"percentage\",\n basisPoints: 219027,\n createdAt: new Date(\"2024-08-25T05:44:47.155Z\"),\n modifiedAt: new Date(\"2024-05-20T21:20:47.625Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n name: \"\",\n code: \"\",\n startsAt: new Date(\"2023-02-10T10:42:46.688Z\"),\n endsAt: new Date(\"2022-06-18T16:12:21.059Z\"),\n maxRedemptions: 372199,\n redemptionsCount: 943530,\n organizationId: \"\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointsubscriptionCanceledPost({\n data: {\n createdAt: new Date(\"2024-02-08T10:04:43.200Z\"),\n modifiedAt: new Date(\"2023-02-20T09:16:44.963Z\"),\n id: \"\",\n amount: 384017,\n currency: \"Nakfa\",\n recurringInterval: \"month\",\n status: \"canceled\",\n currentPeriodStart: new Date(\"2025-08-29T23:51:26.505Z\"),\n currentPeriodEnd: new Date(\"2024-01-30T14:57:29.126Z\"),\n cancelAtPeriodEnd: false,\n startedAt: new Date(\"2023-05-31T10:57:35.559Z\"),\n endedAt: new Date(\"2024-10-31T08:13:37.012Z\"),\n customerId: \"\",\n productId: \"\",\n priceId: \"\",\n discountId: \"\",\n checkoutId: \"\",\n metadata: {\n\n },\n customer: {\n createdAt: new Date(\"2023-07-13T20:08:34.251Z\"),\n modifiedAt: new Date(\"2024-11-17T03:48:04.429Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": \"\",\n \"key2\": 199269,\n },\n email: \"Marcella_Gislason@gmail.com\",\n emailVerified: false,\n name: \"\",\n billingAddress: {\n country: \"Kuwait\",\n },\n taxId: [\n \"\",\n \"ca_qst\",\n \"ua_vat\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://oily-juggernaut.com/\",\n },\n userId: \"\",\n user: {\n id: \"\",\n email: \"Sherwood.Murphy2@yahoo.com\",\n publicName: \"\",\n },\n product: {\n createdAt: new Date(\"2023-04-28T07:50:03.180Z\"),\n modifiedAt: new Date(\"2023-02-20T03:50:20.279Z\"),\n id: \"\",\n name: \"\",\n description: \"tenant indeed when distorted before excluding claw stool aw self-reliant\",\n isRecurring: true,\n isArchived: false,\n organizationId: \"\",\n metadata: {\n \"key\": 231419,\n },\n prices: [\n {\n createdAt: new Date(\"2024-02-25T21:11:48.890Z\"),\n modifiedAt: new Date(\"2023-10-06T06:04:45.294Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n priceAmount: 433194,\n recurringInterval: \"year\",\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2024-01-30T14:57:29.126Z\"),\n modifiedAt: new Date(\"2024-11-07T11:19:25.895Z\"),\n id: \"\",\n description: \"above phew splash because\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n prefix: \"\",\n expires: {\n ttl: 632248,\n timeframe: \"day\",\n },\n activations: {\n limit: 351735,\n enableCustomerAdmin: false,\n },\n limitUsage: 629264,\n },\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/usr/include\",\n mimeType: \"\",\n size: 778001,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2024-03-30T22:07:25.990Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2025-09-17T20:00:26.644Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://dim-tail.org\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/etc/namedb\",\n mimeType: \"\",\n size: 797228,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2023-12-03T23:14:09.199Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2025-10-11T05:55:27.601Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://tragic-castanet.biz/\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/private/tmp\",\n mimeType: \"\",\n size: 547184,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2025-08-24T04:18:58.722Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2024-07-30T11:34:39.128Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://cumbersome-forage.biz\",\n },\n ],\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-02-02T14:55:14.427Z\"),\n modifiedAt: new Date(\"2023-01-12T05:03:52.598Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 790486,\n required: true,\n },\n ],\n },\n price: {\n createdAt: new Date(\"2025-10-11T07:00:30.143Z\"),\n modifiedAt: new Date(\"2024-12-23T22:35:56.583Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n priceAmount: 257157,\n recurringInterval: \"month\",\n },\n discount: {\n duration: \"repeating\",\n durationInMonths: 881227,\n type: \"percentage\",\n basisPoints: 219027,\n createdAt: new Date(\"2025-08-25T05:44:47.155Z\"),\n modifiedAt: new Date(\"2025-05-20T21:20:47.625Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n name: \"\",\n code: \"\",\n startsAt: new Date(\"2024-02-10T10:42:46.688Z\"),\n endsAt: new Date(\"2023-06-18T16:12:21.059Z\"),\n maxRedemptions: 372199,\n redemptionsCount: 943530,\n organizationId: \"\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["subscription.created"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointsubscription_created_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointsubscriptionCreatedPost({\n data: {\n createdAt: new Date(\"2023-07-04T01:29:40.920Z\"),\n modifiedAt: new Date(\"2022-02-20T03:35:25.500Z\"),\n id: \"\",\n amount: 78980,\n currency: \"Dong\",\n recurringInterval: \"month\",\n status: \"incomplete_expired\",\n currentPeriodStart: new Date(\"2024-01-26T02:46:12.208Z\"),\n currentPeriodEnd: new Date(\"2022-10-08T16:07:22.449Z\"),\n cancelAtPeriodEnd: false,\n startedAt: new Date(\"2024-10-17T20:21:29.819Z\"),\n endedAt: new Date(\"2022-02-26T17:52:17.099Z\"),\n customerId: \"\",\n productId: \"\",\n priceId: \"\",\n discountId: \"\",\n checkoutId: \"\",\n metadata: {\n\n },\n customer: {\n createdAt: new Date(\"2022-09-06T09:33:34.348Z\"),\n modifiedAt: new Date(\"2024-05-17T19:46:56.602Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": 229409,\n },\n email: \"Jermey.Ward@gmail.com\",\n emailVerified: false,\n name: \"\",\n billingAddress: {\n country: \"Vietnam\",\n },\n taxId: [\n \"\",\n \"sg_gst\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://junior-numeracy.info/\",\n },\n userId: \"\",\n user: {\n id: \"\",\n email: \"Rosalia.Ritchie@yahoo.com\",\n publicName: \"\",\n },\n product: {\n createdAt: new Date(\"2024-02-26T17:46:34.360Z\"),\n modifiedAt: new Date(\"2023-12-01T21:55:43.801Z\"),\n id: \"\",\n name: \"\",\n description: \"from below aw request\",\n isRecurring: false,\n isArchived: true,\n organizationId: \"\",\n metadata: {\n\n },\n prices: [\n {\n createdAt: new Date(\"2022-03-28T13:29:27.613Z\"),\n modifiedAt: new Date(\"2024-10-05T17:53:50.261Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n priceAmount: 418755,\n },\n {\n createdAt: new Date(\"2022-10-08T16:07:22.449Z\"),\n modifiedAt: new Date(\"2024-03-25T06:36:23.018Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n recurringInterval: \"year\",\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2022-07-04T19:46:53.033Z\"),\n modifiedAt: new Date(\"2022-09-06T09:33:34.348Z\"),\n id: \"\",\n description: \"foretell outgoing meh mechanically etch twine deed um on\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {},\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/etc/defaults\",\n mimeType: \"\",\n size: 212274,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2024-02-07T09:30:30.379Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2023-02-24T03:01:46.062Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://courageous-sailor.com/\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/bin\",\n mimeType: \"\",\n size: 411556,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2022-11-06T04:00:51.558Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2024-08-27T08:53:33.064Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://snappy-airline.name\",\n },\n ],\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2024-08-04T21:33:41.088Z\"),\n modifiedAt: new Date(\"2023-01-18T07:13:43.618Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 893449,\n required: false,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-10-22T05:30:47.412Z\"),\n modifiedAt: new Date(\"2024-06-17T14:49:05.261Z\"),\n id: \"\",\n metadata: {\n \"key\": 966758,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 954791,\n required: false,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-05-30T03:00:41.121Z\"),\n modifiedAt: new Date(\"2022-09-20T15:44:04.829Z\"),\n id: \"\",\n metadata: {\n \"key\": 262037,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 748789,\n required: true,\n },\n ],\n },\n price: {\n createdAt: new Date(\"2024-10-04T05:55:28.900Z\"),\n modifiedAt: new Date(\"2023-12-20T20:35:08.624Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n minimumAmount: 63766,\n maximumAmount: 626461,\n presetAmount: 467502,\n recurringInterval: \"month\",\n },\n discount: {\n duration: \"forever\",\n type: \"fixed\",\n basisPoints: 116399,\n createdAt: new Date(\"2024-09-29T12:11:21.682Z\"),\n modifiedAt: new Date(\"2022-07-03T04:55:47.377Z\"),\n id: \"\",\n metadata: {\n\n },\n name: \"\",\n code: \"\",\n startsAt: new Date(\"2022-03-13T02:22:01.631Z\"),\n endsAt: new Date(\"2024-09-16T04:55:19.972Z\"),\n maxRedemptions: 803154,\n redemptionsCount: 825426,\n organizationId: \"\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointsubscriptionCreatedPost({\n data: {\n createdAt: new Date(\"2024-07-03T01:29:40.920Z\"),\n modifiedAt: new Date(\"2023-02-20T03:35:25.500Z\"),\n id: \"\",\n amount: 78980,\n currency: \"Dong\",\n recurringInterval: \"month\",\n status: \"incomplete_expired\",\n currentPeriodStart: new Date(\"2025-01-25T02:46:12.208Z\"),\n currentPeriodEnd: new Date(\"2023-10-08T16:07:22.449Z\"),\n cancelAtPeriodEnd: false,\n startedAt: new Date(\"2025-10-17T20:21:29.819Z\"),\n endedAt: new Date(\"2023-02-26T17:52:17.099Z\"),\n customerId: \"\",\n productId: \"\",\n priceId: \"\",\n discountId: \"\",\n checkoutId: \"\",\n metadata: {\n\n },\n customer: {\n createdAt: new Date(\"2023-09-06T09:33:34.348Z\"),\n modifiedAt: new Date(\"2025-05-17T19:46:56.602Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": 229409,\n },\n email: \"Jermey.Ward@gmail.com\",\n emailVerified: false,\n name: \"\",\n billingAddress: {\n country: \"Vietnam\",\n },\n taxId: [\n \"\",\n \"sg_gst\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://junior-numeracy.info/\",\n },\n userId: \"\",\n user: {\n id: \"\",\n email: \"Rosalia.Ritchie@yahoo.com\",\n publicName: \"\",\n },\n product: {\n createdAt: new Date(\"2025-02-25T17:46:34.360Z\"),\n modifiedAt: new Date(\"2024-11-30T21:55:43.801Z\"),\n id: \"\",\n name: \"\",\n description: \"from below aw request\",\n isRecurring: false,\n isArchived: true,\n organizationId: \"\",\n metadata: {\n\n },\n prices: [\n {\n createdAt: new Date(\"2023-03-28T13:29:27.613Z\"),\n modifiedAt: new Date(\"2025-10-05T17:53:50.261Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n priceAmount: 418755,\n },\n {\n createdAt: new Date(\"2023-10-08T16:07:22.449Z\"),\n modifiedAt: new Date(\"2025-03-25T06:36:23.018Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n recurringInterval: \"year\",\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2023-07-04T19:46:53.033Z\"),\n modifiedAt: new Date(\"2023-09-06T09:33:34.348Z\"),\n id: \"\",\n description: \"foretell outgoing meh mechanically etch twine deed um on\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {},\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/etc/defaults\",\n mimeType: \"\",\n size: 212274,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2025-02-06T09:30:30.379Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2024-02-24T03:01:46.062Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://courageous-sailor.com/\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/bin\",\n mimeType: \"\",\n size: 411556,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2023-11-06T04:00:51.558Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2025-08-27T08:53:33.064Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://snappy-airline.name\",\n },\n ],\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2025-08-04T21:33:41.088Z\"),\n modifiedAt: new Date(\"2024-01-18T07:13:43.618Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 893449,\n required: false,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2024-10-21T05:30:47.412Z\"),\n modifiedAt: new Date(\"2025-06-17T14:49:05.261Z\"),\n id: \"\",\n metadata: {\n \"key\": 966758,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 954791,\n required: false,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2024-05-29T03:00:41.121Z\"),\n modifiedAt: new Date(\"2023-09-20T15:44:04.829Z\"),\n id: \"\",\n metadata: {\n \"key\": 262037,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 748789,\n required: true,\n },\n ],\n },\n price: {\n createdAt: new Date(\"2025-10-04T05:55:28.900Z\"),\n modifiedAt: new Date(\"2024-12-19T20:35:08.624Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n minimumAmount: 63766,\n maximumAmount: 626461,\n presetAmount: 467502,\n recurringInterval: \"month\",\n },\n discount: {\n duration: \"forever\",\n type: \"fixed\",\n basisPoints: 116399,\n createdAt: new Date(\"2025-09-29T12:11:21.682Z\"),\n modifiedAt: new Date(\"2023-07-03T04:55:47.377Z\"),\n id: \"\",\n metadata: {\n\n },\n name: \"\",\n code: \"\",\n startsAt: new Date(\"2023-03-13T02:22:01.631Z\"),\n endsAt: new Date(\"2025-09-16T04:55:19.972Z\"),\n maxRedemptions: 803154,\n redemptionsCount: 825426,\n organizationId: \"\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["subscription.revoked"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointsubscription_revoked_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointsubscriptionRevokedPost({\n data: {\n createdAt: new Date(\"2024-11-29T12:00:55.925Z\"),\n modifiedAt: new Date(\"2022-03-13T04:36:55.320Z\"),\n id: \"\",\n amount: 780683,\n currency: \"CFP Franc\",\n recurringInterval: \"year\",\n status: \"trialing\",\n currentPeriodStart: new Date(\"2022-06-20T05:55:42.170Z\"),\n currentPeriodEnd: new Date(\"2023-05-17T17:55:53.899Z\"),\n cancelAtPeriodEnd: true,\n startedAt: new Date(\"2024-10-25T10:04:20.460Z\"),\n endedAt: new Date(\"2023-09-30T18:36:35.285Z\"),\n customerId: \"\",\n productId: \"\",\n priceId: \"\",\n discountId: \"\",\n checkoutId: \"\",\n metadata: {\n \"key\": 721489,\n },\n customer: {\n createdAt: new Date(\"2022-06-02T05:06:11.692Z\"),\n modifiedAt: new Date(\"2024-09-02T15:09:07.489Z\"),\n id: \"\",\n metadata: {\n \"key\": 112038,\n \"key1\": 182663,\n \"key2\": 85731,\n },\n email: \"Tia59@yahoo.com\",\n emailVerified: true,\n name: \"\",\n billingAddress: {\n country: \"Azerbaijan\",\n },\n taxId: [\n \"au_arn\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://babyish-plastic.net\",\n },\n userId: \"\",\n user: {\n id: \"\",\n email: \"Reina59@yahoo.com\",\n publicName: \"\",\n },\n product: {\n createdAt: new Date(\"2023-11-12T08:35:43.186Z\"),\n modifiedAt: new Date(\"2023-02-16T16:26:12.752Z\"),\n id: \"\",\n name: \"\",\n description: \"knavishly next unlike\",\n isRecurring: false,\n isArchived: false,\n organizationId: \"\",\n metadata: {\n\n },\n prices: [\n {\n createdAt: new Date(\"2023-08-17T13:41:14.572Z\"),\n modifiedAt: new Date(\"2022-12-18T14:14:00.851Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n },\n {\n createdAt: new Date(\"2023-06-25T17:28:30.971Z\"),\n modifiedAt: new Date(\"2024-10-25T10:04:20.460Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n minimumAmount: 581912,\n maximumAmount: 382050,\n presetAmount: 354441,\n recurringInterval: \"year\",\n },\n {\n createdAt: new Date(\"2024-06-23T22:13:15.423Z\"),\n modifiedAt: new Date(\"2023-11-03T11:38:25.623Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n recurringInterval: \"month\",\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2022-07-20T04:46:43.248Z\"),\n modifiedAt: new Date(\"2023-11-18T04:36:46.811Z\"),\n id: \"\",\n description: \"replicate where whenever\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n repositoryOwner: \"polarsource\",\n repositoryName: \"private_repo\",\n permission: \"maintain\",\n },\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/selinux\",\n mimeType: \"\",\n size: 307478,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2023-08-09T04:03:47.757Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2024-03-19T06:48:17.921Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://bleak-worth.name\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/opt/sbin\",\n mimeType: \"\",\n size: 846156,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2024-07-22T16:48:21.593Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2022-01-29T12:49:28.784Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://unusual-switch.name\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/var/mail\",\n mimeType: \"\",\n size: 4230,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2024-09-24T13:03:31.087Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2022-07-22T04:02:13.353Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://warm-sideboard.name/\",\n },\n ],\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2022-02-02T13:25:42.995Z\"),\n modifiedAt: new Date(\"2023-01-21T09:49:19.562Z\"),\n id: \"\",\n metadata: {\n \"key\": 107780,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 120474,\n required: false,\n },\n ],\n },\n price: {\n createdAt: new Date(\"2023-06-28T04:05:34.316Z\"),\n modifiedAt: new Date(\"2023-04-02T06:25:10.726Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n recurringInterval: \"year\",\n },\n discount: {\n duration: \"repeating\",\n durationInMonths: 623981,\n type: \"percentage\",\n amount: 886908,\n currency: \"Tugrik\",\n createdAt: new Date(\"2023-01-24T05:12:46.858Z\"),\n modifiedAt: new Date(\"2023-07-07T23:08:05.752Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n name: \"\",\n code: \"\",\n startsAt: new Date(\"2022-03-18T18:07:14.590Z\"),\n endsAt: new Date(\"2023-08-23T05:03:56.525Z\"),\n maxRedemptions: 608057,\n redemptionsCount: 892144,\n organizationId: \"\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointsubscriptionRevokedPost({\n data: {\n createdAt: new Date(\"2025-11-29T12:00:55.925Z\"),\n modifiedAt: new Date(\"2023-03-13T04:36:55.320Z\"),\n id: \"\",\n amount: 780683,\n currency: \"CFP Franc\",\n recurringInterval: \"year\",\n status: \"trialing\",\n currentPeriodStart: new Date(\"2023-06-20T05:55:42.170Z\"),\n currentPeriodEnd: new Date(\"2024-05-16T17:55:53.899Z\"),\n cancelAtPeriodEnd: true,\n startedAt: new Date(\"2025-10-25T10:04:20.460Z\"),\n endedAt: new Date(\"2024-09-29T18:36:35.285Z\"),\n customerId: \"\",\n productId: \"\",\n priceId: \"\",\n discountId: \"\",\n checkoutId: \"\",\n metadata: {\n \"key\": 721489,\n },\n customer: {\n createdAt: new Date(\"2023-06-02T05:06:11.692Z\"),\n modifiedAt: new Date(\"2025-09-02T15:09:07.489Z\"),\n id: \"\",\n metadata: {\n \"key\": 112038,\n \"key1\": 182663,\n \"key2\": 85731,\n },\n email: \"Tia59@yahoo.com\",\n emailVerified: true,\n name: \"\",\n billingAddress: {\n country: \"Azerbaijan\",\n },\n taxId: [\n \"au_arn\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://babyish-plastic.net\",\n },\n userId: \"\",\n user: {\n id: \"\",\n email: \"Reina59@yahoo.com\",\n publicName: \"\",\n },\n product: {\n createdAt: new Date(\"2024-11-11T08:35:43.186Z\"),\n modifiedAt: new Date(\"2024-02-16T16:26:12.752Z\"),\n id: \"\",\n name: \"\",\n description: \"knavishly next unlike\",\n isRecurring: false,\n isArchived: false,\n organizationId: \"\",\n metadata: {\n\n },\n prices: [\n {\n createdAt: new Date(\"2024-08-16T13:41:14.572Z\"),\n modifiedAt: new Date(\"2023-12-18T14:14:00.851Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n },\n {\n createdAt: new Date(\"2024-06-24T17:28:30.971Z\"),\n modifiedAt: new Date(\"2025-10-25T10:04:20.460Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n priceCurrency: \"\",\n minimumAmount: 581912,\n maximumAmount: 382050,\n presetAmount: 354441,\n recurringInterval: \"year\",\n },\n {\n createdAt: new Date(\"2025-06-23T22:13:15.423Z\"),\n modifiedAt: new Date(\"2024-11-02T11:38:25.623Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n recurringInterval: \"month\",\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2023-07-20T04:46:43.248Z\"),\n modifiedAt: new Date(\"2024-11-17T04:36:46.811Z\"),\n id: \"\",\n description: \"replicate where whenever\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n repositoryOwner: \"polarsource\",\n repositoryName: \"private_repo\",\n permission: \"maintain\",\n },\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/selinux\",\n mimeType: \"\",\n size: 307478,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2024-08-08T04:03:47.757Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2025-03-19T06:48:17.921Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://bleak-worth.name\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/opt/sbin\",\n mimeType: \"\",\n size: 846156,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2025-07-22T16:48:21.593Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2023-01-29T12:49:28.784Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://unusual-switch.name\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/var/mail\",\n mimeType: \"\",\n size: 4230,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2025-09-24T13:03:31.087Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2023-07-22T04:02:13.353Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://warm-sideboard.name/\",\n },\n ],\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-02-02T13:25:42.995Z\"),\n modifiedAt: new Date(\"2024-01-21T09:49:19.562Z\"),\n id: \"\",\n metadata: {\n \"key\": 107780,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 120474,\n required: false,\n },\n ],\n },\n price: {\n createdAt: new Date(\"2024-06-27T04:05:34.316Z\"),\n modifiedAt: new Date(\"2024-04-01T06:25:10.726Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n recurringInterval: \"year\",\n },\n discount: {\n duration: \"repeating\",\n durationInMonths: 623981,\n type: \"percentage\",\n amount: 886908,\n currency: \"Tugrik\",\n createdAt: new Date(\"2024-01-24T05:12:46.858Z\"),\n modifiedAt: new Date(\"2024-07-06T23:08:05.752Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n name: \"\",\n code: \"\",\n startsAt: new Date(\"2023-03-18T18:07:14.590Z\"),\n endsAt: new Date(\"2024-08-22T05:03:56.525Z\"),\n maxRedemptions: 608057,\n redemptionsCount: 892144,\n organizationId: \"\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" - target: $["paths"]["subscription.updated"]["post"] update: "x-codeSamples": - "lang": "typescript" - "label": "_endpointsubscription_updated_post" - "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointsubscriptionUpdatedPost({\n data: {\n createdAt: new Date(\"2022-08-16T06:35:49.390Z\"),\n modifiedAt: new Date(\"2024-11-13T10:48:05.575Z\"),\n id: \"\",\n amount: 299644,\n currency: \"Baht\",\n recurringInterval: \"year\",\n status: \"trialing\",\n currentPeriodStart: new Date(\"2024-10-06T07:01:55.000Z\"),\n currentPeriodEnd: new Date(\"2024-01-21T06:59:31.349Z\"),\n cancelAtPeriodEnd: false,\n startedAt: new Date(\"2022-10-04T04:56:04.382Z\"),\n endedAt: new Date(\"2022-01-22T12:57:07.430Z\"),\n customerId: \"\",\n productId: \"\",\n priceId: \"\",\n discountId: \"\",\n checkoutId: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": 442859,\n \"key2\": 394013,\n },\n customer: {\n createdAt: new Date(\"2024-09-14T04:37:19.722Z\"),\n modifiedAt: new Date(\"2024-03-24T00:03:13.207Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": true,\n \"key2\": 392900,\n },\n email: \"Dominic.Toy27@yahoo.com\",\n emailVerified: false,\n name: \"\",\n billingAddress: {\n country: \"Sweden\",\n },\n taxId: [\n \"mx_rfc\",\n \"gb_vat\",\n \"\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://worthy-place.biz\",\n },\n userId: \"\",\n user: {\n id: \"\",\n email: \"Domenico_Franecki46@hotmail.com\",\n publicName: \"\",\n },\n product: {\n createdAt: new Date(\"2023-06-12T14:55:33.574Z\"),\n modifiedAt: new Date(\"2022-06-02T07:14:13.619Z\"),\n id: \"\",\n name: \"\",\n description: \"intent that yowza\",\n isRecurring: true,\n isArchived: false,\n organizationId: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": true,\n },\n prices: [\n {\n createdAt: new Date(\"2022-11-25T09:50:52.301Z\"),\n modifiedAt: new Date(\"2024-06-16T22:58:18.488Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n recurringInterval: \"year\",\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2024-10-06T07:01:55.000Z\"),\n modifiedAt: new Date(\"2024-01-21T06:59:31.349Z\"),\n id: \"\",\n description: \"meanwhile amount accurate pleasing delicious book frenetically brr considering huzzah\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n note: \"\",\n },\n isTaxApplicable: false,\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/lost+found\",\n mimeType: \"\",\n size: 562154,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2024-08-06T03:20:53.935Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2023-09-07T09:54:32.715Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://rare-trash.info\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/etc/ppp\",\n mimeType: \"\",\n size: 66044,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2024-07-07T23:54:00.303Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2022-10-11T04:49:26.739Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://worse-ceramic.org\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/home\",\n mimeType: \"\",\n size: 75695,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2022-09-16T06:56:23.715Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2023-06-23T20:54:57.375Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://closed-seafood.info\",\n },\n ],\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2022-03-28T22:24:16.436Z\"),\n modifiedAt: new Date(\"2022-06-25T07:31:50.142Z\"),\n id: \"\",\n metadata: {\n \"key\": 471294,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {\n options: [\n {\n value: \"\",\n label: \"\",\n },\n ],\n },\n },\n order: 553735,\n required: false,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-04-27T03:42:46.919Z\"),\n modifiedAt: new Date(\"2022-07-10T15:18:31.478Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 892169,\n required: true,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-03-07T23:45:11.850Z\"),\n modifiedAt: new Date(\"2024-12-11T04:05:14.451Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {\n options: [\n {\n value: \"\",\n label: \"\",\n },\n ],\n },\n },\n order: 578881,\n required: false,\n },\n ],\n },\n price: {\n createdAt: new Date(\"2024-10-02T04:07:15.390Z\"),\n modifiedAt: new Date(\"2023-09-28T09:04:47.791Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n recurringInterval: \"month\",\n },\n discount: {\n duration: \"forever\",\n durationInMonths: 539267,\n type: \"percentage\",\n amount: 440126,\n currency: \"Liberian Dollar\",\n createdAt: new Date(\"2023-12-15T11:44:25.253Z\"),\n modifiedAt: new Date(\"2023-03-06T16:20:52.572Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n name: \"\",\n code: \"\",\n startsAt: new Date(\"2023-11-05T14:17:31.159Z\"),\n endsAt: new Date(\"2024-07-18T17:11:43.309Z\"),\n maxRedemptions: 542595,\n redemptionsCount: 673893,\n organizationId: \"\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" + "label": "Typescript (SDK)" + "source": "import { Polar } from \"@polar-sh/sdk\";\n\nconst polar = new Polar();\n\nasync function run() {\n const result = await polar.endpointsubscriptionUpdatedPost({\n data: {\n createdAt: new Date(\"2023-08-16T06:35:49.390Z\"),\n modifiedAt: new Date(\"2025-11-13T10:48:05.575Z\"),\n id: \"\",\n amount: 299644,\n currency: \"Baht\",\n recurringInterval: \"year\",\n status: \"trialing\",\n currentPeriodStart: new Date(\"2025-10-06T07:01:55.000Z\"),\n currentPeriodEnd: new Date(\"2025-01-20T06:59:31.349Z\"),\n cancelAtPeriodEnd: false,\n startedAt: new Date(\"2023-10-04T04:56:04.382Z\"),\n endedAt: new Date(\"2023-01-22T12:57:07.430Z\"),\n customerId: \"\",\n productId: \"\",\n priceId: \"\",\n discountId: \"\",\n checkoutId: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": 442859,\n \"key2\": 394013,\n },\n customer: {\n createdAt: new Date(\"2025-09-14T04:37:19.722Z\"),\n modifiedAt: new Date(\"2025-03-24T00:03:13.207Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": true,\n \"key2\": 392900,\n },\n email: \"Dominic.Toy27@yahoo.com\",\n emailVerified: false,\n name: \"\",\n billingAddress: {\n country: \"Sweden\",\n },\n taxId: [\n \"mx_rfc\",\n \"gb_vat\",\n \"\",\n ],\n organizationId: \"\",\n avatarUrl: \"https://worthy-place.biz\",\n },\n userId: \"\",\n user: {\n id: \"\",\n email: \"Domenico_Franecki46@hotmail.com\",\n publicName: \"\",\n },\n product: {\n createdAt: new Date(\"2024-06-11T14:55:33.574Z\"),\n modifiedAt: new Date(\"2023-06-02T07:14:13.619Z\"),\n id: \"\",\n name: \"\",\n description: \"intent that yowza\",\n isRecurring: true,\n isArchived: false,\n organizationId: \"\",\n metadata: {\n \"key\": \"\",\n \"key1\": true,\n },\n prices: [\n {\n createdAt: new Date(\"2023-11-25T09:50:52.301Z\"),\n modifiedAt: new Date(\"2025-06-16T22:58:18.488Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n recurringInterval: \"year\",\n },\n ],\n benefits: [\n {\n createdAt: new Date(\"2025-10-06T07:01:55.000Z\"),\n modifiedAt: new Date(\"2025-01-20T06:59:31.349Z\"),\n id: \"\",\n description: \"meanwhile amount accurate pleasing delicious book frenetically brr considering huzzah\",\n selectable: false,\n deletable: false,\n organizationId: \"\",\n properties: {\n note: \"\",\n },\n isTaxApplicable: false,\n },\n ],\n medias: [\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/lost+found\",\n mimeType: \"\",\n size: 562154,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2025-08-06T03:20:53.935Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2024-09-06T09:54:32.715Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://rare-trash.info\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/etc/ppp\",\n mimeType: \"\",\n size: 66044,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2025-07-07T23:54:00.303Z\"),\n version: \"\",\n isUploaded: true,\n createdAt: new Date(\"2023-10-11T04:49:26.739Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://worse-ceramic.org\",\n },\n {\n id: \"\",\n organizationId: \"\",\n name: \"\",\n path: \"/home\",\n mimeType: \"\",\n size: 75695,\n storageVersion: \"\",\n checksumEtag: \"\",\n checksumSha256Base64: \"\",\n checksumSha256Hex: \"\",\n lastModifiedAt: new Date(\"2023-09-16T06:56:23.715Z\"),\n version: \"\",\n isUploaded: false,\n createdAt: new Date(\"2024-06-22T20:54:57.375Z\"),\n sizeReadable: \"\",\n publicUrl: \"https://closed-seafood.info\",\n },\n ],\n attachedCustomFields: [\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2023-03-28T22:24:16.436Z\"),\n modifiedAt: new Date(\"2023-06-25T07:31:50.142Z\"),\n id: \"\",\n metadata: {\n \"key\": 471294,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {\n options: [\n {\n value: \"\",\n label: \"\",\n },\n ],\n },\n },\n order: 553735,\n required: false,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2024-04-26T03:42:46.919Z\"),\n modifiedAt: new Date(\"2023-07-10T15:18:31.478Z\"),\n id: \"\",\n metadata: {\n \"key\": false,\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {},\n },\n order: 892169,\n required: true,\n },\n {\n customFieldId: \"\",\n customField: {\n createdAt: new Date(\"2024-03-06T23:45:11.850Z\"),\n modifiedAt: new Date(\"2025-12-11T04:05:14.451Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n slug: \"\",\n name: \"\",\n organizationId: \"\",\n properties: {\n options: [\n {\n value: \"\",\n label: \"\",\n },\n ],\n },\n },\n order: 578881,\n required: false,\n },\n ],\n },\n price: {\n createdAt: new Date(\"2025-10-02T04:07:15.390Z\"),\n modifiedAt: new Date(\"2024-09-27T09:04:47.791Z\"),\n id: \"\",\n isArchived: false,\n productId: \"\",\n recurringInterval: \"month\",\n },\n discount: {\n duration: \"forever\",\n durationInMonths: 539267,\n type: \"percentage\",\n amount: 440126,\n currency: \"Liberian Dollar\",\n createdAt: new Date(\"2024-12-14T11:44:25.253Z\"),\n modifiedAt: new Date(\"2024-03-05T16:20:52.572Z\"),\n id: \"\",\n metadata: {\n \"key\": \"\",\n },\n name: \"\",\n code: \"\",\n startsAt: new Date(\"2024-11-04T14:17:31.159Z\"),\n endsAt: new Date(\"2025-07-18T17:11:43.309Z\"),\n maxRedemptions: 542595,\n redemptionsCount: 673893,\n organizationId: \"\",\n },\n },\n });\n\n // Handle the result\n console.log(result);\n}\n\nrun();" diff --git a/docs/models/components/advertisementcampaign.md b/docs/models/components/advertisementcampaign.md index 11dea330..da497895 100644 --- a/docs/models/components/advertisementcampaign.md +++ b/docs/models/components/advertisementcampaign.md @@ -6,13 +6,13 @@ import { AdvertisementCampaign } from "@polar-sh/sdk/models/components"; let value: AdvertisementCampaign = { - createdAt: new Date("2023-09-17T05:56:47.413Z"), - modifiedAt: new Date("2023-04-26T12:06:48.895Z"), + createdAt: new Date("2025-01-29T10:30:11.869Z"), + modifiedAt: new Date("2023-08-28T02:22:07.688Z"), id: "", - imageUrl: "https://yellow-peony.biz/", - imageUrlDark: "https://burly-replacement.info", + imageUrl: "https://discrete-guacamole.org/", + imageUrlDark: "https://friendly-bathrobe.info/", text: "", - linkUrl: "https://damp-advertisement.net/", + linkUrl: "https://snappy-cannon.com/", }; ``` diff --git a/docs/models/components/advertisementcampaignlistresource.md b/docs/models/components/advertisementcampaignlistresource.md index c3fb87a2..e72d3fa0 100644 --- a/docs/models/components/advertisementcampaignlistresource.md +++ b/docs/models/components/advertisementcampaignlistresource.md @@ -8,21 +8,21 @@ import { AdvertisementCampaignListResource } from "@polar-sh/sdk/models/componen let value: AdvertisementCampaignListResource = { items: [ { - createdAt: new Date("2024-11-20T21:08:23.770Z"), - modifiedAt: new Date("2023-07-29T08:38:01.905Z"), + createdAt: new Date("2024-09-26T20:47:30.377Z"), + modifiedAt: new Date("2024-02-10T05:09:54.223Z"), id: "", - imageUrl: "https://damp-pupil.name/", - imageUrlDark: "https://extra-large-daughter.info/", + imageUrl: "https://vain-pine.biz", + imageUrlDark: "https://innocent-precedent.info", text: "", - linkUrl: "https://forsaken-recommendation.name/", + linkUrl: "https://black-clavicle.biz", }, ], pagination: { - totalCount: 818596, - maxPage: 744825, + totalCount: 221000, + maxPage: 235427, }, dimensions: [ - 21277, + 152850, ], }; ``` diff --git a/docs/models/components/advertisementsortproperty.md b/docs/models/components/advertisementsortproperty.md index f7e291e5..6877cf58 100644 --- a/docs/models/components/advertisementsortproperty.md +++ b/docs/models/components/advertisementsortproperty.md @@ -5,7 +5,7 @@ ```typescript import { AdvertisementSortProperty } from "@polar-sh/sdk/models/components"; -let value: AdvertisementSortProperty = "-views"; +let value: AdvertisementSortProperty = "granted_at"; ``` ## Values diff --git a/docs/models/components/amounttype.md b/docs/models/components/amounttype.md deleted file mode 100644 index 5656440a..00000000 --- a/docs/models/components/amounttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# AmountType - -## Example Usage - -```typescript -import { AmountType } from "@polar-sh/sdk/models/components"; - -let value: AmountType = "fixed"; -``` - -## Values - -```typescript -"fixed" -``` \ No newline at end of file diff --git a/docs/models/components/attachedcustomfield.md b/docs/models/components/attachedcustomfield.md index d91cf930..c4f3b4fe 100644 --- a/docs/models/components/attachedcustomfield.md +++ b/docs/models/components/attachedcustomfield.md @@ -10,8 +10,8 @@ import { AttachedCustomField } from "@polar-sh/sdk/models/components"; let value: AttachedCustomField = { customFieldId: "", customField: { - createdAt: new Date("2024-02-06T18:51:30.654Z"), - modifiedAt: new Date("2022-12-26T04:21:26.793Z"), + createdAt: new Date("2025-02-05T18:51:30.654Z"), + modifiedAt: new Date("2023-12-26T04:21:26.793Z"), id: "", metadata: { "key": false, diff --git a/docs/models/components/authorizeorganization.md b/docs/models/components/authorizeorganization.md index 2682a34b..63c38338 100644 --- a/docs/models/components/authorizeorganization.md +++ b/docs/models/components/authorizeorganization.md @@ -8,7 +8,7 @@ import { AuthorizeOrganization } from "@polar-sh/sdk/models/components"; let value: AuthorizeOrganization = { id: "", slug: "", - avatarUrl: "https://blaring-loyalty.com/", + avatarUrl: "https://slight-kettledrum.info", }; ``` diff --git a/docs/models/components/authorizeresponseorganization.md b/docs/models/components/authorizeresponseorganization.md index eafcb040..d1fb1eb0 100644 --- a/docs/models/components/authorizeresponseorganization.md +++ b/docs/models/components/authorizeresponseorganization.md @@ -7,28 +7,28 @@ import { AuthorizeResponseOrganization } from "@polar-sh/sdk/models/components"; let value: AuthorizeResponseOrganization = { client: { - createdAt: new Date("2023-12-14T04:05:55.302Z"), - modifiedAt: new Date("2023-08-10T23:06:38.424Z"), + createdAt: new Date("2024-07-18T14:44:10.552Z"), + modifiedAt: new Date("2025-02-01T06:43:01.101Z"), clientId: "", clientName: "", - clientUri: "https://deficient-countess.name/", - logoUri: "https://ambitious-fowl.net/", - tosUri: "https://stable-possession.name", - policyUri: "https://dual-metabolite.name/", + clientUri: "https://concrete-meadow.org/", + logoUri: "https://little-elevation.net/", + tosUri: "https://decent-zen.net/", + policyUri: "https://stale-yin.biz", }, sub: { id: "", slug: "", - avatarUrl: "https://oblong-brace.name/", + avatarUrl: "https://grounded-rawhide.net", }, scopes: [ - "organizations:read", + "customer_portal:write", ], organizations: [ { id: "", slug: "", - avatarUrl: "https://circular-thunderbolt.name/", + avatarUrl: "https://acceptable-representation.name/", }, ], }; @@ -36,10 +36,10 @@ let value: AuthorizeResponseOrganization = { ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------ | -| `client` | [components.OAuth2ClientPublic](../../models/components/oauth2clientpublic.md) | :heavy_check_mark: | N/A | -| `subType` | [components.AuthorizeResponseOrganizationSubType](../../models/components/authorizeresponseorganizationsubtype.md) | :heavy_check_mark: | N/A | -| `sub` | [components.AuthorizeOrganization](../../models/components/authorizeorganization.md) | :heavy_check_mark: | N/A | -| `scopes` | [components.Scope](../../models/components/scope.md)[] | :heavy_check_mark: | N/A | -| `organizations` | [components.AuthorizeOrganization](../../models/components/authorizeorganization.md)[] | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| -------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------- | +| `client` | [components.OAuth2ClientPublic](../../models/components/oauth2clientpublic.md) | :heavy_check_mark: | N/A | +| `subType` | *string* | :heavy_check_mark: | N/A | +| `sub` | [components.AuthorizeOrganization](../../models/components/authorizeorganization.md) | :heavy_check_mark: | N/A | +| `scopes` | [components.Scope](../../models/components/scope.md)[] | :heavy_check_mark: | N/A | +| `organizations` | [components.AuthorizeOrganization](../../models/components/authorizeorganization.md)[] | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/authorizeresponseorganizationsubtype.md b/docs/models/components/authorizeresponseorganizationsubtype.md deleted file mode 100644 index ace551a4..00000000 --- a/docs/models/components/authorizeresponseorganizationsubtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# AuthorizeResponseOrganizationSubType - -## Example Usage - -```typescript -import { AuthorizeResponseOrganizationSubType } from "@polar-sh/sdk/models/components"; - -let value: AuthorizeResponseOrganizationSubType = "organization"; -``` - -## Values - -```typescript -"organization" -``` \ No newline at end of file diff --git a/docs/models/components/authorizeresponseuser.md b/docs/models/components/authorizeresponseuser.md index 0ba37fd4..3179b4ce 100644 --- a/docs/models/components/authorizeresponseuser.md +++ b/docs/models/components/authorizeresponseuser.md @@ -7,31 +7,31 @@ import { AuthorizeResponseUser } from "@polar-sh/sdk/models/components"; let value: AuthorizeResponseUser = { client: { - createdAt: new Date("2023-06-16T14:07:15.875Z"), - modifiedAt: new Date("2022-12-02T08:05:48.981Z"), + createdAt: new Date("2023-11-12T16:15:27.788Z"), + modifiedAt: new Date("2025-07-16T13:12:18.198Z"), clientId: "", clientName: "", - clientUri: "https://unfinished-casement.com/", - logoUri: "https://miserly-accountability.com/", - tosUri: "https://key-unibody.org", - policyUri: "https://humble-tool.name/", + clientUri: "https://ordinary-electronics.biz", + logoUri: "https://showy-going.name", + tosUri: "https://pushy-lox.com", + policyUri: "https://distant-opera.com/", }, sub: { id: "", - email: "Precious.Pacocha@yahoo.com", - avatarUrl: "https://low-tusk.com", + email: "Ford_Pouros@gmail.com", + avatarUrl: "https://dual-metabolite.name/", }, scopes: [ - "organizations:read", + "admin", ], }; ``` ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------- | -| `client` | [components.OAuth2ClientPublic](../../models/components/oauth2clientpublic.md) | :heavy_check_mark: | N/A | -| `subType` | [components.AuthorizeResponseUserSubType](../../models/components/authorizeresponseusersubtype.md) | :heavy_check_mark: | N/A | -| `sub` | [components.AuthorizeUser](../../models/components/authorizeuser.md) | :heavy_check_mark: | N/A | -| `scopes` | [components.Scope](../../models/components/scope.md)[] | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------------------------------------ | ------------------------------------------------------------------------------ | ------------------------------------------------------------------------------ | ------------------------------------------------------------------------------ | +| `client` | [components.OAuth2ClientPublic](../../models/components/oauth2clientpublic.md) | :heavy_check_mark: | N/A | +| `subType` | *string* | :heavy_check_mark: | N/A | +| `sub` | [components.AuthorizeUser](../../models/components/authorizeuser.md) | :heavy_check_mark: | N/A | +| `scopes` | [components.Scope](../../models/components/scope.md)[] | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/authorizeresponseusersubtype.md b/docs/models/components/authorizeresponseusersubtype.md deleted file mode 100644 index 7572a65c..00000000 --- a/docs/models/components/authorizeresponseusersubtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# AuthorizeResponseUserSubType - -## Example Usage - -```typescript -import { AuthorizeResponseUserSubType } from "@polar-sh/sdk/models/components"; - -let value: AuthorizeResponseUserSubType = "user"; -``` - -## Values - -```typescript -"user" -``` \ No newline at end of file diff --git a/docs/models/components/authorizeuser.md b/docs/models/components/authorizeuser.md index 925dbe7a..74da96ec 100644 --- a/docs/models/components/authorizeuser.md +++ b/docs/models/components/authorizeuser.md @@ -7,8 +7,8 @@ import { AuthorizeUser } from "@polar-sh/sdk/models/components"; let value: AuthorizeUser = { id: "", - email: "Darron.Pouros23@gmail.com", - avatarUrl: "https://which-fun.biz/", + email: "Kasey.Carter@gmail.com", + avatarUrl: "https://blaring-loyalty.com/", }; ``` diff --git a/docs/models/components/benefit.md b/docs/models/components/benefit.md index 146f6d6c..0557bc50 100644 --- a/docs/models/components/benefit.md +++ b/docs/models/components/benefit.md @@ -7,8 +7,8 @@ ```typescript const value: components.BenefitAds = { - createdAt: new Date("2024-01-08T04:47:03.376Z"), - modifiedAt: new Date("2024-06-27T00:21:02.962Z"), + createdAt: new Date("2025-01-07T04:47:03.376Z"), + modifiedAt: new Date("2025-06-27T00:21:02.962Z"), id: "", description: "psst before anguished emergent upward rival inasmuch uh-huh the", @@ -23,8 +23,8 @@ const value: components.BenefitAds = { ```typescript const value: components.BenefitCustom = { - createdAt: new Date("2022-04-28T14:26:46.798Z"), - modifiedAt: new Date("2022-01-10T22:18:51.218Z"), + createdAt: new Date("2023-04-28T14:26:46.798Z"), + modifiedAt: new Date("2023-01-10T22:18:51.218Z"), id: "", description: "besides even forenenst lazily", selectable: false, @@ -41,8 +41,8 @@ const value: components.BenefitCustom = { ```typescript const value: components.BenefitDiscord = { - createdAt: new Date("2022-12-18T12:57:11.461Z"), - modifiedAt: new Date("2022-03-23T05:46:16.749Z"), + createdAt: new Date("2023-12-18T12:57:11.461Z"), + modifiedAt: new Date("2023-03-23T05:46:16.749Z"), id: "", description: "inwardly whereas officially annex superficial fluctuate candid gigantic boohoo", @@ -61,8 +61,8 @@ const value: components.BenefitDiscord = { ```typescript const value: components.BenefitGitHubRepository = { - createdAt: new Date("2022-08-10T08:31:29.759Z"), - modifiedAt: new Date("2024-01-31T07:41:55.322Z"), + createdAt: new Date("2023-08-10T08:31:29.759Z"), + modifiedAt: new Date("2025-01-30T07:41:55.322Z"), id: "", description: "below certification drat corral snowplow unimpressively chubby rout unhappy", @@ -81,8 +81,8 @@ const value: components.BenefitGitHubRepository = { ```typescript const value: components.BenefitDownloadables = { - createdAt: new Date("2022-03-16T21:31:12.259Z"), - modifiedAt: new Date("2023-07-03T21:47:04.955Z"), + createdAt: new Date("2023-03-16T21:31:12.259Z"), + modifiedAt: new Date("2024-07-02T21:47:04.955Z"), id: "", description: "celsius along upward than acidly", selectable: false, @@ -103,8 +103,8 @@ const value: components.BenefitDownloadables = { ```typescript const value: components.BenefitLicenseKeys = { - createdAt: new Date("2023-08-07T04:09:31.431Z"), - modifiedAt: new Date("2024-10-30T06:52:10.521Z"), + createdAt: new Date("2024-08-06T04:09:31.431Z"), + modifiedAt: new Date("2025-10-30T06:52:10.521Z"), id: "", description: "um mid bloom redound grounded about mature minority", selectable: false, diff --git a/docs/models/components/benefitads.md b/docs/models/components/benefitads.md index fc5d4c45..f53fc584 100644 --- a/docs/models/components/benefitads.md +++ b/docs/models/components/benefitads.md @@ -10,8 +10,8 @@ Use it so your backers can display ads on your README, website, etc. import { BenefitAds } from "@polar-sh/sdk/models/components"; let value: BenefitAds = { - createdAt: new Date("2022-10-21T20:20:45.975Z"), - modifiedAt: new Date("2022-05-25T05:31:24.787Z"), + createdAt: new Date("2023-10-21T20:20:45.975Z"), + modifiedAt: new Date("2023-05-25T05:31:24.787Z"), id: "", description: "appropriate bar successfully", selectable: false, @@ -28,7 +28,7 @@ let value: BenefitAds = { | `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the benefit. | -| `type` | [components.BenefitAdsType](../../models/components/benefitadstype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. | | `selectable` | *boolean* | :heavy_check_mark: | Whether the benefit is selectable when creating a product. | | `deletable` | *boolean* | :heavy_check_mark: | Whether the benefit is deletable. | diff --git a/docs/models/components/benefitadscreate.md b/docs/models/components/benefitadscreate.md index 32073815..611b0c61 100644 --- a/docs/models/components/benefitadscreate.md +++ b/docs/models/components/benefitadscreate.md @@ -6,7 +6,7 @@ import { BenefitAdsCreate } from "@polar-sh/sdk/models/components"; let value: BenefitAdsCreate = { - description: "those naturally if solemnly underneath french now corny", + description: "amid far-off beloved decent whoa lively publicity briskly oof", properties: {}, }; ``` @@ -15,7 +15,7 @@ let value: BenefitAdsCreate = { | Field | Type | Required | Description | | ------------------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------------------- | ------------------------------------------------------------------------------------------------- | -| `type` | [components.BenefitAdsCreateType](../../models/components/benefitadscreatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. Will be displayed on products having this benefit. | | `organizationId` | *string* | :heavy_minus_sign: | The ID of the organization owning the benefit. **Required unless you use an organization token.** | | `properties` | [components.BenefitAdsProperties](../../models/components/benefitadsproperties.md) | :heavy_check_mark: | Properties for a benefit of type `ads`. | \ No newline at end of file diff --git a/docs/models/components/benefitadscreatetype.md b/docs/models/components/benefitadscreatetype.md deleted file mode 100644 index d862f742..00000000 --- a/docs/models/components/benefitadscreatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitAdsCreateType - -## Example Usage - -```typescript -import { BenefitAdsCreateType } from "@polar-sh/sdk/models/components"; - -let value: BenefitAdsCreateType = "ads"; -``` - -## Values - -```typescript -"ads" -``` \ No newline at end of file diff --git a/docs/models/components/benefitadssubscriber.md b/docs/models/components/benefitadssubscriber.md index 0f3ab4ce..8ef08c09 100644 --- a/docs/models/components/benefitadssubscriber.md +++ b/docs/models/components/benefitadssubscriber.md @@ -6,29 +6,29 @@ import { BenefitAdsSubscriber } from "@polar-sh/sdk/models/components"; let value: BenefitAdsSubscriber = { - createdAt: new Date("2022-06-29T12:28:45.551Z"), - modifiedAt: new Date("2024-08-30T16:46:15.289Z"), + createdAt: new Date("2024-09-05T05:04:08.077Z"), + modifiedAt: new Date("2023-04-25T11:53:31.235Z"), id: "", - description: "embed stir-fry mmm infatuated until gosh", + description: "helpful gee because", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2024-04-13T22:58:10.181Z"), - modifiedAt: new Date("2023-02-17T17:56:53.516Z"), + createdAt: new Date("2024-01-05T09:56:17.090Z"), + modifiedAt: new Date("2023-09-30T17:15:44.718Z"), id: "", name: "", slug: "", - avatarUrl: "https://tight-flight.com/", + avatarUrl: "https://babyish-jazz.name", bio: "", - company: "Bauch Group", + company: "Waelchi, Adams and McClure", blog: "", location: "", - email: "Jessy.Reilly30@gmail.com", + email: "Kailyn92@yahoo.com", twitterUsername: "", - pledgeMinimumAmount: 747290, + pledgeMinimumAmount: 755343, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 879775, + defaultUpfrontSplitToContributors: 524457, profileSettings: {}, featureSettings: {}, }, @@ -43,7 +43,7 @@ let value: BenefitAdsSubscriber = { | `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the benefit. | -| `type` | [components.BenefitAdsSubscriberType](../../models/components/benefitadssubscribertype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. | | `selectable` | *boolean* | :heavy_check_mark: | Whether the benefit is selectable when creating a product. | | `deletable` | *boolean* | :heavy_check_mark: | Whether the benefit is deletable. | diff --git a/docs/models/components/benefitadssubscribertype.md b/docs/models/components/benefitadssubscribertype.md deleted file mode 100644 index 5269de2a..00000000 --- a/docs/models/components/benefitadssubscribertype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitAdsSubscriberType - -## Example Usage - -```typescript -import { BenefitAdsSubscriberType } from "@polar-sh/sdk/models/components"; - -let value: BenefitAdsSubscriberType = "ads"; -``` - -## Values - -```typescript -"ads" -``` \ No newline at end of file diff --git a/docs/models/components/benefitadstype.md b/docs/models/components/benefitadstype.md deleted file mode 100644 index 611cbe8f..00000000 --- a/docs/models/components/benefitadstype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitAdsType - -## Example Usage - -```typescript -import { BenefitAdsType } from "@polar-sh/sdk/models/components"; - -let value: BenefitAdsType = "ads"; -``` - -## Values - -```typescript -"ads" -``` \ No newline at end of file diff --git a/docs/models/components/benefitadsupdate.md b/docs/models/components/benefitadsupdate.md index 12fabd23..bae453be 100644 --- a/docs/models/components/benefitadsupdate.md +++ b/docs/models/components/benefitadsupdate.md @@ -13,5 +13,5 @@ let value: BenefitAdsUpdate = {}; | Field | Type | Required | Description | | ---------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------- | | `description` | *string* | :heavy_minus_sign: | The description of the benefit. Will be displayed on products having this benefit. | -| `type` | [components.BenefitAdsUpdateType](../../models/components/benefitadsupdatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `properties` | [components.BenefitAdsProperties](../../models/components/benefitadsproperties.md) | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/benefitadsupdatetype.md b/docs/models/components/benefitadsupdatetype.md deleted file mode 100644 index 88aa990d..00000000 --- a/docs/models/components/benefitadsupdatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitAdsUpdateType - -## Example Usage - -```typescript -import { BenefitAdsUpdateType } from "@polar-sh/sdk/models/components"; - -let value: BenefitAdsUpdateType = "ads"; -``` - -## Values - -```typescript -"ads" -``` \ No newline at end of file diff --git a/docs/models/components/benefitbase.md b/docs/models/components/benefitbase.md index 73a8d1d6..2164b165 100644 --- a/docs/models/components/benefitbase.md +++ b/docs/models/components/benefitbase.md @@ -6,8 +6,8 @@ import { BenefitBase } from "@polar-sh/sdk/models/components"; let value: BenefitBase = { - createdAt: new Date("2024-02-05T06:43:40.658Z"), - modifiedAt: new Date("2023-01-03T16:56:37.878Z"), + createdAt: new Date("2025-02-04T06:43:40.658Z"), + modifiedAt: new Date("2024-01-03T16:56:37.878Z"), id: "", type: "custom", description: "card joshingly overload", diff --git a/docs/models/components/benefitcreate.md b/docs/models/components/benefitcreate.md index 7641cdcc..3a613c4e 100644 --- a/docs/models/components/benefitcreate.md +++ b/docs/models/components/benefitcreate.md @@ -7,7 +7,8 @@ ```typescript const value: components.BenefitAdsCreate = { - description: "search controvert mozzarella", + description: + "controvert mozzarella solemnly sinful meanwhile skyline up heating avaricious", properties: {}, }; ``` @@ -16,7 +17,8 @@ const value: components.BenefitAdsCreate = { ```typescript const value: components.BenefitCustomCreate = { - description: "fooey actual finally provided jaywalk kissingly worriedly", + description: + "hunt retool space informal minus dark while beyond untimely whenever", properties: {}, }; ``` @@ -25,7 +27,8 @@ const value: components.BenefitCustomCreate = { ```typescript const value: components.BenefitDiscordCreate = { - description: "yippee spring ugh factorize well-lit weary fearless out", + description: + "whose synthesise seriously nor joyously through nor cheerfully neatly juvenile", properties: { guildToken: "", roleId: "", @@ -37,7 +40,7 @@ const value: components.BenefitDiscordCreate = { ```typescript const value: components.BenefitDownloadablesCreate = { - description: "naturally key whoa partial ick ack", + description: "a yet coolly but pick creature with", properties: { files: [ "", @@ -50,11 +53,11 @@ const value: components.BenefitDownloadablesCreate = { ```typescript const value: components.BenefitGitHubRepositoryCreate = { - description: "once charlatan hm except though posh pleasure woot yuck", + description: "scholarship what shabby bloom blah along eek override absent", properties: { repositoryOwner: "polarsource", repositoryName: "private_repo", - permission: "triage", + permission: "maintain", }, }; ``` @@ -63,8 +66,7 @@ const value: components.BenefitGitHubRepositoryCreate = { ```typescript const value: components.BenefitLicenseKeysCreate = { - description: - "gee barring drat frankly accomplished graffiti strictly unnaturally", + description: "once till how gadzooks birth pointed modulo throughout", properties: {}, }; ``` diff --git a/docs/models/components/benefitcustom.md b/docs/models/components/benefitcustom.md index 87542a52..2e75197f 100644 --- a/docs/models/components/benefitcustom.md +++ b/docs/models/components/benefitcustom.md @@ -10,8 +10,8 @@ Use it to grant any kind of benefit that doesn't fit in the other types. import { BenefitCustom } from "@polar-sh/sdk/models/components"; let value: BenefitCustom = { - createdAt: new Date("2024-06-01T10:04:24.136Z"), - modifiedAt: new Date("2024-04-23T02:16:34.389Z"), + createdAt: new Date("2025-06-01T10:04:24.136Z"), + modifiedAt: new Date("2025-04-23T02:16:34.389Z"), id: "", description: "descent and provided mash out throughout with", selectable: false, @@ -31,7 +31,7 @@ let value: BenefitCustom = { | `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the benefit. | -| `type` | [components.BenefitCustomType](../../models/components/benefitcustomtype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. | | `selectable` | *boolean* | :heavy_check_mark: | Whether the benefit is selectable when creating a product. | | `deletable` | *boolean* | :heavy_check_mark: | Whether the benefit is deletable. | diff --git a/docs/models/components/benefitcustomcreate.md b/docs/models/components/benefitcustomcreate.md index 9955ad36..7dfbdde7 100644 --- a/docs/models/components/benefitcustomcreate.md +++ b/docs/models/components/benefitcustomcreate.md @@ -8,7 +8,7 @@ Schema to create a benefit of type `custom`. import { BenefitCustomCreate } from "@polar-sh/sdk/models/components"; let value: BenefitCustomCreate = { - description: "yum deceivingly colligate", + description: "jubilantly hm scram fortunately daily", properties: {}, }; ``` @@ -17,7 +17,7 @@ let value: BenefitCustomCreate = { | Field | Type | Required | Description | | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | -| `type` | [components.BenefitCustomCreateType](../../models/components/benefitcustomcreatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. Will be displayed on products having this benefit. | | `organizationId` | *string* | :heavy_minus_sign: | The ID of the organization owning the benefit. **Required unless you use an organization token.** | | `properties` | [components.BenefitCustomCreateProperties](../../models/components/benefitcustomcreateproperties.md) | :heavy_check_mark: | Properties for creating a benefit of type `custom`. | \ No newline at end of file diff --git a/docs/models/components/benefitcustomcreatetype.md b/docs/models/components/benefitcustomcreatetype.md deleted file mode 100644 index 2cb579ce..00000000 --- a/docs/models/components/benefitcustomcreatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitCustomCreateType - -## Example Usage - -```typescript -import { BenefitCustomCreateType } from "@polar-sh/sdk/models/components"; - -let value: BenefitCustomCreateType = "custom"; -``` - -## Values - -```typescript -"custom" -``` \ No newline at end of file diff --git a/docs/models/components/benefitcustomsubscriber.md b/docs/models/components/benefitcustomsubscriber.md index 233dbb0d..dcd67cf8 100644 --- a/docs/models/components/benefitcustomsubscriber.md +++ b/docs/models/components/benefitcustomsubscriber.md @@ -6,29 +6,29 @@ import { BenefitCustomSubscriber } from "@polar-sh/sdk/models/components"; let value: BenefitCustomSubscriber = { - createdAt: new Date("2022-07-06T20:36:46.094Z"), - modifiedAt: new Date("2022-12-20T03:37:12.994Z"), + createdAt: new Date("2025-07-22T10:55:03.530Z"), + modifiedAt: new Date("2025-10-03T13:31:02.987Z"), id: "", - description: "republican beautifully barring", + description: "stunt emotional guilt wheel mmm", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2023-02-15T00:23:15.198Z"), - modifiedAt: new Date("2023-09-24T14:39:14.681Z"), + createdAt: new Date("2023-04-16T20:46:36.695Z"), + modifiedAt: new Date("2024-08-10T20:52:01.499Z"), id: "", name: "", slug: "", - avatarUrl: "https://scientific-cornet.org/", + avatarUrl: "https://unlawful-hydrant.name", bio: "", - company: "Jerde - Fahey", + company: "Leannon and Sons", blog: "", location: "", - email: "Gaston_Sporer47@yahoo.com", + email: "Taya.Stroman@hotmail.com", twitterUsername: "", - pledgeMinimumAmount: 872293, + pledgeMinimumAmount: 94273, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 419384, + defaultUpfrontSplitToContributors: 499308, profileSettings: {}, featureSettings: {}, }, @@ -45,7 +45,7 @@ let value: BenefitCustomSubscriber = { | `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the benefit. | -| `type` | [components.BenefitCustomSubscriberType](../../models/components/benefitcustomsubscribertype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. | | `selectable` | *boolean* | :heavy_check_mark: | Whether the benefit is selectable when creating a product. | | `deletable` | *boolean* | :heavy_check_mark: | Whether the benefit is deletable. | diff --git a/docs/models/components/benefitcustomsubscribertype.md b/docs/models/components/benefitcustomsubscribertype.md deleted file mode 100644 index b096a22f..00000000 --- a/docs/models/components/benefitcustomsubscribertype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitCustomSubscriberType - -## Example Usage - -```typescript -import { BenefitCustomSubscriberType } from "@polar-sh/sdk/models/components"; - -let value: BenefitCustomSubscriberType = "custom"; -``` - -## Values - -```typescript -"custom" -``` \ No newline at end of file diff --git a/docs/models/components/benefitcustomtype.md b/docs/models/components/benefitcustomtype.md deleted file mode 100644 index f2da1e66..00000000 --- a/docs/models/components/benefitcustomtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitCustomType - -## Example Usage - -```typescript -import { BenefitCustomType } from "@polar-sh/sdk/models/components"; - -let value: BenefitCustomType = "custom"; -``` - -## Values - -```typescript -"custom" -``` \ No newline at end of file diff --git a/docs/models/components/benefitcustomupdate.md b/docs/models/components/benefitcustomupdate.md index 6373ca40..c37b6108 100644 --- a/docs/models/components/benefitcustomupdate.md +++ b/docs/models/components/benefitcustomupdate.md @@ -13,5 +13,5 @@ let value: BenefitCustomUpdate = {}; | Field | Type | Required | Description | | ---------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------- | | `description` | *string* | :heavy_minus_sign: | The description of the benefit. Will be displayed on products having this benefit. | -| `type` | [components.BenefitCustomUpdateType](../../models/components/benefitcustomupdatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `properties` | [components.BenefitCustomProperties](../../models/components/benefitcustomproperties.md) | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/benefitcustomupdatetype.md b/docs/models/components/benefitcustomupdatetype.md deleted file mode 100644 index 59955416..00000000 --- a/docs/models/components/benefitcustomupdatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitCustomUpdateType - -## Example Usage - -```typescript -import { BenefitCustomUpdateType } from "@polar-sh/sdk/models/components"; - -let value: BenefitCustomUpdateType = "custom"; -``` - -## Values - -```typescript -"custom" -``` \ No newline at end of file diff --git a/docs/models/components/benefitdiscord.md b/docs/models/components/benefitdiscord.md index 4851d503..503d6b2b 100644 --- a/docs/models/components/benefitdiscord.md +++ b/docs/models/components/benefitdiscord.md @@ -10,8 +10,8 @@ Use it to automatically invite your backers to a Discord server. import { BenefitDiscord } from "@polar-sh/sdk/models/components"; let value: BenefitDiscord = { - createdAt: new Date("2022-11-20T15:45:49.704Z"), - modifiedAt: new Date("2024-02-13T00:23:21.664Z"), + createdAt: new Date("2023-11-20T15:45:49.704Z"), + modifiedAt: new Date("2025-02-12T00:23:21.664Z"), id: "", description: "monasticism ugh and slide thongs", selectable: false, @@ -32,7 +32,7 @@ let value: BenefitDiscord = { | `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the benefit. | -| `type` | [components.BenefitDiscordType](../../models/components/benefitdiscordtype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. | | `selectable` | *boolean* | :heavy_check_mark: | Whether the benefit is selectable when creating a product. | | `deletable` | *boolean* | :heavy_check_mark: | Whether the benefit is deletable. | diff --git a/docs/models/components/benefitdiscordcreate.md b/docs/models/components/benefitdiscordcreate.md index 871deb1e..2b71f611 100644 --- a/docs/models/components/benefitdiscordcreate.md +++ b/docs/models/components/benefitdiscordcreate.md @@ -6,7 +6,7 @@ import { BenefitDiscordCreate } from "@polar-sh/sdk/models/components"; let value: BenefitDiscordCreate = { - description: "gaseous so tame inside meh whenever after where beneath", + description: "who fat iridescence yahoo deer weary out ape solemnly around", properties: { guildToken: "", roleId: "", @@ -18,7 +18,7 @@ let value: BenefitDiscordCreate = { | Field | Type | Required | Description | | ------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------ | -| `type` | [components.BenefitDiscordCreateType](../../models/components/benefitdiscordcreatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. Will be displayed on products having this benefit. | | `organizationId` | *string* | :heavy_minus_sign: | The ID of the organization owning the benefit. **Required unless you use an organization token.** | | `properties` | [components.BenefitDiscordCreateProperties](../../models/components/benefitdiscordcreateproperties.md) | :heavy_check_mark: | Properties to create a benefit of type `discord`. | \ No newline at end of file diff --git a/docs/models/components/benefitdiscordcreatetype.md b/docs/models/components/benefitdiscordcreatetype.md deleted file mode 100644 index db941fd5..00000000 --- a/docs/models/components/benefitdiscordcreatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitDiscordCreateType - -## Example Usage - -```typescript -import { BenefitDiscordCreateType } from "@polar-sh/sdk/models/components"; - -let value: BenefitDiscordCreateType = "discord"; -``` - -## Values - -```typescript -"discord" -``` \ No newline at end of file diff --git a/docs/models/components/benefitdiscordsubscriber.md b/docs/models/components/benefitdiscordsubscriber.md index f9c2ecfc..bb41075a 100644 --- a/docs/models/components/benefitdiscordsubscriber.md +++ b/docs/models/components/benefitdiscordsubscriber.md @@ -6,29 +6,30 @@ import { BenefitDiscordSubscriber } from "@polar-sh/sdk/models/components"; let value: BenefitDiscordSubscriber = { - createdAt: new Date("2023-09-17T22:29:19.829Z"), - modifiedAt: new Date("2023-12-05T14:41:27.048Z"), + createdAt: new Date("2024-04-09T18:38:17.654Z"), + modifiedAt: new Date("2023-09-01T12:05:57.701Z"), id: "", - description: "blah citizen sprinkles across against", + description: + "ick stupendous inasmuch transparency oddly yahoo before needily", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2023-09-16T07:37:16.955Z"), - modifiedAt: new Date("2024-05-17T05:06:11.950Z"), + createdAt: new Date("2024-02-29T20:44:05.346Z"), + modifiedAt: new Date("2023-04-17T06:23:06.840Z"), id: "", name: "", slug: "", - avatarUrl: "https://puny-ravioli.net/", + avatarUrl: "https://impractical-academics.com/", bio: "", - company: "Nitzsche - Crona", + company: "Runolfsson - Towne", blog: "", location: "", - email: "Titus3@gmail.com", + email: "Addie.Grant10@hotmail.com", twitterUsername: "", - pledgeMinimumAmount: 857502, + pledgeMinimumAmount: 550268, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 457552, + defaultUpfrontSplitToContributors: 306875, profileSettings: {}, featureSettings: {}, }, @@ -45,7 +46,7 @@ let value: BenefitDiscordSubscriber = { | `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the benefit. | -| `type` | [components.BenefitDiscordSubscriberType](../../models/components/benefitdiscordsubscribertype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. | | `selectable` | *boolean* | :heavy_check_mark: | Whether the benefit is selectable when creating a product. | | `deletable` | *boolean* | :heavy_check_mark: | Whether the benefit is deletable. | diff --git a/docs/models/components/benefitdiscordsubscribertype.md b/docs/models/components/benefitdiscordsubscribertype.md deleted file mode 100644 index 0940d058..00000000 --- a/docs/models/components/benefitdiscordsubscribertype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitDiscordSubscriberType - -## Example Usage - -```typescript -import { BenefitDiscordSubscriberType } from "@polar-sh/sdk/models/components"; - -let value: BenefitDiscordSubscriberType = "discord"; -``` - -## Values - -```typescript -"discord" -``` \ No newline at end of file diff --git a/docs/models/components/benefitdiscordtype.md b/docs/models/components/benefitdiscordtype.md deleted file mode 100644 index 3fa9e244..00000000 --- a/docs/models/components/benefitdiscordtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitDiscordType - -## Example Usage - -```typescript -import { BenefitDiscordType } from "@polar-sh/sdk/models/components"; - -let value: BenefitDiscordType = "discord"; -``` - -## Values - -```typescript -"discord" -``` \ No newline at end of file diff --git a/docs/models/components/benefitdiscordupdate.md b/docs/models/components/benefitdiscordupdate.md index 7d1bd1ca..721347e9 100644 --- a/docs/models/components/benefitdiscordupdate.md +++ b/docs/models/components/benefitdiscordupdate.md @@ -13,5 +13,5 @@ let value: BenefitDiscordUpdate = {}; | Field | Type | Required | Description | | ------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------ | | `description` | *string* | :heavy_minus_sign: | The description of the benefit. Will be displayed on products having this benefit. | -| `type` | [components.BenefitDiscordUpdateType](../../models/components/benefitdiscordupdatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `properties` | [components.BenefitDiscordCreateProperties](../../models/components/benefitdiscordcreateproperties.md) | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/benefitdiscordupdatetype.md b/docs/models/components/benefitdiscordupdatetype.md deleted file mode 100644 index 854f3179..00000000 --- a/docs/models/components/benefitdiscordupdatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitDiscordUpdateType - -## Example Usage - -```typescript -import { BenefitDiscordUpdateType } from "@polar-sh/sdk/models/components"; - -let value: BenefitDiscordUpdateType = "discord"; -``` - -## Values - -```typescript -"discord" -``` \ No newline at end of file diff --git a/docs/models/components/benefitdownloadables.md b/docs/models/components/benefitdownloadables.md index d2a5d709..f8e6299c 100644 --- a/docs/models/components/benefitdownloadables.md +++ b/docs/models/components/benefitdownloadables.md @@ -6,8 +6,8 @@ import { BenefitDownloadables } from "@polar-sh/sdk/models/components"; let value: BenefitDownloadables = { - createdAt: new Date("2024-04-09T14:25:36.451Z"), - modifiedAt: new Date("2023-01-08T06:10:49.913Z"), + createdAt: new Date("2025-04-09T14:25:36.451Z"), + modifiedAt: new Date("2024-01-08T06:10:49.913Z"), id: "", description: "pleasing foolishly why beside commonly intently prime hm", selectable: false, @@ -31,7 +31,7 @@ let value: BenefitDownloadables = { | `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the benefit. | -| `type` | [components.BenefitDownloadablesType](../../models/components/benefitdownloadablestype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. | | `selectable` | *boolean* | :heavy_check_mark: | Whether the benefit is selectable when creating a product. | | `deletable` | *boolean* | :heavy_check_mark: | Whether the benefit is deletable. | diff --git a/docs/models/components/benefitdownloadablescreate.md b/docs/models/components/benefitdownloadablescreate.md index e6204eb8..aac28db9 100644 --- a/docs/models/components/benefitdownloadablescreate.md +++ b/docs/models/components/benefitdownloadablescreate.md @@ -6,7 +6,8 @@ import { BenefitDownloadablesCreate } from "@polar-sh/sdk/models/components"; let value: BenefitDownloadablesCreate = { - description: "nor heating weary whereas", + description: + "ick untimely suddenly incline meander than past yahoo neatly yet", properties: { files: [ "", @@ -19,7 +20,7 @@ let value: BenefitDownloadablesCreate = { | Field | Type | Required | Description | | ------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------ | -| `type` | [components.BenefitDownloadablesCreateType](../../models/components/benefitdownloadablescreatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. Will be displayed on products having this benefit. | | `organizationId` | *string* | :heavy_minus_sign: | The ID of the organization owning the benefit. **Required unless you use an organization token.** | | `properties` | [components.BenefitDownloadablesCreateProperties](../../models/components/benefitdownloadablescreateproperties.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/benefitdownloadablescreatetype.md b/docs/models/components/benefitdownloadablescreatetype.md deleted file mode 100644 index 830afe1b..00000000 --- a/docs/models/components/benefitdownloadablescreatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitDownloadablesCreateType - -## Example Usage - -```typescript -import { BenefitDownloadablesCreateType } from "@polar-sh/sdk/models/components"; - -let value: BenefitDownloadablesCreateType = "downloadables"; -``` - -## Values - -```typescript -"downloadables" -``` \ No newline at end of file diff --git a/docs/models/components/benefitdownloadablessubscriber.md b/docs/models/components/benefitdownloadablessubscriber.md index 116fdc9f..cc9593aa 100644 --- a/docs/models/components/benefitdownloadablessubscriber.md +++ b/docs/models/components/benefitdownloadablessubscriber.md @@ -6,29 +6,29 @@ import { BenefitDownloadablesSubscriber } from "@polar-sh/sdk/models/components"; let value: BenefitDownloadablesSubscriber = { - createdAt: new Date("2023-01-30T10:46:01.325Z"), - modifiedAt: new Date("2024-10-13T02:43:24.463Z"), + createdAt: new Date("2024-04-11T15:10:30.195Z"), + modifiedAt: new Date("2024-04-26T00:40:26.962Z"), id: "", - description: "for patroller oof yahoo", + description: "ick attest huff quixotic oh giant even equal", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2022-04-17T06:23:06.840Z"), - modifiedAt: new Date("2022-05-13T01:49:45.783Z"), + createdAt: new Date("2025-03-30T00:41:56.529Z"), + modifiedAt: new Date("2025-08-22T05:35:25.241Z"), id: "", name: "", slug: "", - avatarUrl: "https://acclaimed-airmail.com/", + avatarUrl: "https://noxious-secrecy.org/", bio: "", - company: "Towne, Turner and Adams", + company: "Gerlach, Bins and Ebert", blog: "", location: "", - email: "Edison.Braun55@yahoo.com", + email: "Katharina.Bins@yahoo.com", twitterUsername: "", - pledgeMinimumAmount: 166277, + pledgeMinimumAmount: 245870, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 145476, + defaultUpfrontSplitToContributors: 707050, profileSettings: {}, featureSettings: {}, }, @@ -47,7 +47,7 @@ let value: BenefitDownloadablesSubscriber = { | `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the benefit. | -| `type` | [components.BenefitDownloadablesSubscriberType](../../models/components/benefitdownloadablessubscribertype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. | | `selectable` | *boolean* | :heavy_check_mark: | Whether the benefit is selectable when creating a product. | | `deletable` | *boolean* | :heavy_check_mark: | Whether the benefit is deletable. | diff --git a/docs/models/components/benefitdownloadablessubscribertype.md b/docs/models/components/benefitdownloadablessubscribertype.md deleted file mode 100644 index 48c35442..00000000 --- a/docs/models/components/benefitdownloadablessubscribertype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitDownloadablesSubscriberType - -## Example Usage - -```typescript -import { BenefitDownloadablesSubscriberType } from "@polar-sh/sdk/models/components"; - -let value: BenefitDownloadablesSubscriberType = "downloadables"; -``` - -## Values - -```typescript -"downloadables" -``` \ No newline at end of file diff --git a/docs/models/components/benefitdownloadablestype.md b/docs/models/components/benefitdownloadablestype.md deleted file mode 100644 index 2029832a..00000000 --- a/docs/models/components/benefitdownloadablestype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitDownloadablesType - -## Example Usage - -```typescript -import { BenefitDownloadablesType } from "@polar-sh/sdk/models/components"; - -let value: BenefitDownloadablesType = "downloadables"; -``` - -## Values - -```typescript -"downloadables" -``` \ No newline at end of file diff --git a/docs/models/components/benefitdownloadablesupdate.md b/docs/models/components/benefitdownloadablesupdate.md index f34057ca..aa66a1fc 100644 --- a/docs/models/components/benefitdownloadablesupdate.md +++ b/docs/models/components/benefitdownloadablesupdate.md @@ -13,5 +13,5 @@ let value: BenefitDownloadablesUpdate = {}; | Field | Type | Required | Description | | ------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------ | | `description` | *string* | :heavy_minus_sign: | The description of the benefit. Will be displayed on products having this benefit. | -| `type` | [components.BenefitDownloadablesUpdateType](../../models/components/benefitdownloadablesupdatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `properties` | [components.BenefitDownloadablesCreateProperties](../../models/components/benefitdownloadablescreateproperties.md) | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/benefitdownloadablesupdatetype.md b/docs/models/components/benefitdownloadablesupdatetype.md deleted file mode 100644 index 835edd0a..00000000 --- a/docs/models/components/benefitdownloadablesupdatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitDownloadablesUpdateType - -## Example Usage - -```typescript -import { BenefitDownloadablesUpdateType } from "@polar-sh/sdk/models/components"; - -let value: BenefitDownloadablesUpdateType = "downloadables"; -``` - -## Values - -```typescript -"downloadables" -``` \ No newline at end of file diff --git a/docs/models/components/benefitgithubrepository.md b/docs/models/components/benefitgithubrepository.md index 399f0905..c8c9ab85 100644 --- a/docs/models/components/benefitgithubrepository.md +++ b/docs/models/components/benefitgithubrepository.md @@ -10,8 +10,8 @@ Use it to automatically invite your backers to a private GitHub repository. import { BenefitGitHubRepository } from "@polar-sh/sdk/models/components"; let value: BenefitGitHubRepository = { - createdAt: new Date("2023-03-25T06:54:06.627Z"), - modifiedAt: new Date("2022-12-31T03:28:31.793Z"), + createdAt: new Date("2024-03-24T06:54:06.627Z"), + modifiedAt: new Date("2023-12-31T03:28:31.793Z"), id: "", description: "delight provided stay appertain so quintessential until enroll upsell pish", @@ -33,7 +33,7 @@ let value: BenefitGitHubRepository = { | `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the benefit. | -| `type` | [components.BenefitGitHubRepositoryType](../../models/components/benefitgithubrepositorytype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. | | `selectable` | *boolean* | :heavy_check_mark: | Whether the benefit is selectable when creating a product. | | `deletable` | *boolean* | :heavy_check_mark: | Whether the benefit is deletable. | diff --git a/docs/models/components/benefitgithubrepositorycreate.md b/docs/models/components/benefitgithubrepositorycreate.md index 99348916..6be83c2f 100644 --- a/docs/models/components/benefitgithubrepositorycreate.md +++ b/docs/models/components/benefitgithubrepositorycreate.md @@ -6,7 +6,8 @@ import { BenefitGitHubRepositoryCreate } from "@polar-sh/sdk/models/components"; let value: BenefitGitHubRepositoryCreate = { - description: "oxidise hmph account spook meager", + description: + "cannon graffiti valiantly pfft concerned char notwithstanding yuck inside finally", properties: { repositoryOwner: "polarsource", repositoryName: "private_repo", @@ -19,7 +20,7 @@ let value: BenefitGitHubRepositoryCreate = { | Field | Type | Required | Description | | ------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------ | -| `type` | [components.BenefitGitHubRepositoryCreateType](../../models/components/benefitgithubrepositorycreatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. Will be displayed on products having this benefit. | | `organizationId` | *string* | :heavy_minus_sign: | The ID of the organization owning the benefit. **Required unless you use an organization token.** | | `properties` | [components.BenefitGitHubRepositoryCreateProperties](../../models/components/benefitgithubrepositorycreateproperties.md) | :heavy_check_mark: | Properties to create a benefit of type `github_repository`. | \ No newline at end of file diff --git a/docs/models/components/benefitgithubrepositorycreatepropertiespermission.md b/docs/models/components/benefitgithubrepositorycreatepropertiespermission.md index 5e1ecf62..78095d2e 100644 --- a/docs/models/components/benefitgithubrepositorycreatepropertiespermission.md +++ b/docs/models/components/benefitgithubrepositorycreatepropertiespermission.md @@ -7,7 +7,7 @@ The permission level to grant. Read more about roles and their permissions on [G ```typescript import { BenefitGitHubRepositoryCreatePropertiesPermission } from "@polar-sh/sdk/models/components"; -let value: BenefitGitHubRepositoryCreatePropertiesPermission = "pull"; +let value: BenefitGitHubRepositoryCreatePropertiesPermission = "push"; ``` ## Values diff --git a/docs/models/components/benefitgithubrepositorycreatetype.md b/docs/models/components/benefitgithubrepositorycreatetype.md deleted file mode 100644 index daaaac3d..00000000 --- a/docs/models/components/benefitgithubrepositorycreatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitGitHubRepositoryCreateType - -## Example Usage - -```typescript -import { BenefitGitHubRepositoryCreateType } from "@polar-sh/sdk/models/components"; - -let value: BenefitGitHubRepositoryCreateType = "github_repository"; -``` - -## Values - -```typescript -"github_repository" -``` \ No newline at end of file diff --git a/docs/models/components/benefitgithubrepositorysubscriber.md b/docs/models/components/benefitgithubrepositorysubscriber.md index d5c82ab0..1a4e651c 100644 --- a/docs/models/components/benefitgithubrepositorysubscriber.md +++ b/docs/models/components/benefitgithubrepositorysubscriber.md @@ -6,29 +6,29 @@ import { BenefitGitHubRepositorySubscriber } from "@polar-sh/sdk/models/components"; let value: BenefitGitHubRepositorySubscriber = { - createdAt: new Date("2023-02-06T21:19:44.981Z"), - modifiedAt: new Date("2022-05-28T07:24:58.835Z"), + createdAt: new Date("2023-10-09T06:21:19.248Z"), + modifiedAt: new Date("2023-05-22T01:56:18.414Z"), id: "", - description: "drat fervently realistic provided against how thorn", + description: "manner what marketplace", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2024-11-26T15:04:44.401Z"), - modifiedAt: new Date("2023-06-05T11:33:54.284Z"), + createdAt: new Date("2024-09-13T00:27:16.676Z"), + modifiedAt: new Date("2023-01-12T09:17:12.503Z"), id: "", name: "", slug: "", - avatarUrl: "https://dearest-doubter.org/", + avatarUrl: "https://dutiful-airman.name", bio: "", - company: "Wisoky, Gislason and Dare", + company: "Champlin and Sons", blog: "", location: "", - email: "Evert32@yahoo.com", + email: "Dino14@yahoo.com", twitterUsername: "", - pledgeMinimumAmount: 478658, + pledgeMinimumAmount: 66860, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 765491, + defaultUpfrontSplitToContributors: 713152, profileSettings: {}, featureSettings: {}, }, @@ -46,7 +46,7 @@ let value: BenefitGitHubRepositorySubscriber = { | `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the benefit. | -| `type` | [components.BenefitGitHubRepositorySubscriberType](../../models/components/benefitgithubrepositorysubscribertype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. | | `selectable` | *boolean* | :heavy_check_mark: | Whether the benefit is selectable when creating a product. | | `deletable` | *boolean* | :heavy_check_mark: | Whether the benefit is deletable. | diff --git a/docs/models/components/benefitgithubrepositorysubscribertype.md b/docs/models/components/benefitgithubrepositorysubscribertype.md deleted file mode 100644 index e45bb3c5..00000000 --- a/docs/models/components/benefitgithubrepositorysubscribertype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitGitHubRepositorySubscriberType - -## Example Usage - -```typescript -import { BenefitGitHubRepositorySubscriberType } from "@polar-sh/sdk/models/components"; - -let value: BenefitGitHubRepositorySubscriberType = "github_repository"; -``` - -## Values - -```typescript -"github_repository" -``` \ No newline at end of file diff --git a/docs/models/components/benefitgithubrepositorytype.md b/docs/models/components/benefitgithubrepositorytype.md deleted file mode 100644 index f8c220d2..00000000 --- a/docs/models/components/benefitgithubrepositorytype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitGitHubRepositoryType - -## Example Usage - -```typescript -import { BenefitGitHubRepositoryType } from "@polar-sh/sdk/models/components"; - -let value: BenefitGitHubRepositoryType = "github_repository"; -``` - -## Values - -```typescript -"github_repository" -``` \ No newline at end of file diff --git a/docs/models/components/benefitgithubrepositoryupdate.md b/docs/models/components/benefitgithubrepositoryupdate.md index b31450a3..c0accb84 100644 --- a/docs/models/components/benefitgithubrepositoryupdate.md +++ b/docs/models/components/benefitgithubrepositoryupdate.md @@ -9,7 +9,7 @@ let value: BenefitGitHubRepositoryUpdate = { properties: { repositoryOwner: "polarsource", repositoryName: "private_repo", - permission: "push", + permission: "triage", }, }; ``` @@ -19,5 +19,5 @@ let value: BenefitGitHubRepositoryUpdate = { | Field | Type | Required | Description | | ------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------ | | `description` | *string* | :heavy_minus_sign: | The description of the benefit. Will be displayed on products having this benefit. | -| `type` | [components.BenefitGitHubRepositoryUpdateType](../../models/components/benefitgithubrepositoryupdatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `properties` | [components.BenefitGitHubRepositoryCreateProperties](../../models/components/benefitgithubrepositorycreateproperties.md) | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/benefitgithubrepositoryupdatetype.md b/docs/models/components/benefitgithubrepositoryupdatetype.md deleted file mode 100644 index 273402b8..00000000 --- a/docs/models/components/benefitgithubrepositoryupdatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitGitHubRepositoryUpdateType - -## Example Usage - -```typescript -import { BenefitGitHubRepositoryUpdateType } from "@polar-sh/sdk/models/components"; - -let value: BenefitGitHubRepositoryUpdateType = "github_repository"; -``` - -## Values - -```typescript -"github_repository" -``` \ No newline at end of file diff --git a/docs/models/components/benefitgrant.md b/docs/models/components/benefitgrant.md index 44fac4b0..6247bf94 100644 --- a/docs/models/components/benefitgrant.md +++ b/docs/models/components/benefitgrant.md @@ -6,8 +6,8 @@ import { BenefitGrant } from "@polar-sh/sdk/models/components"; let value: BenefitGrant = { - createdAt: new Date("2024-06-21T06:25:46.648Z"), - modifiedAt: new Date("2024-05-01T03:28:56.356Z"), + createdAt: new Date("2025-08-12T07:47:19.008Z"), + modifiedAt: new Date("2023-08-27T23:28:28.119Z"), id: "", isGranted: false, isRevoked: false, @@ -16,7 +16,28 @@ let value: BenefitGrant = { customerId: "", userId: "", benefitId: "", - properties: {}, + customer: { + createdAt: new Date("2025-11-25T18:02:23.702Z"), + modifiedAt: new Date("2023-03-29T08:13:52.389Z"), + id: "", + metadata: { + "key": false, + }, + email: "Beverly43@gmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "New Caledonia", + }, + taxId: [ + "", + ], + organizationId: "", + avatarUrl: "https://flimsy-pulse.biz", + }, + properties: { + advertisementCampaignId: "", + }, }; ``` @@ -36,4 +57,5 @@ let value: BenefitGrant = { | `customerId` | *string* | :heavy_check_mark: | The ID of the customer concerned by this grant. | | ~~`userId`~~ | *string* | :heavy_check_mark: | : warning: ** DEPRECATED **: This will be removed in a future release, please migrate away from it as soon as possible. | | `benefitId` | *string* | :heavy_check_mark: | The ID of the benefit concerned by this grant. | +| `customer` | [components.Customer](../../models/components/customer.md) | :heavy_check_mark: | A customer in an organization. | | `properties` | *components.Properties* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/benefitgrantgithubrepositorypropertiespermission.md b/docs/models/components/benefitgrantgithubrepositorypropertiespermission.md index 445a6b33..70d94d75 100644 --- a/docs/models/components/benefitgrantgithubrepositorypropertiespermission.md +++ b/docs/models/components/benefitgrantgithubrepositorypropertiespermission.md @@ -5,7 +5,7 @@ ```typescript import { BenefitGrantGitHubRepositoryPropertiesPermission } from "@polar-sh/sdk/models/components"; -let value: BenefitGrantGitHubRepositoryPropertiesPermission = "pull"; +let value: BenefitGrantGitHubRepositoryPropertiesPermission = "maintain"; ``` ## Values diff --git a/docs/models/components/benefitgrantwebhook.md b/docs/models/components/benefitgrantwebhook.md index 82c9d9c5..ce7ec2ca 100644 --- a/docs/models/components/benefitgrantwebhook.md +++ b/docs/models/components/benefitgrantwebhook.md @@ -6,8 +6,8 @@ import { BenefitGrantWebhook } from "@polar-sh/sdk/models/components"; let value: BenefitGrantWebhook = { - createdAt: new Date("2024-01-24T22:04:15.259Z"), - modifiedAt: new Date("2023-07-05T22:22:10.952Z"), + createdAt: new Date("2024-04-14T02:50:28.988Z"), + modifiedAt: new Date("2024-07-01T02:28:44.314Z"), id: "", isGranted: false, isRevoked: false, @@ -16,20 +16,38 @@ let value: BenefitGrantWebhook = { customerId: "", userId: "", benefitId: "", + customer: { + createdAt: new Date("2024-05-05T20:10:59.426Z"), + modifiedAt: new Date("2023-01-05T21:42:02.091Z"), + id: "", + metadata: { + "key": 257393, + }, + email: "Joana.Barrows@gmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Algeria", + }, + taxId: [ + "", + ], + organizationId: "", + avatarUrl: "https://kooky-cassava.com", + }, properties: {}, benefit: { - createdAt: new Date("2023-07-02T02:28:44.314Z"), - modifiedAt: new Date("2023-05-06T20:10:59.426Z"), + createdAt: new Date("2023-01-29T04:09:01.525Z"), + modifiedAt: new Date("2024-11-28T01:49:49.888Z"), id: "", - description: "abaft commonly before", + description: "lively an unto", selectable: false, deletable: false, organizationId: "", properties: { - guildId: "", - roleId: "", - guildToken: "", + note: "", }, + isTaxApplicable: false, }, }; ``` @@ -50,6 +68,7 @@ let value: BenefitGrantWebhook = { | `customerId` | *string* | :heavy_check_mark: | The ID of the customer concerned by this grant. | | ~~`userId`~~ | *string* | :heavy_check_mark: | : warning: ** DEPRECATED **: This will be removed in a future release, please migrate away from it as soon as possible. | | `benefitId` | *string* | :heavy_check_mark: | The ID of the benefit concerned by this grant. | +| `customer` | [components.Customer](../../models/components/customer.md) | :heavy_check_mark: | A customer in an organization. | | `properties` | *components.BenefitGrantWebhookProperties* | :heavy_check_mark: | N/A | | `benefit` | *components.Benefit* | :heavy_check_mark: | N/A | | `previousProperties` | *components.PreviousProperties* | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/benefitlicensekeys.md b/docs/models/components/benefitlicensekeys.md index 537d0fa6..fb665e44 100644 --- a/docs/models/components/benefitlicensekeys.md +++ b/docs/models/components/benefitlicensekeys.md @@ -6,8 +6,8 @@ import { BenefitLicenseKeys } from "@polar-sh/sdk/models/components"; let value: BenefitLicenseKeys = { - createdAt: new Date("2023-08-03T23:23:59.966Z"), - modifiedAt: new Date("2023-08-18T21:58:52.875Z"), + createdAt: new Date("2024-08-02T23:23:59.966Z"), + modifiedAt: new Date("2024-08-17T21:58:52.875Z"), id: "", description: "dividend investigate minty louse ferret commonly talkative liberalize", @@ -36,7 +36,7 @@ let value: BenefitLicenseKeys = { | `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the benefit. | -| `type` | [components.BenefitLicenseKeysType](../../models/components/benefitlicensekeystype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. | | `selectable` | *boolean* | :heavy_check_mark: | Whether the benefit is selectable when creating a product. | | `deletable` | *boolean* | :heavy_check_mark: | Whether the benefit is deletable. | diff --git a/docs/models/components/benefitlicensekeyscreate.md b/docs/models/components/benefitlicensekeyscreate.md index d2aa881f..251b14cf 100644 --- a/docs/models/components/benefitlicensekeyscreate.md +++ b/docs/models/components/benefitlicensekeyscreate.md @@ -6,8 +6,7 @@ import { BenefitLicenseKeysCreate } from "@polar-sh/sdk/models/components"; let value: BenefitLicenseKeysCreate = { - description: - "even phooey rowdy whenever following delightfully deduct quixotic what worth", + description: "personal skateboard outside", properties: {}, }; ``` @@ -16,7 +15,7 @@ let value: BenefitLicenseKeysCreate = { | Field | Type | Required | Description | | -------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------- | -| `type` | [components.BenefitLicenseKeysCreateType](../../models/components/benefitlicensekeyscreatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. Will be displayed on products having this benefit. | | `organizationId` | *string* | :heavy_minus_sign: | The ID of the organization owning the benefit. **Required unless you use an organization token.** | | `properties` | [components.BenefitLicenseKeysCreateProperties](../../models/components/benefitlicensekeyscreateproperties.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/benefitlicensekeyscreatetype.md b/docs/models/components/benefitlicensekeyscreatetype.md deleted file mode 100644 index 39eb7a22..00000000 --- a/docs/models/components/benefitlicensekeyscreatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitLicenseKeysCreateType - -## Example Usage - -```typescript -import { BenefitLicenseKeysCreateType } from "@polar-sh/sdk/models/components"; - -let value: BenefitLicenseKeysCreateType = "license_keys"; -``` - -## Values - -```typescript -"license_keys" -``` \ No newline at end of file diff --git a/docs/models/components/benefitlicensekeyssubscriber.md b/docs/models/components/benefitlicensekeyssubscriber.md index 5af883b7..3606a6b4 100644 --- a/docs/models/components/benefitlicensekeyssubscriber.md +++ b/docs/models/components/benefitlicensekeyssubscriber.md @@ -6,43 +6,43 @@ import { BenefitLicenseKeysSubscriber } from "@polar-sh/sdk/models/components"; let value: BenefitLicenseKeysSubscriber = { - createdAt: new Date("2024-11-23T05:57:14.612Z"), - modifiedAt: new Date("2022-07-18T04:17:29.241Z"), + createdAt: new Date("2024-12-26T03:56:08.116Z"), + modifiedAt: new Date("2023-09-18T14:12:48.441Z"), id: "", - description: "pish suddenly drat outfit splosh phew", + description: "improbable quarterly testify ah", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2024-09-13T17:33:20.087Z"), - modifiedAt: new Date("2022-10-05T01:05:42.886Z"), + createdAt: new Date("2023-11-26T17:52:56.229Z"), + modifiedAt: new Date("2025-08-25T03:30:05.569Z"), id: "", name: "", slug: "", - avatarUrl: "https://soft-ravioli.net/", + avatarUrl: "https://talkative-intervention.biz/", bio: "", - company: "Baumbach, Lind and Schamberger", + company: "Gottlieb LLC", blog: "", location: "", - email: "Katrine_Altenwerth21@yahoo.com", + email: "Kristopher.Mosciski@yahoo.com", twitterUsername: "", - pledgeMinimumAmount: 633439, + pledgeMinimumAmount: 769488, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 560174, + defaultUpfrontSplitToContributors: 904183, profileSettings: {}, featureSettings: {}, }, properties: { prefix: "", expires: { - ttl: 127759, + ttl: 24532, timeframe: "day", }, activations: { - limit: 391495, + limit: 491462, enableCustomerAdmin: false, }, - limitUsage: 265994, + limitUsage: 131744, }, }; ``` @@ -54,7 +54,7 @@ let value: BenefitLicenseKeysSubscriber = { | `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the benefit. | -| `type` | [components.BenefitLicenseKeysSubscriberType](../../models/components/benefitlicensekeyssubscribertype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `description` | *string* | :heavy_check_mark: | The description of the benefit. | | `selectable` | *boolean* | :heavy_check_mark: | Whether the benefit is selectable when creating a product. | | `deletable` | *boolean* | :heavy_check_mark: | Whether the benefit is deletable. | diff --git a/docs/models/components/benefitlicensekeyssubscriberproperties.md b/docs/models/components/benefitlicensekeyssubscriberproperties.md index f159c268..05944c09 100644 --- a/docs/models/components/benefitlicensekeyssubscriberproperties.md +++ b/docs/models/components/benefitlicensekeyssubscriberproperties.md @@ -8,14 +8,14 @@ import { BenefitLicenseKeysSubscriberProperties } from "@polar-sh/sdk/models/com let value: BenefitLicenseKeysSubscriberProperties = { prefix: "", expires: { - ttl: 101197, + ttl: 565442, timeframe: "month", }, activations: { - limit: 164275, + limit: 49321, enableCustomerAdmin: false, }, - limitUsage: 145675, + limitUsage: 577624, }; ``` diff --git a/docs/models/components/benefitlicensekeyssubscribertype.md b/docs/models/components/benefitlicensekeyssubscribertype.md deleted file mode 100644 index e1dbb934..00000000 --- a/docs/models/components/benefitlicensekeyssubscribertype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitLicenseKeysSubscriberType - -## Example Usage - -```typescript -import { BenefitLicenseKeysSubscriberType } from "@polar-sh/sdk/models/components"; - -let value: BenefitLicenseKeysSubscriberType = "license_keys"; -``` - -## Values - -```typescript -"license_keys" -``` \ No newline at end of file diff --git a/docs/models/components/benefitlicensekeystype.md b/docs/models/components/benefitlicensekeystype.md deleted file mode 100644 index d5b5a62b..00000000 --- a/docs/models/components/benefitlicensekeystype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitLicenseKeysType - -## Example Usage - -```typescript -import { BenefitLicenseKeysType } from "@polar-sh/sdk/models/components"; - -let value: BenefitLicenseKeysType = "license_keys"; -``` - -## Values - -```typescript -"license_keys" -``` \ No newline at end of file diff --git a/docs/models/components/benefitlicensekeysupdate.md b/docs/models/components/benefitlicensekeysupdate.md index a2fe2180..2512f594 100644 --- a/docs/models/components/benefitlicensekeysupdate.md +++ b/docs/models/components/benefitlicensekeysupdate.md @@ -13,5 +13,5 @@ let value: BenefitLicenseKeysUpdate = {}; | Field | Type | Required | Description | | -------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------- | | `description` | *string* | :heavy_minus_sign: | The description of the benefit. Will be displayed on products having this benefit. | -| `type` | [components.BenefitLicenseKeysUpdateType](../../models/components/benefitlicensekeysupdatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `properties` | [components.BenefitLicenseKeysCreateProperties](../../models/components/benefitlicensekeyscreateproperties.md) | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/benefitlicensekeysupdatetype.md b/docs/models/components/benefitlicensekeysupdatetype.md deleted file mode 100644 index 9e812ece..00000000 --- a/docs/models/components/benefitlicensekeysupdatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# BenefitLicenseKeysUpdateType - -## Example Usage - -```typescript -import { BenefitLicenseKeysUpdateType } from "@polar-sh/sdk/models/components"; - -let value: BenefitLicenseKeysUpdateType = "license_keys"; -``` - -## Values - -```typescript -"license_keys" -``` \ No newline at end of file diff --git a/docs/models/components/checkout.md b/docs/models/components/checkout.md index d039333c..cb4abafe 100644 --- a/docs/models/components/checkout.md +++ b/docs/models/components/checkout.md @@ -8,13 +8,14 @@ Checkout session data retrieved using an access token. import { Checkout } from "@polar-sh/sdk/models/components"; let value: Checkout = { - createdAt: new Date("2024-10-14T04:15:01.236Z"), - modifiedAt: new Date("2024-02-12T00:54:59.142Z"), + createdAt: new Date("2025-10-14T04:15:01.236Z"), + modifiedAt: new Date("2025-02-11T00:54:59.142Z"), id: "", + paymentProcessor: "stripe", status: "open", clientSecret: "", url: "https://poor-minority.biz/", - expiresAt: new Date("2024-10-20T21:33:54.006Z"), + expiresAt: new Date("2025-10-20T21:33:54.006Z"), successUrl: "https://musty-mountain.net", embedOrigin: "", amount: 311945, @@ -44,8 +45,8 @@ let value: Checkout = { "key": 179603, }, product: { - createdAt: new Date("2022-01-28T01:08:57.377Z"), - modifiedAt: new Date("2022-03-15T16:56:03.501Z"), + createdAt: new Date("2023-01-28T01:08:57.377Z"), + modifiedAt: new Date("2023-03-15T16:56:03.501Z"), id: "", name: "", description: "how prejudge cutover for clear-cut consequently bouncy abaft", @@ -54,8 +55,8 @@ let value: Checkout = { organizationId: "", prices: [ { - createdAt: new Date("2024-05-10T12:39:43.913Z"), - modifiedAt: new Date("2022-11-05T18:37:43.326Z"), + createdAt: new Date("2025-05-10T12:39:43.913Z"), + modifiedAt: new Date("2023-11-05T18:37:43.326Z"), id: "", isArchived: false, productId: "", @@ -63,8 +64,8 @@ let value: Checkout = { ], benefits: [ { - createdAt: new Date("2023-10-05T16:55:58.841Z"), - modifiedAt: new Date("2022-03-12T02:16:45.552Z"), + createdAt: new Date("2024-10-04T16:55:58.841Z"), + modifiedAt: new Date("2023-03-12T02:16:45.552Z"), id: "", type: "discord", description: @@ -86,18 +87,18 @@ let value: Checkout = { checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-02-18T21:28:55.099Z"), + lastModifiedAt: new Date("2023-02-18T21:28:55.099Z"), version: "", isUploaded: false, - createdAt: new Date("2024-05-26T13:49:51.412Z"), + createdAt: new Date("2025-05-26T13:49:51.412Z"), sizeReadable: "", publicUrl: "https://minty-executor.name/", }, ], }, productPrice: { - createdAt: new Date("2022-02-08T18:10:24.636Z"), - modifiedAt: new Date("2023-04-17T17:18:20.768Z"), + createdAt: new Date("2023-02-08T18:10:24.636Z"), + modifiedAt: new Date("2024-04-16T17:18:20.768Z"), id: "", isArchived: false, productId: "", @@ -121,8 +122,8 @@ let value: Checkout = { { customFieldId: "", customField: { - createdAt: new Date("2023-05-16T18:35:52.926Z"), - modifiedAt: new Date("2024-08-24T17:13:02.117Z"), + createdAt: new Date("2024-05-15T18:35:52.926Z"), + modifiedAt: new Date("2025-08-24T17:13:02.117Z"), id: "", metadata: { "key": 724168, diff --git a/docs/models/components/checkoutlegacy.md b/docs/models/components/checkoutlegacy.md index 72ac51df..310b26cd 100644 --- a/docs/models/components/checkoutlegacy.md +++ b/docs/models/components/checkoutlegacy.md @@ -12,31 +12,35 @@ let value: CheckoutLegacy = { customerEmail: "", customerName: "", product: { - createdAt: new Date("2023-07-25T02:37:30.530Z"), - modifiedAt: new Date("2022-03-31T15:24:09.344Z"), + createdAt: new Date("2023-07-30T06:16:46.899Z"), + modifiedAt: new Date("2024-01-08T22:15:44.580Z"), id: "", name: "", - description: - "heavenly vibrant happy tankful alive overdub while exactly terrorise", + description: "boohoo whether meanwhile zowie pants goodwill behind", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2024-01-29T02:45:28.314Z"), - modifiedAt: new Date("2022-01-02T20:18:32.549Z"), + createdAt: new Date("2023-07-06T14:18:27.483Z"), + modifiedAt: new Date("2023-05-13T12:52:00.880Z"), id: "", isArchived: false, productId: "", + priceCurrency: "", + minimumAmount: 901357, + maximumAmount: 810244, + presetAmount: 619301, }, ], benefits: [ { - createdAt: new Date("2024-06-10T01:19:46.711Z"), - modifiedAt: new Date("2024-10-02T16:46:38.458Z"), + createdAt: new Date("2024-08-14T12:09:16.429Z"), + modifiedAt: new Date("2025-05-01T18:15:09.156Z"), id: "", - type: "custom", - description: "fooey excitedly tentacle even monstrous plait indeed", + type: "ads", + description: + "questionably pale whereas jet likewise miserable captain digitize", selectable: false, deletable: false, organizationId: "", @@ -47,29 +51,28 @@ let value: CheckoutLegacy = { id: "", organizationId: "", name: "", - path: "/home/user/dir", + path: "/home/user", mimeType: "", - size: 912070, + size: 390854, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-11-29T05:37:45.875Z"), + lastModifiedAt: new Date("2024-11-20T22:00:18.063Z"), version: "", isUploaded: false, - createdAt: new Date("2023-11-30T23:53:33.954Z"), + createdAt: new Date("2024-10-04T12:58:35.956Z"), sizeReadable: "", - publicUrl: "https://robust-advertisement.com/", + publicUrl: "https://responsible-meander.net", }, ], }, productPrice: { - createdAt: new Date("2022-11-30T12:43:32.164Z"), - modifiedAt: new Date("2022-03-05T10:15:44.066Z"), + createdAt: new Date("2024-09-19T09:06:06.239Z"), + modifiedAt: new Date("2025-06-03T18:58:37.464Z"), id: "", isArchived: false, productId: "", - recurringInterval: "month", }, }; ``` diff --git a/docs/models/components/checkoutlegacycreate.md b/docs/models/components/checkoutlegacycreate.md index aa4198a0..7afe2aa0 100644 --- a/docs/models/components/checkoutlegacycreate.md +++ b/docs/models/components/checkoutlegacycreate.md @@ -7,7 +7,7 @@ import { CheckoutLegacyCreate } from "@polar-sh/sdk/models/components"; let value: CheckoutLegacyCreate = { productPriceId: "", - successUrl: "https://back-guacamole.info/", + successUrl: "https://rubbery-formation.biz", }; ``` diff --git a/docs/models/components/checkoutlink.md b/docs/models/components/checkoutlink.md index a7d5f176..b94d96b4 100644 --- a/docs/models/components/checkoutlink.md +++ b/docs/models/components/checkoutlink.md @@ -8,32 +8,33 @@ Checkout link data. import { CheckoutLink } from "@polar-sh/sdk/models/components"; let value: CheckoutLink = { - createdAt: new Date("2024-11-20T15:44:57.582Z"), - modifiedAt: new Date("2024-11-07T01:09:19.102Z"), + createdAt: new Date("2025-03-04T13:39:39.013Z"), + modifiedAt: new Date("2024-06-17T10:36:28.925Z"), id: "", metadata: { - "key": "", + "key": false, }, + paymentProcessor: "stripe", clientSecret: "", - successUrl: "https://optimistic-pomelo.info/", + successUrl: "https://handsome-nun.info", label: "", allowDiscountCodes: false, productId: "", productPriceId: "", discountId: "", product: { - createdAt: new Date("2024-05-13T09:28:35.495Z"), - modifiedAt: new Date("2023-11-24T16:18:25.939Z"), + createdAt: new Date("2025-05-18T01:34:45.076Z"), + modifiedAt: new Date("2023-01-09T03:57:13.283Z"), id: "", name: "", - description: "now fashion judgementally yak through excitedly steep", + description: "bah zowie indeed besides haul oh absent", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2023-09-14T07:43:31.648Z"), - modifiedAt: new Date("2023-09-10T05:55:09.703Z"), + createdAt: new Date("2024-06-06T12:48:42.851Z"), + modifiedAt: new Date("2024-10-17T00:55:18.953Z"), id: "", isArchived: false, productId: "", @@ -42,12 +43,12 @@ let value: CheckoutLink = { ], benefits: [ { - createdAt: new Date("2022-06-26T03:55:13.180Z"), - modifiedAt: new Date("2022-07-09T15:57:29.739Z"), + createdAt: new Date("2025-10-11T08:44:45.015Z"), + modifiedAt: new Date("2025-06-23T11:20:33.120Z"), id: "", - type: "custom", + type: "license_keys", description: - "cafe shark woot rejigger openly handsome within bowler plus", + "so obediently yet preclude nauseate hydrolyse mmm huzzah since birdbath", selectable: false, deletable: false, organizationId: "", @@ -58,50 +59,52 @@ let value: CheckoutLink = { id: "", organizationId: "", name: "", - path: "/usr/libdata", + path: "/etc/namedb", mimeType: "", - size: 893084, + size: 653114, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-08-16T11:06:13.409Z"), + lastModifiedAt: new Date("2023-09-03T20:58:16.570Z"), version: "", isUploaded: false, - createdAt: new Date("2024-03-03T16:49:58.761Z"), + createdAt: new Date("2025-06-24T09:42:38.938Z"), sizeReadable: "", - publicUrl: "https://ill-fated-lamp.com/", + publicUrl: "https://long-term-cellar.com/", }, ], }, productPrice: { - createdAt: new Date("2022-07-17T23:15:29.041Z"), - modifiedAt: new Date("2022-12-12T10:04:21.339Z"), + createdAt: new Date("2024-12-02T14:44:34.345Z"), + modifiedAt: new Date("2024-08-12T03:13:38.266Z"), id: "", isArchived: false, productId: "", - recurringInterval: "year", + priceCurrency: "", + priceAmount: 518491, }, discount: { - duration: "once", + duration: "repeating", + durationInMonths: 400613, type: "fixed", - amount: 985677, - currency: "Jamaican Dollar", - createdAt: new Date("2023-03-10T23:31:28.664Z"), - modifiedAt: new Date("2024-04-09T16:36:06.881Z"), + amount: 56043, + currency: "Hong Kong Dollar", + createdAt: new Date("2024-10-28T10:16:41.446Z"), + modifiedAt: new Date("2023-08-30T11:21:08.421Z"), id: "", metadata: { - "key": "", + "key": false, }, name: "", code: "", - startsAt: new Date("2022-07-05T19:31:24.943Z"), - endsAt: new Date("2024-02-28T23:43:34.291Z"), - maxRedemptions: 319651, - redemptionsCount: 701679, + startsAt: new Date("2023-04-30T03:55:25.651Z"), + endsAt: new Date("2024-06-01T06:33:39.509Z"), + maxRedemptions: 536704, + redemptionsCount: 821012, organizationId: "", }, - url: "https://overdue-making.com/", + url: "https://able-lounge.com/", }; ``` diff --git a/docs/models/components/checkoutlinkdiscount.md b/docs/models/components/checkoutlinkdiscount.md index b1d1e827..dfb2f225 100644 --- a/docs/models/components/checkoutlinkdiscount.md +++ b/docs/models/components/checkoutlinkdiscount.md @@ -9,20 +9,20 @@ const value: components.DiscountFixedOnceForeverDurationBase = { duration: "forever", type: "percentage", - amount: 793274, - currency: "Guinea Franc", - createdAt: new Date("2024-12-16T18:47:24.230Z"), - modifiedAt: new Date("2024-01-01T11:35:03.806Z"), + amount: 337245, + currency: "Canadian Dollar", + createdAt: new Date("2023-07-09T15:57:29.739Z"), + modifiedAt: new Date("2023-03-05T03:05:50.686Z"), id: "", metadata: { - "key": "", + "key": false, }, name: "", code: "", - startsAt: new Date("2023-05-23T13:04:23.905Z"), - endsAt: new Date("2024-09-24T17:09:33.132Z"), - maxRedemptions: 295960, - redemptionsCount: 926867, + startsAt: new Date("2025-03-26T08:49:10.019Z"), + endsAt: new Date("2025-07-27T23:23:21.475Z"), + maxRedemptions: 704143, + redemptionsCount: 167786, organizationId: "", }; ``` @@ -31,23 +31,23 @@ const value: components.DiscountFixedOnceForeverDurationBase = { ```typescript const value: components.DiscountFixedRepeatDurationBase = { - duration: "forever", - durationInMonths: 583044, + duration: "repeating", + durationInMonths: 557852, type: "fixed", - amount: 956924, - currency: "Kenyan Shilling", - createdAt: new Date("2023-11-27T06:53:44.342Z"), - modifiedAt: new Date("2023-11-30T05:53:36.778Z"), + amount: 905123, + currency: "Peso Uruguayo", + createdAt: new Date("2024-11-19T03:20:24.143Z"), + modifiedAt: new Date("2024-04-04T22:14:33.524Z"), id: "", metadata: { - "key": 306043, + "key": "", }, name: "", code: "", - startsAt: new Date("2024-08-05T18:09:35.721Z"), - endsAt: new Date("2023-10-13T14:08:51.106Z"), - maxRedemptions: 388445, - redemptionsCount: 322274, + startsAt: new Date("2023-04-17T23:17:03.220Z"), + endsAt: new Date("2025-06-02T09:00:38.951Z"), + maxRedemptions: 966754, + redemptionsCount: 14040, organizationId: "", }; ``` @@ -56,21 +56,21 @@ const value: components.DiscountFixedRepeatDurationBase = { ```typescript const value: components.DiscountPercentageOnceForeverDurationBase = { - duration: "once", - type: "percentage", - basisPoints: 782608, - createdAt: new Date("2023-04-09T00:32:24.908Z"), - modifiedAt: new Date("2024-09-30T13:32:34.699Z"), + duration: "forever", + type: "fixed", + basisPoints: 418539, + createdAt: new Date("2024-09-28T08:26:20.213Z"), + modifiedAt: new Date("2024-04-15T07:03:49.563Z"), id: "", metadata: { "key": "", }, name: "", code: "", - startsAt: new Date("2023-06-19T17:26:23.980Z"), - endsAt: new Date("2023-12-06T02:22:06.346Z"), - maxRedemptions: 569604, - redemptionsCount: 889495, + startsAt: new Date("2025-12-18T16:16:07.562Z"), + endsAt: new Date("2025-10-11T16:21:18.956Z"), + maxRedemptions: 772373, + redemptionsCount: 400681, organizationId: "", }; ``` @@ -80,21 +80,21 @@ const value: components.DiscountPercentageOnceForeverDurationBase = { ```typescript const value: components.DiscountPercentageRepeatDurationBase = { duration: "repeating", - durationInMonths: 825033, - type: "percentage", - basisPoints: 344243, - createdAt: new Date("2022-10-26T18:02:39.058Z"), - modifiedAt: new Date("2023-01-19T13:22:59.390Z"), + durationInMonths: 709769, + type: "fixed", + basisPoints: 39686, + createdAt: new Date("2024-11-13T01:21:39.808Z"), + modifiedAt: new Date("2025-11-05T02:23:41.409Z"), id: "", metadata: { - "key": 826808, + "key": false, }, name: "", code: "", - startsAt: new Date("2024-02-19T04:27:42.766Z"), - endsAt: new Date("2024-06-25T05:15:41.596Z"), - maxRedemptions: 925137, - redemptionsCount: 814797, + startsAt: new Date("2023-09-07T20:58:48.974Z"), + endsAt: new Date("2024-09-01T04:02:03.009Z"), + maxRedemptions: 390215, + redemptionsCount: 546501, organizationId: "", }; ``` diff --git a/docs/models/components/checkoutlinkmetadata.md b/docs/models/components/checkoutlinkmetadata.md index 583d264a..40ef9aca 100644 --- a/docs/models/components/checkoutlinkmetadata.md +++ b/docs/models/components/checkoutlinkmetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 634157; +const value: number = 762643; ``` ### `boolean` diff --git a/docs/models/components/checkoutlinkpricecreate.md b/docs/models/components/checkoutlinkpricecreate.md index 5b317174..11a90024 100644 --- a/docs/models/components/checkoutlinkpricecreate.md +++ b/docs/models/components/checkoutlinkpricecreate.md @@ -15,7 +15,7 @@ let value: CheckoutLinkPriceCreate = { | Field | Type | Required | Description | | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | | `metadata` | Record | :heavy_minus_sign: | Key-value object allowing you to store additional information.

The key must be a string with a maximum length of **40 characters**.
The value must be either:

* A string with a maximum length of **500 characters**
* An integer
* A boolean

You can store up to **50 key-value pairs**. | -| `paymentProcessor` | [components.CheckoutLinkPriceCreatePaymentProcessor](../../models/components/checkoutlinkpricecreatepaymentprocessor.md) | :heavy_check_mark: | Payment processor to use. Currently only Stripe is supported. | +| `paymentProcessor` | *string* | :heavy_check_mark: | Payment processor to use. Currently only Stripe is supported. | | `label` | *string* | :heavy_minus_sign: | Optional label to distinguish links internally | | `allowDiscountCodes` | *boolean* | :heavy_minus_sign: | Whether to allow the customer to apply discount codes. If you apply a discount through `discount_id`, it'll still be applied, but the customer won't be able to change it. | | `discountId` | *string* | :heavy_minus_sign: | ID of the discount to apply to the checkout. If the discount is not applicable anymore when opening the checkout link, it'll be ignored. | diff --git a/docs/models/components/checkoutlinkpricecreatemetadata.md b/docs/models/components/checkoutlinkpricecreatemetadata.md index 88e1fa15..5a6a45eb 100644 --- a/docs/models/components/checkoutlinkpricecreatemetadata.md +++ b/docs/models/components/checkoutlinkpricecreatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 880942; +const value: number = 459536; ``` ### `boolean` diff --git a/docs/models/components/checkoutlinkpricecreatepaymentprocessor.md b/docs/models/components/checkoutlinkpricecreatepaymentprocessor.md deleted file mode 100644 index dd59509b..00000000 --- a/docs/models/components/checkoutlinkpricecreatepaymentprocessor.md +++ /dev/null @@ -1,17 +0,0 @@ -# CheckoutLinkPriceCreatePaymentProcessor - -Payment processor to use. Currently only Stripe is supported. - -## Example Usage - -```typescript -import { CheckoutLinkPriceCreatePaymentProcessor } from "@polar-sh/sdk/models/components"; - -let value: CheckoutLinkPriceCreatePaymentProcessor = "stripe"; -``` - -## Values - -```typescript -"stripe" -``` \ No newline at end of file diff --git a/docs/models/components/checkoutlinkproduct.md b/docs/models/components/checkoutlinkproduct.md index 10ce11cb..1ebba32c 100644 --- a/docs/models/components/checkoutlinkproduct.md +++ b/docs/models/components/checkoutlinkproduct.md @@ -8,33 +8,35 @@ Product data for a checkout link. import { CheckoutLinkProduct } from "@polar-sh/sdk/models/components"; let value: CheckoutLinkProduct = { - createdAt: new Date("2022-05-11T03:13:41.281Z"), - modifiedAt: new Date("2024-10-14T06:10:04.916Z"), + createdAt: new Date("2024-09-18T13:49:20.310Z"), + modifiedAt: new Date("2023-02-06T01:28:31.449Z"), id: "", name: "", - description: "whoever gah boohoo oh transcend for ack", + description: "tinderbox weakly fooey quickly CD ignite", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2023-05-04T04:09:06.657Z"), - modifiedAt: new Date("2024-04-28T14:16:56.411Z"), + createdAt: new Date("2024-03-26T11:10:30.169Z"), + modifiedAt: new Date("2024-08-25T04:55:24.796Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - priceAmount: 668154, + minimumAmount: 639829, + maximumAmount: 58904, + presetAmount: 617530, + recurringInterval: "month", }, ], benefits: [ { - createdAt: new Date("2022-05-02T13:11:55.885Z"), - modifiedAt: new Date("2023-08-06T05:54:35.974Z"), + createdAt: new Date("2024-04-18T06:24:50.359Z"), + modifiedAt: new Date("2025-09-04T23:51:10.342Z"), id: "", - type: "ads", - description: - "blah per verbally merrily legend punctually amid joyously gee hateful", + type: "custom", + description: "ouch mozzarella hoof accelerator", selectable: false, deletable: false, organizationId: "", @@ -45,19 +47,19 @@ let value: CheckoutLinkProduct = { id: "", organizationId: "", name: "", - path: "/usr/include", + path: "/usr/sbin", mimeType: "", - size: 936796, + size: 987398, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-01-18T18:59:13.114Z"), + lastModifiedAt: new Date("2025-01-01T12:27:08.755Z"), version: "", isUploaded: false, - createdAt: new Date("2024-10-05T21:58:09.997Z"), + createdAt: new Date("2025-10-19T19:37:40.374Z"), sizeReadable: "", - publicUrl: "https://drab-handful.com", + publicUrl: "https://right-footrest.com", }, ], }; diff --git a/docs/models/components/checkoutlinkproductcreate.md b/docs/models/components/checkoutlinkproductcreate.md index 446be11e..29981948 100644 --- a/docs/models/components/checkoutlinkproductcreate.md +++ b/docs/models/components/checkoutlinkproductcreate.md @@ -15,7 +15,7 @@ let value: CheckoutLinkProductCreate = { | Field | Type | Required | Description | | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | | `metadata` | Record | :heavy_minus_sign: | Key-value object allowing you to store additional information.

The key must be a string with a maximum length of **40 characters**.
The value must be either:

* A string with a maximum length of **500 characters**
* An integer
* A boolean

You can store up to **50 key-value pairs**. | -| `paymentProcessor` | [components.CheckoutLinkProductCreatePaymentProcessor](../../models/components/checkoutlinkproductcreatepaymentprocessor.md) | :heavy_check_mark: | Payment processor to use. Currently only Stripe is supported. | +| `paymentProcessor` | *string* | :heavy_check_mark: | Payment processor to use. Currently only Stripe is supported. | | `label` | *string* | :heavy_minus_sign: | Optional label to distinguish links internally | | `allowDiscountCodes` | *boolean* | :heavy_minus_sign: | Whether to allow the customer to apply discount codes. If you apply a discount through `discount_id`, it'll still be applied, but the customer won't be able to change it. | | `discountId` | *string* | :heavy_minus_sign: | ID of the discount to apply to the checkout. If the discount is not applicable anymore when opening the checkout link, it'll be ignored. | diff --git a/docs/models/components/checkoutlinkproductcreatemetadata.md b/docs/models/components/checkoutlinkproductcreatemetadata.md index c162fcc6..f1380cbf 100644 --- a/docs/models/components/checkoutlinkproductcreatemetadata.md +++ b/docs/models/components/checkoutlinkproductcreatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 777414; +const value: number = 450561; ``` ### `boolean` diff --git a/docs/models/components/checkoutlinkproductcreatepaymentprocessor.md b/docs/models/components/checkoutlinkproductcreatepaymentprocessor.md deleted file mode 100644 index a9381054..00000000 --- a/docs/models/components/checkoutlinkproductcreatepaymentprocessor.md +++ /dev/null @@ -1,17 +0,0 @@ -# CheckoutLinkProductCreatePaymentProcessor - -Payment processor to use. Currently only Stripe is supported. - -## Example Usage - -```typescript -import { CheckoutLinkProductCreatePaymentProcessor } from "@polar-sh/sdk/models/components"; - -let value: CheckoutLinkProductCreatePaymentProcessor = "stripe"; -``` - -## Values - -```typescript -"stripe" -``` \ No newline at end of file diff --git a/docs/models/components/checkoutlinksortproperty.md b/docs/models/components/checkoutlinksortproperty.md index caa81d84..25aecc00 100644 --- a/docs/models/components/checkoutlinksortproperty.md +++ b/docs/models/components/checkoutlinksortproperty.md @@ -5,7 +5,7 @@ ```typescript import { CheckoutLinkSortProperty } from "@polar-sh/sdk/models/components"; -let value: CheckoutLinkSortProperty = "-created_at"; +let value: CheckoutLinkSortProperty = "created_at"; ``` ## Values diff --git a/docs/models/components/checkoutlinkupdatemetadata.md b/docs/models/components/checkoutlinkupdatemetadata.md index c1f59bf2..95d8a48b 100644 --- a/docs/models/components/checkoutlinkupdatemetadata.md +++ b/docs/models/components/checkoutlinkupdatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 441452; +const value: number = 386185; ``` ### `boolean` diff --git a/docs/models/components/checkoutpricecreate.md b/docs/models/components/checkoutpricecreate.md index 7182a716..acc5fa7b 100644 --- a/docs/models/components/checkoutpricecreate.md +++ b/docs/models/components/checkoutpricecreate.md @@ -21,7 +21,6 @@ let value: CheckoutPriceCreate = { | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | | `metadata` | Record | :heavy_minus_sign: | Key-value object allowing you to store additional information.

The key must be a string with a maximum length of **40 characters**.
The value must be either:

* A string with a maximum length of **500 characters**
* An integer
* A boolean

You can store up to **50 key-value pairs**. | | `customFieldData` | [components.CheckoutPriceCreateCustomFieldData](../../models/components/checkoutpricecreatecustomfielddata.md) | :heavy_minus_sign: | Key-value object storing custom field values. | -| `paymentProcessor` | [components.CheckoutPriceCreatePaymentProcessor](../../models/components/checkoutpricecreatepaymentprocessor.md) | :heavy_check_mark: | Payment processor to use. Currently only Stripe is supported. | | `discountId` | *string* | :heavy_minus_sign: | ID of the discount to apply to the checkout. | | `allowDiscountCodes` | *boolean* | :heavy_minus_sign: | Whether to allow the customer to apply discount codes. If you apply a discount through `discount_id`, it'll still be applied, but the customer won't be able to change it. | | `amount` | *number* | :heavy_minus_sign: | N/A | diff --git a/docs/models/components/checkoutpricecreatecustomermetadata.md b/docs/models/components/checkoutpricecreatecustomermetadata.md index 563c1dd1..7d83de26 100644 --- a/docs/models/components/checkoutpricecreatecustomermetadata.md +++ b/docs/models/components/checkoutpricecreatecustomermetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 829517; +const value: number = 232853; ``` ### `boolean` diff --git a/docs/models/components/checkoutpricecreatemetadata.md b/docs/models/components/checkoutpricecreatemetadata.md index 92b6b010..e59d10bf 100644 --- a/docs/models/components/checkoutpricecreatemetadata.md +++ b/docs/models/components/checkoutpricecreatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 106252; +const value: number = 772419; ``` ### `boolean` diff --git a/docs/models/components/checkoutpricecreatepaymentprocessor.md b/docs/models/components/checkoutpricecreatepaymentprocessor.md deleted file mode 100644 index 4cd0d766..00000000 --- a/docs/models/components/checkoutpricecreatepaymentprocessor.md +++ /dev/null @@ -1,17 +0,0 @@ -# CheckoutPriceCreatePaymentProcessor - -Payment processor to use. Currently only Stripe is supported. - -## Example Usage - -```typescript -import { CheckoutPriceCreatePaymentProcessor } from "@polar-sh/sdk/models/components"; - -let value: CheckoutPriceCreatePaymentProcessor = "stripe"; -``` - -## Values - -```typescript -"stripe" -``` \ No newline at end of file diff --git a/docs/models/components/checkoutproduct.md b/docs/models/components/checkoutproduct.md index d96f9f1c..294c0b95 100644 --- a/docs/models/components/checkoutproduct.md +++ b/docs/models/components/checkoutproduct.md @@ -8,8 +8,8 @@ Product data for a checkout session. import { CheckoutProduct } from "@polar-sh/sdk/models/components"; let value: CheckoutProduct = { - createdAt: new Date("2024-09-08T08:13:49.082Z"), - modifiedAt: new Date("2024-11-26T16:52:15.770Z"), + createdAt: new Date("2025-09-08T08:13:49.082Z"), + modifiedAt: new Date("2025-11-26T16:52:15.770Z"), id: "", name: "", description: "nor sizzling cheerfully hungrily accessorise fly gadzooks", @@ -18,8 +18,8 @@ let value: CheckoutProduct = { organizationId: "", prices: [ { - createdAt: new Date("2023-12-11T07:51:38.823Z"), - modifiedAt: new Date("2023-10-21T00:43:02.657Z"), + createdAt: new Date("2024-12-10T07:51:38.823Z"), + modifiedAt: new Date("2024-10-20T00:43:02.657Z"), id: "", isArchived: false, productId: "", @@ -29,8 +29,8 @@ let value: CheckoutProduct = { ], benefits: [ { - createdAt: new Date("2024-11-21T04:42:37.776Z"), - modifiedAt: new Date("2022-01-19T11:47:32.986Z"), + createdAt: new Date("2025-11-21T04:42:37.776Z"), + modifiedAt: new Date("2023-01-19T11:47:32.986Z"), id: "", type: "downloadables", description: @@ -52,10 +52,10 @@ let value: CheckoutProduct = { checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-05-27T05:59:26.925Z"), + lastModifiedAt: new Date("2023-05-27T05:59:26.925Z"), version: "", isUploaded: false, - createdAt: new Date("2022-04-17T02:19:52.263Z"), + createdAt: new Date("2023-04-17T02:19:52.263Z"), sizeReadable: "", publicUrl: "https://palatable-permafrost.info/", }, diff --git a/docs/models/components/checkoutproductcreate.md b/docs/models/components/checkoutproductcreate.md index 37f85e78..21085bc5 100644 --- a/docs/models/components/checkoutproductcreate.md +++ b/docs/models/components/checkoutproductcreate.md @@ -21,7 +21,6 @@ let value: CheckoutProductCreate = { | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | | `metadata` | Record | :heavy_minus_sign: | Key-value object allowing you to store additional information.

The key must be a string with a maximum length of **40 characters**.
The value must be either:

* A string with a maximum length of **500 characters**
* An integer
* A boolean

You can store up to **50 key-value pairs**. | | `customFieldData` | [components.CheckoutProductCreateCustomFieldData](../../models/components/checkoutproductcreatecustomfielddata.md) | :heavy_minus_sign: | Key-value object storing custom field values. | -| `paymentProcessor` | [components.CheckoutProductCreatePaymentProcessor](../../models/components/checkoutproductcreatepaymentprocessor.md) | :heavy_check_mark: | Payment processor to use. Currently only Stripe is supported. | | `discountId` | *string* | :heavy_minus_sign: | ID of the discount to apply to the checkout. | | `allowDiscountCodes` | *boolean* | :heavy_minus_sign: | Whether to allow the customer to apply discount codes. If you apply a discount through `discount_id`, it'll still be applied, but the customer won't be able to change it. | | `amount` | *number* | :heavy_minus_sign: | N/A | diff --git a/docs/models/components/checkoutproductcreatecustomermetadata.md b/docs/models/components/checkoutproductcreatecustomermetadata.md index 6a721466..7480abb9 100644 --- a/docs/models/components/checkoutproductcreatecustomermetadata.md +++ b/docs/models/components/checkoutproductcreatecustomermetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 846938; +const value: number = 524728; ``` ### `boolean` diff --git a/docs/models/components/checkoutproductcreatemetadata.md b/docs/models/components/checkoutproductcreatemetadata.md index 83bd6138..0e494282 100644 --- a/docs/models/components/checkoutproductcreatemetadata.md +++ b/docs/models/components/checkoutproductcreatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 523055; +const value: number = 432505; ``` ### `boolean` diff --git a/docs/models/components/checkoutproductcreatepaymentprocessor.md b/docs/models/components/checkoutproductcreatepaymentprocessor.md deleted file mode 100644 index f2c8f623..00000000 --- a/docs/models/components/checkoutproductcreatepaymentprocessor.md +++ /dev/null @@ -1,17 +0,0 @@ -# CheckoutProductCreatePaymentProcessor - -Payment processor to use. Currently only Stripe is supported. - -## Example Usage - -```typescript -import { CheckoutProductCreatePaymentProcessor } from "@polar-sh/sdk/models/components"; - -let value: CheckoutProductCreatePaymentProcessor = "stripe"; -``` - -## Values - -```typescript -"stripe" -``` \ No newline at end of file diff --git a/docs/models/components/checkoutpublic.md b/docs/models/components/checkoutpublic.md index 1293db8e..1793f340 100644 --- a/docs/models/components/checkoutpublic.md +++ b/docs/models/components/checkoutpublic.md @@ -8,20 +8,21 @@ Checkout session data retrieved using the client secret. import { CheckoutPublic } from "@polar-sh/sdk/models/components"; let value: CheckoutPublic = { - createdAt: new Date("2023-02-14T04:29:05.402Z"), - modifiedAt: new Date("2022-09-19T22:20:10.589Z"), + createdAt: new Date("2025-12-23T21:13:01.572Z"), + modifiedAt: new Date("2025-03-25T10:28:49.546Z"), id: "", - status: "open", + paymentProcessor: "stripe", + status: "failed", clientSecret: "", - url: "https://kaleidoscopic-plastic.info", - expiresAt: new Date("2023-09-17T11:51:16.694Z"), - successUrl: "https://pleasant-puppet.name/", + url: "https://flashy-valley.biz", + expiresAt: new Date("2024-03-11T05:41:15.184Z"), + successUrl: "https://proud-hello.org/", embedOrigin: "", - amount: 762104, - taxAmount: 146304, - currency: "Bahraini Dinar", - subtotalAmount: 338899, - totalAmount: 481828, + amount: 967421, + taxAmount: 96914, + currency: "Vatu", + subtotalAmount: 797996, + totalAmount: 712338, productId: "", productPriceId: "", discountId: "", @@ -33,43 +34,40 @@ let value: CheckoutPublic = { isPaymentFormRequired: false, customerId: "", customerName: "", - customerEmail: "Oma_Volkman@gmail.com", + customerEmail: "Marilie_Simonis32@yahoo.com", customerIpAddress: "", customerBillingAddress: { - country: "Iceland", + country: "Maldives", }, customerTaxId: "", paymentProcessorMetadata: {}, product: { - createdAt: new Date("2022-10-12T12:54:25.552Z"), - modifiedAt: new Date("2023-10-22T17:43:48.774Z"), + createdAt: new Date("2023-10-06T15:09:40.514Z"), + modifiedAt: new Date("2025-05-10T08:15:00.850Z"), id: "", name: "", - description: "but trek upon inculcate phooey", + description: "greedily once patiently", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2024-04-09T00:58:16.271Z"), - modifiedAt: new Date("2024-03-19T06:46:43.895Z"), + createdAt: new Date("2024-02-29T21:55:30.875Z"), + modifiedAt: new Date("2023-08-07T18:10:01.757Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - minimumAmount: 221408, - maximumAmount: 227674, - presetAmount: 627883, - recurringInterval: "year", + priceAmount: 343621, }, ], benefits: [ { - createdAt: new Date("2023-09-07T23:14:50.718Z"), - modifiedAt: new Date("2022-05-03T17:17:42.677Z"), + createdAt: new Date("2023-05-18T21:21:15.558Z"), + modifiedAt: new Date("2024-08-23T16:47:08.348Z"), id: "", - type: "ads", - description: "um handy into", + type: "github_repository", + description: "recompense eggplant midst crumble quirkily if anenst", selectable: false, deletable: false, organizationId: "", @@ -80,54 +78,58 @@ let value: CheckoutPublic = { id: "", organizationId: "", name: "", - path: "/usr/libexec", + path: "/usr/share", mimeType: "", - size: 232853, + size: 446326, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-08-31T13:02:18.053Z"), + lastModifiedAt: new Date("2024-06-05T13:03:17.818Z"), version: "", isUploaded: false, - createdAt: new Date("2023-06-16T13:05:35.278Z"), + createdAt: new Date("2023-08-12T17:54:50.405Z"), sizeReadable: "", - publicUrl: "https://alienated-mom.info/", + publicUrl: "https://worthy-mountain.name", }, ], }, productPrice: { - createdAt: new Date("2023-01-01T02:20:17.002Z"), - modifiedAt: new Date("2022-04-29T04:30:50.569Z"), + createdAt: new Date("2023-08-04T04:56:14.788Z"), + modifiedAt: new Date("2024-07-18T00:04:56.566Z"), id: "", isArchived: false, productId: "", + priceCurrency: "", + priceAmount: 147974, + recurringInterval: "year", }, discount: { - duration: "once", + duration: "forever", + durationInMonths: 70720, type: "percentage", - amount: 549074, - currency: "Zimbabwe Dollar", + amount: 378581, + currency: "Cuban Peso", id: "", name: "", code: "", }, organization: { - createdAt: new Date("2022-11-09T09:28:55.730Z"), - modifiedAt: new Date("2022-03-17T07:47:24.616Z"), + createdAt: new Date("2024-07-02T20:36:53.375Z"), + modifiedAt: new Date("2025-10-16T02:00:31.918Z"), id: "", name: "", slug: "", - avatarUrl: "https://yellow-reorganisation.org/", + avatarUrl: "https://grizzled-event.name", bio: "", - company: "Gorczany and Sons", + company: "Hickle - Kris", blog: "", location: "", - email: "Grady95@gmail.com", + email: "Eric.Sawayn@hotmail.com", twitterUsername: "", - pledgeMinimumAmount: 96914, + pledgeMinimumAmount: 496042, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 928334, + defaultUpfrontSplitToContributors: 27636, profileSettings: {}, featureSettings: {}, }, @@ -135,25 +137,18 @@ let value: CheckoutPublic = { { customFieldId: "", customField: { - createdAt: new Date("2024-02-20T17:19:26.112Z"), - modifiedAt: new Date("2023-02-02T14:43:20.833Z"), + createdAt: new Date("2024-11-16T20:20:55.562Z"), + modifiedAt: new Date("2025-12-22T21:19:02.932Z"), id: "", metadata: { - "key": false, + "key": "", }, slug: "", name: "", organizationId: "", - properties: { - options: [ - { - value: "", - label: "", - }, - ], - }, + properties: {}, }, - order: 810667, + order: 152719, required: false, }, ], diff --git a/docs/models/components/checkoutpublicconfirmed.md b/docs/models/components/checkoutpublicconfirmed.md index fca20794..7c9f82dd 100644 --- a/docs/models/components/checkoutpublicconfirmed.md +++ b/docs/models/components/checkoutpublicconfirmed.md @@ -11,19 +11,20 @@ right after the checkout. import { CheckoutPublicConfirmed } from "@polar-sh/sdk/models/components"; let value: CheckoutPublicConfirmed = { - createdAt: new Date("2023-11-22T12:06:42.367Z"), - modifiedAt: new Date("2022-12-31T20:50:06.920Z"), + createdAt: new Date("2025-04-30T15:57:54.017Z"), + modifiedAt: new Date("2023-04-03T20:01:39.272Z"), id: "", + paymentProcessor: "stripe", clientSecret: "", - url: "https://busy-taxicab.info", - expiresAt: new Date("2022-05-09T23:59:58.974Z"), - successUrl: "https://chilly-parsnip.biz", + url: "https://woeful-abacus.info/", + expiresAt: new Date("2024-05-28T22:11:49.046Z"), + successUrl: "https://fortunate-sanity.com", embedOrigin: "", - amount: 449117, - taxAmount: 573020, - currency: "Dong", - subtotalAmount: 284514, - totalAmount: 387695, + amount: 490750, + taxAmount: 319320, + currency: "Syrian Pound", + subtotalAmount: 402947, + totalAmount: 69878, productId: "", productPriceId: "", discountId: "", @@ -35,42 +36,41 @@ let value: CheckoutPublicConfirmed = { isPaymentFormRequired: false, customerId: "", customerName: "", - customerEmail: "Everett_Lowe62@gmail.com", + customerEmail: "Adonis_Kuphal31@hotmail.com", customerIpAddress: "", customerBillingAddress: { - country: "Ireland", + country: "Somalia", }, customerTaxId: "", paymentProcessorMetadata: {}, product: { - createdAt: new Date("2022-02-15T09:45:02.580Z"), - modifiedAt: new Date("2022-02-14T02:54:42.879Z"), + createdAt: new Date("2023-01-11T18:22:31.099Z"), + modifiedAt: new Date("2025-08-14T22:50:28.709Z"), id: "", name: "", - description: "pretty quit boyfriend cruel so", + description: "cleverly ha psst", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2022-08-13T15:30:37.197Z"), - modifiedAt: new Date("2024-02-27T19:52:47.838Z"), + createdAt: new Date("2024-01-21T08:41:14.953Z"), + modifiedAt: new Date("2025-09-04T01:03:05.967Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - priceAmount: 768613, - recurringInterval: "year", + priceAmount: 690215, }, ], benefits: [ { - createdAt: new Date("2022-09-16T16:37:59.200Z"), - modifiedAt: new Date("2024-02-01T10:56:21.274Z"), + createdAt: new Date("2025-03-12T21:52:07.391Z"), + modifiedAt: new Date("2025-08-20T14:30:30.151Z"), id: "", - type: "custom", + type: "ads", description: - "qualified gah whoever liberalize put circumference contractor so abacus major", + "to replicate pfft approach silky however loudly up separately", selectable: false, deletable: false, organizationId: "", @@ -81,56 +81,56 @@ let value: CheckoutPublicConfirmed = { id: "", organizationId: "", name: "", - path: "/net", + path: "/etc/periodic", mimeType: "", - size: 808156, + size: 455389, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2023-03-18T15:07:30.797Z"), + lastModifiedAt: new Date("2023-05-12T22:41:43.362Z"), version: "", isUploaded: false, - createdAt: new Date("2022-03-18T14:04:55.018Z"), + createdAt: new Date("2024-02-05T14:35:18.199Z"), sizeReadable: "", - publicUrl: "https://afraid-fireplace.info", + publicUrl: "https://unwieldy-priesthood.org/", }, ], }, productPrice: { - createdAt: new Date("2022-04-25T02:10:45.992Z"), - modifiedAt: new Date("2024-06-23T11:32:52.597Z"), + createdAt: new Date("2024-03-24T22:59:34.235Z"), + modifiedAt: new Date("2024-10-12T16:07:08.214Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - priceAmount: 9822, + priceAmount: 541245, + recurringInterval: "year", }, discount: { duration: "once", - durationInMonths: 125701, - type: "fixed", - basisPoints: 148343, + type: "percentage", + basisPoints: 173926, id: "", name: "", code: "", }, organization: { - createdAt: new Date("2024-05-21T01:52:05.438Z"), - modifiedAt: new Date("2024-06-07T20:03:13.719Z"), + createdAt: new Date("2024-06-06T04:13:55.600Z"), + modifiedAt: new Date("2025-08-30T20:45:32.677Z"), id: "", name: "", slug: "", - avatarUrl: "https://chubby-milestone.net/", + avatarUrl: "https://musty-poetry.info", bio: "", - company: "Barrows and Sons", + company: "Murazik LLC", blog: "", location: "", - email: "Mike47@hotmail.com", + email: "Rod.Buckridge-Zboncak@hotmail.com", twitterUsername: "", - pledgeMinimumAmount: 96417, + pledgeMinimumAmount: 673487, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 504932, + defaultUpfrontSplitToContributors: 973823, profileSettings: {}, featureSettings: {}, }, @@ -138,18 +138,25 @@ let value: CheckoutPublicConfirmed = { { customFieldId: "", customField: { - createdAt: new Date("2022-05-15T15:39:25.865Z"), - modifiedAt: new Date("2023-01-21T08:41:14.953Z"), + createdAt: new Date("2024-03-06T08:29:05.090Z"), + modifiedAt: new Date("2024-10-19T17:10:22.055Z"), id: "", metadata: { - "key": false, + "key": 765419, }, slug: "", name: "", organizationId: "", - properties: {}, + properties: { + options: [ + { + value: "", + label: "", + }, + ], + }, }, - order: 690215, + order: 581098, required: false, }, ], @@ -166,7 +173,7 @@ let value: CheckoutPublicConfirmed = { | `id` | *string* | :heavy_check_mark: | The ID of the object. | | `customFieldData` | [components.CheckoutPublicConfirmedCustomFieldData](../../models/components/checkoutpublicconfirmedcustomfielddata.md) | :heavy_minus_sign: | Key-value object storing custom field values. | | `paymentProcessor` | [components.PaymentProcessor](../../models/components/paymentprocessor.md) | :heavy_check_mark: | N/A | -| `status` | [components.Status](../../models/components/status.md) | :heavy_check_mark: | N/A | +| `status` | *string* | :heavy_check_mark: | N/A | | `clientSecret` | *string* | :heavy_check_mark: | Client secret used to update and complete the checkout session from the client. | | `url` | *string* | :heavy_check_mark: | URL where the customer can access the checkout session. | | `expiresAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Expiration date and time of the checkout session. | diff --git a/docs/models/components/checkoutpublicconfirmeddiscount.md b/docs/models/components/checkoutpublicconfirmeddiscount.md index 5628a4b3..13a652d4 100644 --- a/docs/models/components/checkoutpublicconfirmeddiscount.md +++ b/docs/models/components/checkoutpublicconfirmeddiscount.md @@ -7,10 +7,10 @@ ```typescript const value: components.CheckoutDiscountFixedOnceForeverDuration = { - duration: "repeating", + duration: "forever", type: "percentage", - amount: 320023, - currency: "Yuan Renminbi", + amount: 664499, + currency: "Forint", id: "", name: "", code: "", @@ -21,11 +21,11 @@ const value: components.CheckoutDiscountFixedOnceForeverDuration = { ```typescript const value: components.CheckoutDiscountFixedRepeatDuration = { - duration: "forever", - durationInMonths: 254226, - type: "percentage", - amount: 44670, - currency: "Yen", + duration: "once", + durationInMonths: 5224, + type: "fixed", + amount: 100063, + currency: "Algerian Dinar", id: "", name: "", code: "", @@ -36,9 +36,9 @@ const value: components.CheckoutDiscountFixedRepeatDuration = { ```typescript const value: components.CheckoutDiscountPercentageOnceForeverDuration = { - duration: "repeating", + duration: "once", type: "fixed", - basisPoints: 686979, + basisPoints: 405846, id: "", name: "", code: "", @@ -50,9 +50,9 @@ const value: components.CheckoutDiscountPercentageOnceForeverDuration = { ```typescript const value: components.CheckoutDiscountPercentageRepeatDuration = { duration: "once", - durationInMonths: 127394, + durationInMonths: 581368, type: "fixed", - basisPoints: 19336, + basisPoints: 639652, id: "", name: "", code: "", diff --git a/docs/models/components/checkoutpublicdiscount.md b/docs/models/components/checkoutpublicdiscount.md index b638f154..b9a4b7b7 100644 --- a/docs/models/components/checkoutpublicdiscount.md +++ b/docs/models/components/checkoutpublicdiscount.md @@ -7,10 +7,10 @@ ```typescript const value: components.CheckoutDiscountFixedOnceForeverDuration = { - duration: "repeating", - type: "percentage", - amount: 108001, - currency: "Euro", + duration: "forever", + type: "fixed", + amount: 581946, + currency: "Jordanian Dinar", id: "", name: "", code: "", @@ -22,10 +22,10 @@ const value: components.CheckoutDiscountFixedOnceForeverDuration = { ```typescript const value: components.CheckoutDiscountFixedRepeatDuration = { duration: "forever", - durationInMonths: 380575, - type: "percentage", - amount: 536042, - currency: "Turkish Lira", + durationInMonths: 914824, + type: "fixed", + amount: 107835, + currency: "Cuban Peso", id: "", name: "", code: "", @@ -38,7 +38,7 @@ const value: components.CheckoutDiscountFixedRepeatDuration = { const value: components.CheckoutDiscountPercentageOnceForeverDuration = { duration: "once", type: "percentage", - basisPoints: 464640, + basisPoints: 549074, id: "", name: "", code: "", @@ -49,10 +49,10 @@ const value: components.CheckoutDiscountPercentageOnceForeverDuration = { ```typescript const value: components.CheckoutDiscountPercentageRepeatDuration = { - duration: "forever", - durationInMonths: 284045, + duration: "repeating", + durationInMonths: 285032, type: "fixed", - basisPoints: 189804, + basisPoints: 301188, id: "", name: "", code: "", diff --git a/docs/models/components/checkoutupdatecustomermetadata.md b/docs/models/components/checkoutupdatecustomermetadata.md index 9665bc85..37f9829f 100644 --- a/docs/models/components/checkoutupdatecustomermetadata.md +++ b/docs/models/components/checkoutupdatecustomermetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 214929; +const value: number = 484987; ``` ### `boolean` diff --git a/docs/models/components/checkoutupdatemetadata.md b/docs/models/components/checkoutupdatemetadata.md index 438af8ad..eb11f090 100644 --- a/docs/models/components/checkoutupdatemetadata.md +++ b/docs/models/components/checkoutupdatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 650918; +const value: number = 221298; ``` ### `boolean` diff --git a/docs/models/components/customer.md b/docs/models/components/customer.md index 684b2b64..ea9ae9c7 100644 --- a/docs/models/components/customer.md +++ b/docs/models/components/customer.md @@ -8,23 +8,23 @@ A customer in an organization. import { Customer } from "@polar-sh/sdk/models/components"; let value: Customer = { - createdAt: new Date("2024-04-10T18:10:09.907Z"), - modifiedAt: new Date("2023-10-01T23:34:17.590Z"), + createdAt: new Date("2023-07-06T20:17:06.814Z"), + modifiedAt: new Date("2025-05-28T20:24:06.201Z"), id: "", metadata: { - "key": false, + "key": 276945, }, - email: "Lavonne33@yahoo.com", + email: "Princess.Schmitt67@hotmail.com", emailVerified: false, name: "", billingAddress: { - country: "Pakistan", + country: "Panama", }, taxId: [ - "", + "rs_pib", ], organizationId: "", - avatarUrl: "https://prudent-status.org", + avatarUrl: "https://silver-instance.biz", }; ``` diff --git a/docs/models/components/customerbenefitgrant.md b/docs/models/components/customerbenefitgrant.md index 6bc414c4..506e21ab 100644 --- a/docs/models/components/customerbenefitgrant.md +++ b/docs/models/components/customerbenefitgrant.md @@ -7,41 +7,61 @@ ```typescript const value: components.CustomerBenefitGrantDiscord = { - createdAt: new Date("2024-09-29T04:13:26.424Z"), - modifiedAt: new Date("2023-03-17T15:09:49.842Z"), + createdAt: new Date("2023-11-19T06:41:38.705Z"), + modifiedAt: new Date("2024-08-09T01:38:45.701Z"), id: "", - grantedAt: new Date("2023-08-05T02:47:44.010Z"), - revokedAt: new Date("2022-07-02T04:54:45.425Z"), + grantedAt: new Date("2024-11-05T08:55:11.482Z"), + revokedAt: new Date("2025-05-21T04:20:19.703Z"), customerId: "", benefitId: "", subscriptionId: "", orderId: "", isGranted: false, isRevoked: false, + customer: { + createdAt: new Date("2025-02-27T19:56:45.753Z"), + modifiedAt: new Date("2023-07-11T02:37:33.682Z"), + id: "", + email: "Betsy83@hotmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Poland", + }, + taxId: [ + "", + ], + oauthAccounts: { + "key": { + accountId: "", + accountUsername: "", + }, + }, + }, benefit: { - createdAt: new Date("2022-02-08T09:47:50.312Z"), - modifiedAt: new Date("2022-04-11T13:31:09.956Z"), + createdAt: new Date("2024-10-24T18:09:57.493Z"), + modifiedAt: new Date("2024-04-14T05:06:02.597Z"), id: "", - description: "gee convalesce from", + description: "or emphasise toward shrill closely republican yahoo", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2022-07-21T19:51:58.737Z"), - modifiedAt: new Date("2022-06-26T22:17:36.002Z"), + createdAt: new Date("2025-03-05T13:59:29.287Z"), + modifiedAt: new Date("2025-11-19T12:36:32.087Z"), id: "", name: "", slug: "", - avatarUrl: "https://nippy-knitting.info", + avatarUrl: "https://lumbering-loaf.biz/", bio: "", - company: "Lubowitz, Carter and Bernhard", + company: "Kuhn - Kutch", blog: "", location: "", - email: "Wava_Lind7@gmail.com", + email: "Kristofer.Pollich64@gmail.com", twitterUsername: "", - pledgeMinimumAmount: 620988, + pledgeMinimumAmount: 392697, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 13831, + defaultUpfrontSplitToContributors: 461028, profileSettings: {}, featureSettings: {}, }, @@ -57,41 +77,61 @@ const value: components.CustomerBenefitGrantDiscord = { ```typescript const value: components.CustomerBenefitGrantGitHubRepository = { - createdAt: new Date("2024-10-12T04:07:38.112Z"), - modifiedAt: new Date("2022-04-28T16:01:19.072Z"), + createdAt: new Date("2025-05-21T22:19:32.604Z"), + modifiedAt: new Date("2025-08-22T13:59:23.140Z"), id: "", - grantedAt: new Date("2022-03-08T05:27:12.001Z"), - revokedAt: new Date("2022-07-30T16:24:41.039Z"), + grantedAt: new Date("2025-02-26T03:28:22.521Z"), + revokedAt: new Date("2025-04-29T16:14:06.656Z"), customerId: "", benefitId: "", subscriptionId: "", orderId: "", isGranted: false, isRevoked: false, + customer: { + createdAt: new Date("2025-10-18T01:10:09.104Z"), + modifiedAt: new Date("2024-06-15T01:31:41.447Z"), + id: "", + email: "Fritz98@gmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Niger", + }, + taxId: [ + "om_vat", + ], + oauthAccounts: { + "key": { + accountId: "", + accountUsername: "", + }, + }, + }, benefit: { - createdAt: new Date("2023-10-31T22:30:40.646Z"), - modifiedAt: new Date("2024-10-28T09:44:26.940Z"), + createdAt: new Date("2025-01-17T14:16:00.694Z"), + modifiedAt: new Date("2023-06-10T13:45:05.270Z"), id: "", - description: "miserly sesame separately except reproach once", + description: "rapidly expatiate ack pro", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2022-05-14T13:28:32.287Z"), - modifiedAt: new Date("2023-12-15T10:23:59.029Z"), + createdAt: new Date("2024-05-13T18:08:52.522Z"), + modifiedAt: new Date("2024-06-24T05:42:29.206Z"), id: "", name: "", slug: "", - avatarUrl: "https://tired-tabletop.biz", + avatarUrl: "https://ample-shore.com/", bio: "", - company: "Wiza Inc", + company: "Ratke, Parisian and Little", blog: "", location: "", - email: "Tiana.Krajcik@yahoo.com", + email: "Warren.Krajcik23@yahoo.com", twitterUsername: "", - pledgeMinimumAmount: 863222, + pledgeMinimumAmount: 872276, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 670247, + defaultUpfrontSplitToContributors: 363414, profileSettings: {}, featureSettings: {}, }, @@ -108,41 +148,61 @@ const value: components.CustomerBenefitGrantGitHubRepository = { ```typescript const value: components.CustomerBenefitGrantDownloadables = { - createdAt: new Date("2024-10-17T08:10:11.917Z"), - modifiedAt: new Date("2022-10-15T04:12:19.227Z"), + createdAt: new Date("2024-06-16T11:00:23.774Z"), + modifiedAt: new Date("2024-07-30T23:49:35.128Z"), id: "", - grantedAt: new Date("2024-06-09T09:26:08.069Z"), - revokedAt: new Date("2022-05-08T23:36:08.958Z"), + grantedAt: new Date("2025-05-19T06:34:40.999Z"), + revokedAt: new Date("2024-11-05T04:22:18.799Z"), customerId: "", benefitId: "", subscriptionId: "", orderId: "", isGranted: false, isRevoked: false, + customer: { + createdAt: new Date("2023-03-17T22:21:59.387Z"), + modifiedAt: new Date("2024-02-18T07:07:56.877Z"), + id: "", + email: "Miles2@yahoo.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Democratic Republic of the Congo", + }, + taxId: [ + "", + ], + oauthAccounts: { + "key": { + accountId: "", + accountUsername: "", + }, + }, + }, benefit: { - createdAt: new Date("2024-05-28T21:58:09.513Z"), - modifiedAt: new Date("2024-07-19T04:58:26.102Z"), + createdAt: new Date("2023-09-13T07:17:27.740Z"), + modifiedAt: new Date("2025-08-09T01:53:56.642Z"), id: "", - description: "crossly unfortunate toward who pillbox than", + description: "pike sheathe runny absent now", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2024-05-21T04:20:19.703Z"), - modifiedAt: new Date("2024-02-28T19:56:45.753Z"), + createdAt: new Date("2024-07-22T14:36:15.153Z"), + modifiedAt: new Date("2023-06-17T07:07:59.245Z"), id: "", name: "", slug: "", - avatarUrl: "https://silent-captain.org/", + avatarUrl: "https://unfortunate-minister.biz/", bio: "", - company: "Brown, Smith and Pagac", + company: "Trantow, Walter and Sauer", blog: "", location: "", - email: "Jedidiah_Keebler78@hotmail.com", + email: "Oral.Abshire@yahoo.com", twitterUsername: "", - pledgeMinimumAmount: 875896, + pledgeMinimumAmount: 695735, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 306009, + defaultUpfrontSplitToContributors: 939353, profileSettings: {}, featureSettings: {}, }, @@ -160,55 +220,75 @@ const value: components.CustomerBenefitGrantDownloadables = { ```typescript const value: components.CustomerBenefitGrantLicenseKeys = { - createdAt: new Date("2022-06-11T17:35:21.996Z"), - modifiedAt: new Date("2023-11-27T11:10:42.631Z"), + createdAt: new Date("2025-09-14T17:53:29.108Z"), + modifiedAt: new Date("2024-10-17T05:26:12.523Z"), id: "", - grantedAt: new Date("2023-07-29T18:04:26.564Z"), - revokedAt: new Date("2022-11-16T12:29:48.849Z"), + grantedAt: new Date("2024-09-18T01:12:09.442Z"), + revokedAt: new Date("2023-03-16T20:56:58.345Z"), customerId: "", benefitId: "", subscriptionId: "", orderId: "", isGranted: false, isRevoked: false, + customer: { + createdAt: new Date("2025-04-25T05:56:55.870Z"), + modifiedAt: new Date("2023-10-19T11:47:06.902Z"), + id: "", + email: "Dallas14@hotmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Myanmar", + }, + taxId: [ + "ca_bn", + ], + oauthAccounts: { + "key": { + accountId: "", + accountUsername: "", + }, + }, + }, benefit: { - createdAt: new Date("2023-11-20T11:24:09.591Z"), - modifiedAt: new Date("2024-02-22T22:18:42.102Z"), + createdAt: new Date("2025-07-27T06:53:00.076Z"), + modifiedAt: new Date("2025-03-15T19:17:39.043Z"), id: "", - description: "adjourn consequently rightfully gosh brook", + description: "willfully likewise if per department till", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2024-05-28T12:38:40.125Z"), - modifiedAt: new Date("2024-02-07T22:48:59.434Z"), + createdAt: new Date("2024-07-24T08:55:42.913Z"), + modifiedAt: new Date("2023-08-31T16:57:01.365Z"), id: "", name: "", slug: "", - avatarUrl: "https://serene-verve.info/", + avatarUrl: "https://smooth-governance.org", bio: "", - company: "Lehner Inc", + company: "Mueller Group", blog: "", location: "", - email: "Jeffery77@gmail.com", + email: "Antonette.Beier@yahoo.com", twitterUsername: "", - pledgeMinimumAmount: 147108, + pledgeMinimumAmount: 180967, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 642392, + defaultUpfrontSplitToContributors: 82393, profileSettings: {}, featureSettings: {}, }, properties: { prefix: "", expires: { - ttl: 3418, - timeframe: "month", + ttl: 873721, + timeframe: "year", }, activations: { - limit: 461028, + limit: 568720, enableCustomerAdmin: false, }, - limitUsage: 795557, + limitUsage: 791253, }, }, properties: {}, @@ -219,41 +299,61 @@ const value: components.CustomerBenefitGrantLicenseKeys = { ```typescript const value: components.CustomerBenefitGrantAds = { - createdAt: new Date("2024-08-22T13:59:23.140Z"), - modifiedAt: new Date("2024-02-27T03:28:22.521Z"), + createdAt: new Date("2023-07-03T14:59:21.254Z"), + modifiedAt: new Date("2024-12-09T08:42:56.831Z"), id: "", - grantedAt: new Date("2024-04-29T16:14:06.656Z"), - revokedAt: new Date("2024-10-18T01:10:09.104Z"), + grantedAt: new Date("2025-03-11T18:16:52.321Z"), + revokedAt: new Date("2025-02-14T01:57:38.329Z"), customerId: "", benefitId: "", subscriptionId: "", orderId: "", isGranted: false, isRevoked: false, + customer: { + createdAt: new Date("2023-02-26T16:10:21.358Z"), + modifiedAt: new Date("2024-12-04T04:20:53.724Z"), + id: "", + email: "Elissa_Bechtelar55@gmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Saint Kitts and Nevis", + }, + taxId: [ + "hu_tin", + ], + oauthAccounts: { + "key": { + accountId: "", + accountUsername: "", + }, + }, + }, benefit: { - createdAt: new Date("2023-06-16T01:31:41.447Z"), - modifiedAt: new Date("2022-11-03T13:45:37.941Z"), + createdAt: new Date("2025-05-17T20:32:17.192Z"), + modifiedAt: new Date("2025-09-24T21:01:28.984Z"), id: "", - description: "strong rightfully reassuringly lock limp", + description: "madly hard-to-find gee ouch zowie till chops", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2023-02-25T17:01:22.120Z"), - modifiedAt: new Date("2022-06-07T21:21:33.285Z"), + createdAt: new Date("2025-11-01T16:04:46.969Z"), + modifiedAt: new Date("2025-12-20T11:54:29.031Z"), id: "", name: "", slug: "", - avatarUrl: "https://shabby-impact.info", + avatarUrl: "https://babyish-freckle.org/", bio: "", - company: "Bartell - Schoen", + company: "Fay and Sons", blog: "", location: "", - email: "Oleta34@gmail.com", + email: "Marlen.Nader@gmail.com", twitterUsername: "", - pledgeMinimumAmount: 910738, + pledgeMinimumAmount: 765017, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 474315, + defaultUpfrontSplitToContributors: 555158, profileSettings: {}, featureSettings: {}, }, @@ -269,41 +369,61 @@ const value: components.CustomerBenefitGrantAds = { ```typescript const value: components.CustomerBenefitGrantCustom = { - createdAt: new Date("2022-07-12T06:14:48.425Z"), - modifiedAt: new Date("2022-09-15T02:19:44.265Z"), + createdAt: new Date("2023-07-17T08:42:37.234Z"), + modifiedAt: new Date("2025-04-07T08:49:58.108Z"), id: "", - grantedAt: new Date("2022-01-16T08:40:53.088Z"), - revokedAt: new Date("2024-08-14T00:19:41.639Z"), + grantedAt: new Date("2024-11-29T22:41:42.230Z"), + revokedAt: new Date("2023-01-22T01:43:38.808Z"), customerId: "", benefitId: "", subscriptionId: "", orderId: "", isGranted: false, isRevoked: false, + customer: { + createdAt: new Date("2023-03-13T21:30:50.627Z"), + modifiedAt: new Date("2023-04-11T23:02:43.476Z"), + id: "", + email: "Dovie81@gmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Monaco", + }, + taxId: [ + "", + ], + oauthAccounts: { + "key": { + accountId: "", + accountUsername: "", + }, + }, + }, benefit: { - createdAt: new Date("2023-02-03T07:14:18.882Z"), - modifiedAt: new Date("2023-06-17T11:00:23.774Z"), + createdAt: new Date("2025-01-23T18:32:15.375Z"), + modifiedAt: new Date("2023-11-28T08:15:52.623Z"), id: "", - description: "schedule famously inside technician brr because promptly", + description: "frankly pfft bah indeed nauseate gosh deck even misreport", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2022-06-04T21:18:02.417Z"), - modifiedAt: new Date("2023-06-19T13:19:31.456Z"), + createdAt: new Date("2024-01-13T10:00:25.967Z"), + modifiedAt: new Date("2024-03-12T08:26:51.024Z"), id: "", name: "", slug: "", - avatarUrl: "https://crooked-impostor.org", + avatarUrl: "https://basic-fen.net/", bio: "", - company: "Denesik and Sons", + company: "Runolfsson LLC", blog: "", location: "", - email: "Tillman_MacGyver61@hotmail.com", + email: "Maryjane99@hotmail.com", twitterUsername: "", - pledgeMinimumAmount: 116282, + pledgeMinimumAmount: 93479, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 109545, + defaultUpfrontSplitToContributors: 111422, profileSettings: {}, featureSettings: {}, }, diff --git a/docs/models/components/customerbenefitgrantads.md b/docs/models/components/customerbenefitgrantads.md index ebffddba..a87aa692 100644 --- a/docs/models/components/customerbenefitgrantads.md +++ b/docs/models/components/customerbenefitgrantads.md @@ -6,42 +6,61 @@ import { CustomerBenefitGrantAds } from "@polar-sh/sdk/models/components"; let value: CustomerBenefitGrantAds = { - createdAt: new Date("2024-03-08T08:22:27.702Z"), - modifiedAt: new Date("2022-03-15T06:42:11.490Z"), + createdAt: new Date("2025-10-18T00:02:52.345Z"), + modifiedAt: new Date("2024-06-02T00:04:32.797Z"), id: "", - grantedAt: new Date("2024-02-21T14:44:41.629Z"), - revokedAt: new Date("2022-03-18T07:56:55.620Z"), + grantedAt: new Date("2023-09-09T04:56:49.668Z"), + revokedAt: new Date("2025-01-05T08:25:05.244Z"), customerId: "", benefitId: "", subscriptionId: "", orderId: "", isGranted: false, isRevoked: false, + customer: { + createdAt: new Date("2023-10-21T07:37:15.037Z"), + modifiedAt: new Date("2025-09-30T01:11:06.941Z"), + id: "", + email: "Ova21@yahoo.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Bouvet Island", + }, + taxId: [ + "", + ], + oauthAccounts: { + "key": { + accountId: "", + accountUsername: "", + }, + }, + }, benefit: { - createdAt: new Date("2023-03-09T04:01:27.021Z"), - modifiedAt: new Date("2022-05-17T22:22:57.707Z"), + createdAt: new Date("2024-02-10T10:02:23.518Z"), + modifiedAt: new Date("2025-09-24T08:55:04.735Z"), id: "", - description: - "remark offset major doubtfully whether jealously immediately spew section fearless", + description: "supposing abaft uh-huh quickly", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2024-04-18T15:52:30.847Z"), - modifiedAt: new Date("2022-09-24T10:58:44.754Z"), + createdAt: new Date("2025-11-12T10:24:01.727Z"), + modifiedAt: new Date("2025-05-01T10:55:39.996Z"), id: "", name: "", slug: "", - avatarUrl: "https://intent-hutch.net/", + avatarUrl: "https://dim-toaster.com", bio: "", - company: "Spinka - Collins", + company: "Connelly, Hettinger and Hegmann", blog: "", location: "", - email: "Gudrun66@gmail.com", + email: "Myles26@gmail.com", twitterUsername: "", - pledgeMinimumAmount: 516918, + pledgeMinimumAmount: 564777, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 589391, + defaultUpfrontSplitToContributors: 411312, profileSettings: {}, featureSettings: {}, }, @@ -68,5 +87,6 @@ let value: CustomerBenefitGrantAds = { | `orderId` | *string* | :heavy_check_mark: | N/A | | `isGranted` | *boolean* | :heavy_check_mark: | N/A | | `isRevoked` | *boolean* | :heavy_check_mark: | N/A | +| `customer` | [components.CustomerPortalCustomer](../../models/components/customerportalcustomer.md) | :heavy_check_mark: | N/A | | `benefit` | [components.BenefitAdsSubscriber](../../models/components/benefitadssubscriber.md) | :heavy_check_mark: | N/A | | `properties` | [components.BenefitGrantAdsProperties](../../models/components/benefitgrantadsproperties.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantadsupdate.md b/docs/models/components/customerbenefitgrantadsupdate.md index c98ac166..6378a8cf 100644 --- a/docs/models/components/customerbenefitgrantadsupdate.md +++ b/docs/models/components/customerbenefitgrantadsupdate.md @@ -10,6 +10,6 @@ let value: CustomerBenefitGrantAdsUpdate = {}; ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------- | -| `benefitType` | [components.CustomerBenefitGrantAdsUpdateBenefitType](../../models/components/customerbenefitgrantadsupdatebenefittype.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------ | ------------------ | ------------------ | ------------------ | +| `benefitType` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantadsupdatebenefittype.md b/docs/models/components/customerbenefitgrantadsupdatebenefittype.md deleted file mode 100644 index 6dfae562..00000000 --- a/docs/models/components/customerbenefitgrantadsupdatebenefittype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomerBenefitGrantAdsUpdateBenefitType - -## Example Usage - -```typescript -import { CustomerBenefitGrantAdsUpdateBenefitType } from "@polar-sh/sdk/models/components"; - -let value: CustomerBenefitGrantAdsUpdateBenefitType = "ads"; -``` - -## Values - -```typescript -"ads" -``` \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantcustom.md b/docs/models/components/customerbenefitgrantcustom.md index 518585aa..f441d9a3 100644 --- a/docs/models/components/customerbenefitgrantcustom.md +++ b/docs/models/components/customerbenefitgrantcustom.md @@ -6,41 +6,61 @@ import { CustomerBenefitGrantCustom } from "@polar-sh/sdk/models/components"; let value: CustomerBenefitGrantCustom = { - createdAt: new Date("2023-06-25T00:22:07.985Z"), - modifiedAt: new Date("2023-09-08T14:21:20.970Z"), + createdAt: new Date("2024-06-15T18:30:15.527Z"), + modifiedAt: new Date("2025-03-27T12:26:38.918Z"), id: "", - grantedAt: new Date("2024-05-23T09:35:37.185Z"), - revokedAt: new Date("2024-08-12T20:17:45.476Z"), + grantedAt: new Date("2025-04-26T21:53:34.696Z"), + revokedAt: new Date("2023-01-14T06:47:19.215Z"), customerId: "", benefitId: "", subscriptionId: "", orderId: "", isGranted: false, isRevoked: false, + customer: { + createdAt: new Date("2023-02-11T11:01:25.106Z"), + modifiedAt: new Date("2024-06-07T09:44:26.832Z"), + id: "", + email: "Cristopher26@hotmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Saint Lucia", + }, + taxId: [ + "ca_pst_bc", + ], + oauthAccounts: { + "key": { + accountId: "", + accountUsername: "", + }, + }, + }, benefit: { - createdAt: new Date("2024-04-17T01:09:14.302Z"), - modifiedAt: new Date("2022-10-11T20:38:52.127Z"), + createdAt: new Date("2025-09-10T13:02:30.656Z"), + modifiedAt: new Date("2023-03-04T10:48:40.423Z"), id: "", - description: "anesthetize unto agile", + description: "ew monasticism failing whether crazy vainly broken er", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2022-05-13T16:31:23.365Z"), - modifiedAt: new Date("2023-08-19T04:22:02.080Z"), + createdAt: new Date("2025-11-13T10:52:23.813Z"), + modifiedAt: new Date("2025-10-14T18:51:40.332Z"), id: "", name: "", slug: "", - avatarUrl: "https://legal-consistency.info", + avatarUrl: "https://perfumed-vestment.info", bio: "", - company: "Schneider - Littel", + company: "Kessler Inc", blog: "", location: "", - email: "Bruce_Mann70@yahoo.com", + email: "Kevin54@hotmail.com", twitterUsername: "", - pledgeMinimumAmount: 377797, + pledgeMinimumAmount: 459436, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 372038, + defaultUpfrontSplitToContributors: 625192, profileSettings: {}, featureSettings: {}, }, @@ -67,5 +87,6 @@ let value: CustomerBenefitGrantCustom = { | `orderId` | *string* | :heavy_check_mark: | N/A | | `isGranted` | *boolean* | :heavy_check_mark: | N/A | | `isRevoked` | *boolean* | :heavy_check_mark: | N/A | +| `customer` | [components.CustomerPortalCustomer](../../models/components/customerportalcustomer.md) | :heavy_check_mark: | N/A | | `benefit` | [components.BenefitCustomSubscriber](../../models/components/benefitcustomsubscriber.md) | :heavy_check_mark: | N/A | | `properties` | [components.BenefitGrantCustomProperties](../../models/components/benefitgrantcustomproperties.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantcustomupdate.md b/docs/models/components/customerbenefitgrantcustomupdate.md index 9ae7bcdb..2455d690 100644 --- a/docs/models/components/customerbenefitgrantcustomupdate.md +++ b/docs/models/components/customerbenefitgrantcustomupdate.md @@ -10,6 +10,6 @@ let value: CustomerBenefitGrantCustomUpdate = {}; ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------- | -| `benefitType` | [components.CustomerBenefitGrantCustomUpdateBenefitType](../../models/components/customerbenefitgrantcustomupdatebenefittype.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------ | ------------------ | ------------------ | ------------------ | +| `benefitType` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantcustomupdatebenefittype.md b/docs/models/components/customerbenefitgrantcustomupdatebenefittype.md deleted file mode 100644 index 3dbea6e0..00000000 --- a/docs/models/components/customerbenefitgrantcustomupdatebenefittype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomerBenefitGrantCustomUpdateBenefitType - -## Example Usage - -```typescript -import { CustomerBenefitGrantCustomUpdateBenefitType } from "@polar-sh/sdk/models/components"; - -let value: CustomerBenefitGrantCustomUpdateBenefitType = "custom"; -``` - -## Values - -```typescript -"custom" -``` \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantdiscord.md b/docs/models/components/customerbenefitgrantdiscord.md index 97e6b7b8..c35f7dc4 100644 --- a/docs/models/components/customerbenefitgrantdiscord.md +++ b/docs/models/components/customerbenefitgrantdiscord.md @@ -6,41 +6,61 @@ import { CustomerBenefitGrantDiscord } from "@polar-sh/sdk/models/components"; let value: CustomerBenefitGrantDiscord = { - createdAt: new Date("2023-08-31T00:49:01.651Z"), - modifiedAt: new Date("2024-02-02T12:36:51.052Z"), + createdAt: new Date("2024-02-04T22:44:09.809Z"), + modifiedAt: new Date("2025-02-01T20:11:50.129Z"), id: "", - grantedAt: new Date("2024-10-26T12:43:46.379Z"), - revokedAt: new Date("2024-09-14T17:53:29.108Z"), + grantedAt: new Date("2025-06-25T06:53:42.834Z"), + revokedAt: new Date("2023-07-18T04:09:50.300Z"), customerId: "", benefitId: "", subscriptionId: "", orderId: "", isGranted: false, isRevoked: false, + customer: { + createdAt: new Date("2024-11-16T06:19:22.427Z"), + modifiedAt: new Date("2023-06-24T21:14:12.329Z"), + id: "", + email: "Janis_Murazik39@gmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Ukraine", + }, + taxId: [ + "", + ], + oauthAccounts: { + "key": { + accountId: "", + accountUsername: "", + }, + }, + }, benefit: { - createdAt: new Date("2023-10-18T05:26:12.523Z"), - modifiedAt: new Date("2023-09-19T01:12:09.442Z"), + createdAt: new Date("2024-07-16T16:35:31.351Z"), + modifiedAt: new Date("2023-03-21T03:43:40.209Z"), id: "", - description: "manage what cutover", + description: "boastfully until hence", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2024-11-24T15:15:39.142Z"), - modifiedAt: new Date("2024-05-19T00:29:31.464Z"), + createdAt: new Date("2024-08-21T21:47:18.524Z"), + modifiedAt: new Date("2025-08-19T03:07:08.900Z"), id: "", name: "", slug: "", - avatarUrl: "https://shiny-instance.com", + avatarUrl: "https://rusty-tusk.biz/", bio: "", - company: "Johns and Sons", + company: "Yost - Beatty", blog: "", location: "", - email: "Carole.Kuhlman31@gmail.com", + email: "Santino_Dare72@gmail.com", twitterUsername: "", - pledgeMinimumAmount: 633911, + pledgeMinimumAmount: 501792, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 920081, + defaultUpfrontSplitToContributors: 893477, profileSettings: {}, featureSettings: {}, }, @@ -67,5 +87,6 @@ let value: CustomerBenefitGrantDiscord = { | `orderId` | *string* | :heavy_check_mark: | N/A | | `isGranted` | *boolean* | :heavy_check_mark: | N/A | | `isRevoked` | *boolean* | :heavy_check_mark: | N/A | +| `customer` | [components.CustomerPortalCustomer](../../models/components/customerportalcustomer.md) | :heavy_check_mark: | N/A | | `benefit` | [components.BenefitDiscordSubscriber](../../models/components/benefitdiscordsubscriber.md) | :heavy_check_mark: | N/A | | `properties` | [components.BenefitGrantDiscordProperties](../../models/components/benefitgrantdiscordproperties.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantdiscordupdate.md b/docs/models/components/customerbenefitgrantdiscordupdate.md index 62e71126..db9dcc47 100644 --- a/docs/models/components/customerbenefitgrantdiscordupdate.md +++ b/docs/models/components/customerbenefitgrantdiscordupdate.md @@ -14,7 +14,7 @@ let value: CustomerBenefitGrantDiscordUpdate = { ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------------- | -| `benefitType` | [components.CustomerBenefitGrantDiscordUpdateBenefitType](../../models/components/customerbenefitgrantdiscordupdatebenefittype.md) | :heavy_check_mark: | N/A | -| `properties` | [components.CustomerBenefitGrantDiscordPropertiesUpdate](../../models/components/customerbenefitgrantdiscordpropertiesupdate.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| -------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------- | +| `benefitType` | *string* | :heavy_check_mark: | N/A | +| `properties` | [components.CustomerBenefitGrantDiscordPropertiesUpdate](../../models/components/customerbenefitgrantdiscordpropertiesupdate.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantdiscordupdatebenefittype.md b/docs/models/components/customerbenefitgrantdiscordupdatebenefittype.md deleted file mode 100644 index 268b69e3..00000000 --- a/docs/models/components/customerbenefitgrantdiscordupdatebenefittype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomerBenefitGrantDiscordUpdateBenefitType - -## Example Usage - -```typescript -import { CustomerBenefitGrantDiscordUpdateBenefitType } from "@polar-sh/sdk/models/components"; - -let value: CustomerBenefitGrantDiscordUpdateBenefitType = "discord"; -``` - -## Values - -```typescript -"discord" -``` \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantdownloadables.md b/docs/models/components/customerbenefitgrantdownloadables.md index 5f89ddd5..a6391e8b 100644 --- a/docs/models/components/customerbenefitgrantdownloadables.md +++ b/docs/models/components/customerbenefitgrantdownloadables.md @@ -6,42 +6,61 @@ import { CustomerBenefitGrantDownloadables } from "@polar-sh/sdk/models/components"; let value: CustomerBenefitGrantDownloadables = { - createdAt: new Date("2024-01-07T21:12:58.857Z"), - modifiedAt: new Date("2024-10-28T12:14:30.511Z"), + createdAt: new Date("2023-03-18T07:56:55.620Z"), + modifiedAt: new Date("2024-03-08T04:01:27.021Z"), id: "", - grantedAt: new Date("2024-01-27T14:58:29.591Z"), - revokedAt: new Date("2023-09-06T06:23:05.578Z"), + grantedAt: new Date("2023-05-17T22:22:57.707Z"), + revokedAt: new Date("2025-12-15T04:27:45.463Z"), customerId: "", benefitId: "", subscriptionId: "", orderId: "", isGranted: false, isRevoked: false, + customer: { + createdAt: new Date("2023-09-16T22:12:23.409Z"), + modifiedAt: new Date("2024-02-04T10:48:51.582Z"), + id: "", + email: "Karine_Kub35@gmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Bermuda", + }, + taxId: [ + "eu_vat", + ], + oauthAccounts: { + "key": { + accountId: "", + accountUsername: "", + }, + }, + }, benefit: { - createdAt: new Date("2022-06-22T06:14:18.657Z"), - modifiedAt: new Date("2024-10-06T12:45:51.755Z"), + createdAt: new Date("2025-08-15T11:30:59.577Z"), + modifiedAt: new Date("2024-11-10T04:29:42.756Z"), id: "", - description: - "conservation reassemble blacken boastfully until hence cafe scale populist ick", + description: "into unless video upwardly till ouch tuber soon", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2022-10-27T02:34:14.358Z"), - modifiedAt: new Date("2024-11-24T10:53:11.837Z"), + createdAt: new Date("2023-09-24T10:58:44.754Z"), + modifiedAt: new Date("2023-11-09T16:56:29.548Z"), id: "", name: "", slug: "", - avatarUrl: "https://sparse-sideboard.name/", + avatarUrl: "https://judicious-premier.com/", bio: "", - company: "McLaughlin, Mills and Connelly", + company: "Collins, Balistreri and Jacobson", blog: "", location: "", - email: "Candido.Hamill@hotmail.com", + email: "Faustino_Ondricka@hotmail.com", twitterUsername: "", - pledgeMinimumAmount: 844540, + pledgeMinimumAmount: 163795, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 496921, + defaultUpfrontSplitToContributors: 887499, profileSettings: {}, featureSettings: {}, }, @@ -70,5 +89,6 @@ let value: CustomerBenefitGrantDownloadables = { | `orderId` | *string* | :heavy_check_mark: | N/A | | `isGranted` | *boolean* | :heavy_check_mark: | N/A | | `isRevoked` | *boolean* | :heavy_check_mark: | N/A | +| `customer` | [components.CustomerPortalCustomer](../../models/components/customerportalcustomer.md) | :heavy_check_mark: | N/A | | `benefit` | [components.BenefitDownloadablesSubscriber](../../models/components/benefitdownloadablessubscriber.md) | :heavy_check_mark: | N/A | | `properties` | [components.BenefitGrantDownloadablesProperties](../../models/components/benefitgrantdownloadablesproperties.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantdownloadablesupdate.md b/docs/models/components/customerbenefitgrantdownloadablesupdate.md index ebdbb825..61c14e9d 100644 --- a/docs/models/components/customerbenefitgrantdownloadablesupdate.md +++ b/docs/models/components/customerbenefitgrantdownloadablesupdate.md @@ -10,6 +10,6 @@ let value: CustomerBenefitGrantDownloadablesUpdate = {}; ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------------------------- | -| `benefitType` | [components.CustomerBenefitGrantDownloadablesUpdateBenefitType](../../models/components/customerbenefitgrantdownloadablesupdatebenefittype.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------ | ------------------ | ------------------ | ------------------ | +| `benefitType` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantdownloadablesupdatebenefittype.md b/docs/models/components/customerbenefitgrantdownloadablesupdatebenefittype.md deleted file mode 100644 index 539d8667..00000000 --- a/docs/models/components/customerbenefitgrantdownloadablesupdatebenefittype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomerBenefitGrantDownloadablesUpdateBenefitType - -## Example Usage - -```typescript -import { CustomerBenefitGrantDownloadablesUpdateBenefitType } from "@polar-sh/sdk/models/components"; - -let value: CustomerBenefitGrantDownloadablesUpdateBenefitType = "downloadables"; -``` - -## Values - -```typescript -"downloadables" -``` \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantgithubrepository.md b/docs/models/components/customerbenefitgrantgithubrepository.md index 3f55350a..b679163b 100644 --- a/docs/models/components/customerbenefitgrantgithubrepository.md +++ b/docs/models/components/customerbenefitgrantgithubrepository.md @@ -6,42 +6,61 @@ import { CustomerBenefitGrantGitHubRepository } from "@polar-sh/sdk/models/components"; let value: CustomerBenefitGrantGitHubRepository = { - createdAt: new Date("2024-05-17T20:32:17.192Z"), - modifiedAt: new Date("2024-09-24T21:01:28.984Z"), + createdAt: new Date("2025-12-07T19:04:25.764Z"), + modifiedAt: new Date("2024-01-27T07:29:07.482Z"), id: "", - grantedAt: new Date("2023-09-15T18:42:51.260Z"), - revokedAt: new Date("2024-10-01T16:38:34.857Z"), + grantedAt: new Date("2024-05-03T23:37:31.406Z"), + revokedAt: new Date("2025-01-02T08:17:22.976Z"), customerId: "", benefitId: "", subscriptionId: "", orderId: "", isGranted: false, isRevoked: false, + customer: { + createdAt: new Date("2024-04-07T14:26:13.023Z"), + modifiedAt: new Date("2023-09-20T00:09:09.421Z"), + id: "", + email: "Dorthy.McKenzie78@gmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Uruguay", + }, + taxId: [ + "tw_vat", + ], + oauthAccounts: { + "key": { + accountId: "", + accountUsername: "", + }, + }, + }, benefit: { - createdAt: new Date("2023-04-03T00:06:33.908Z"), - modifiedAt: new Date("2024-06-08T19:18:02.881Z"), + createdAt: new Date("2025-08-28T23:23:26.430Z"), + modifiedAt: new Date("2025-08-28T06:03:19.788Z"), id: "", - description: - "fencing parsnip playfully convection unbearably supposing bleakly plumber marten", + description: "throughout for furthermore whopping dramatic glum", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2022-07-17T08:42:37.234Z"), - modifiedAt: new Date("2024-04-07T08:49:58.108Z"), + createdAt: new Date("2023-09-19T18:10:58.926Z"), + modifiedAt: new Date("2025-05-09T00:02:08.000Z"), id: "", name: "", slug: "", - avatarUrl: "https://agreeable-baseboard.com", + avatarUrl: "https://focused-fundraising.name/", bio: "", - company: "Gorczany - Pagac", + company: "Hammes Inc", blog: "", location: "", - email: "Savanna10@yahoo.com", + email: "Alaina.Kovacek@yahoo.com", twitterUsername: "", - pledgeMinimumAmount: 302321, + pledgeMinimumAmount: 839519, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 783395, + defaultUpfrontSplitToContributors: 774747, profileSettings: {}, featureSettings: {}, }, @@ -69,5 +88,6 @@ let value: CustomerBenefitGrantGitHubRepository = { | `orderId` | *string* | :heavy_check_mark: | N/A | | `isGranted` | *boolean* | :heavy_check_mark: | N/A | | `isRevoked` | *boolean* | :heavy_check_mark: | N/A | +| `customer` | [components.CustomerPortalCustomer](../../models/components/customerportalcustomer.md) | :heavy_check_mark: | N/A | | `benefit` | [components.BenefitGitHubRepositorySubscriber](../../models/components/benefitgithubrepositorysubscriber.md) | :heavy_check_mark: | N/A | | `properties` | [components.BenefitGrantGitHubRepositoryProperties](../../models/components/benefitgrantgithubrepositoryproperties.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantgithubrepositoryupdate.md b/docs/models/components/customerbenefitgrantgithubrepositoryupdate.md index 8a81f472..133b6e35 100644 --- a/docs/models/components/customerbenefitgrantgithubrepositoryupdate.md +++ b/docs/models/components/customerbenefitgrantgithubrepositoryupdate.md @@ -14,7 +14,7 @@ let value: CustomerBenefitGrantGitHubRepositoryUpdate = { ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------------------------------- | -| `benefitType` | [components.CustomerBenefitGrantGitHubRepositoryUpdateBenefitType](../../models/components/customerbenefitgrantgithubrepositoryupdatebenefittype.md) | :heavy_check_mark: | N/A | -| `properties` | [components.CustomerBenefitGrantGitHubRepositoryPropertiesUpdate](../../models/components/customerbenefitgrantgithubrepositorypropertiesupdate.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| -------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------- | +| `benefitType` | *string* | :heavy_check_mark: | N/A | +| `properties` | [components.CustomerBenefitGrantGitHubRepositoryPropertiesUpdate](../../models/components/customerbenefitgrantgithubrepositorypropertiesupdate.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantgithubrepositoryupdatebenefittype.md b/docs/models/components/customerbenefitgrantgithubrepositoryupdatebenefittype.md deleted file mode 100644 index 5f265f97..00000000 --- a/docs/models/components/customerbenefitgrantgithubrepositoryupdatebenefittype.md +++ /dev/null @@ -1,16 +0,0 @@ -# CustomerBenefitGrantGitHubRepositoryUpdateBenefitType - -## Example Usage - -```typescript -import { CustomerBenefitGrantGitHubRepositoryUpdateBenefitType } from "@polar-sh/sdk/models/components"; - -let value: CustomerBenefitGrantGitHubRepositoryUpdateBenefitType = - "github_repository"; -``` - -## Values - -```typescript -"github_repository" -``` \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantlicensekeys.md b/docs/models/components/customerbenefitgrantlicensekeys.md index 317a2abd..1d1e35e9 100644 --- a/docs/models/components/customerbenefitgrantlicensekeys.md +++ b/docs/models/components/customerbenefitgrantlicensekeys.md @@ -6,55 +6,76 @@ import { CustomerBenefitGrantLicenseKeys } from "@polar-sh/sdk/models/components"; let value: CustomerBenefitGrantLicenseKeys = { - createdAt: new Date("2024-07-08T23:51:54.681Z"), - modifiedAt: new Date("2022-01-25T17:10:29.427Z"), + createdAt: new Date("2024-08-06T08:14:46.348Z"), + modifiedAt: new Date("2023-03-01T08:59:33.586Z"), id: "", - grantedAt: new Date("2023-06-27T19:14:57.655Z"), - revokedAt: new Date("2022-03-21T17:23:21.308Z"), + grantedAt: new Date("2023-06-02T13:52:45.545Z"), + revokedAt: new Date("2025-09-26T07:23:43.790Z"), customerId: "", benefitId: "", subscriptionId: "", orderId: "", isGranted: false, isRevoked: false, + customer: { + createdAt: new Date("2025-08-17T20:38:44.628Z"), + modifiedAt: new Date("2025-06-13T01:35:49.200Z"), + id: "", + email: "Ford54@yahoo.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Kazakhstan", + }, + taxId: [ + "", + ], + oauthAccounts: { + "key": { + accountId: "", + accountUsername: "", + }, + }, + }, benefit: { - createdAt: new Date("2022-06-09T23:08:32.328Z"), - modifiedAt: new Date("2023-05-25T23:05:32.713Z"), + createdAt: new Date("2024-04-05T15:03:35.148Z"), + modifiedAt: new Date("2023-08-14T01:50:08.497Z"), id: "", - description: "limply near underneath midst", + description: + "priesthood individual entomb psst jaggedly kissingly forenenst marathon um", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2022-09-30T10:42:40.243Z"), - modifiedAt: new Date("2024-06-17T16:49:17.447Z"), + createdAt: new Date("2023-04-14T20:13:02.673Z"), + modifiedAt: new Date("2024-05-09T07:01:19.772Z"), id: "", name: "", slug: "", - avatarUrl: "https://adolescent-citizen.info/", + avatarUrl: "https://insecure-digestive.info", bio: "", - company: "Nolan - Donnelly", + company: "Bayer, Kuhn and Dickinson", blog: "", location: "", - email: "Adele.Hansen98@yahoo.com", + email: "Pablo17@gmail.com", twitterUsername: "", - pledgeMinimumAmount: 898686, + pledgeMinimumAmount: 408680, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 686368, + defaultUpfrontSplitToContributors: 182103, profileSettings: {}, featureSettings: {}, }, properties: { prefix: "", expires: { - ttl: 958567, - timeframe: "day", + ttl: 611180, + timeframe: "month", }, activations: { - limit: 878661, + limit: 388671, enableCustomerAdmin: false, }, - limitUsage: 577773, + limitUsage: 31468, }, }, properties: {}, @@ -76,5 +97,6 @@ let value: CustomerBenefitGrantLicenseKeys = { | `orderId` | *string* | :heavy_check_mark: | N/A | | `isGranted` | *boolean* | :heavy_check_mark: | N/A | | `isRevoked` | *boolean* | :heavy_check_mark: | N/A | +| `customer` | [components.CustomerPortalCustomer](../../models/components/customerportalcustomer.md) | :heavy_check_mark: | N/A | | `benefit` | [components.BenefitLicenseKeysSubscriber](../../models/components/benefitlicensekeyssubscriber.md) | :heavy_check_mark: | N/A | | `properties` | [components.BenefitGrantLicenseKeysProperties](../../models/components/benefitgrantlicensekeysproperties.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantlicensekeysupdate.md b/docs/models/components/customerbenefitgrantlicensekeysupdate.md index 52b201aa..6709143c 100644 --- a/docs/models/components/customerbenefitgrantlicensekeysupdate.md +++ b/docs/models/components/customerbenefitgrantlicensekeysupdate.md @@ -10,6 +10,6 @@ let value: CustomerBenefitGrantLicenseKeysUpdate = {}; ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------------------------ | -| `benefitType` | [components.CustomerBenefitGrantLicenseKeysUpdateBenefitType](../../models/components/customerbenefitgrantlicensekeysupdatebenefittype.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------ | ------------------ | ------------------ | ------------------ | +| `benefitType` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantlicensekeysupdatebenefittype.md b/docs/models/components/customerbenefitgrantlicensekeysupdatebenefittype.md deleted file mode 100644 index ebd8216d..00000000 --- a/docs/models/components/customerbenefitgrantlicensekeysupdatebenefittype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomerBenefitGrantLicenseKeysUpdateBenefitType - -## Example Usage - -```typescript -import { CustomerBenefitGrantLicenseKeysUpdateBenefitType } from "@polar-sh/sdk/models/components"; - -let value: CustomerBenefitGrantLicenseKeysUpdateBenefitType = "license_keys"; -``` - -## Values - -```typescript -"license_keys" -``` \ No newline at end of file diff --git a/docs/models/components/customerbenefitgrantsortproperty.md b/docs/models/components/customerbenefitgrantsortproperty.md index 7d9e8ff0..719b1e4d 100644 --- a/docs/models/components/customerbenefitgrantsortproperty.md +++ b/docs/models/components/customerbenefitgrantsortproperty.md @@ -5,7 +5,7 @@ ```typescript import { CustomerBenefitGrantSortProperty } from "@polar-sh/sdk/models/components"; -let value: CustomerBenefitGrantSortProperty = "type"; +let value: CustomerBenefitGrantSortProperty = "organization"; ``` ## Values diff --git a/docs/models/components/customercreate.md b/docs/models/components/customercreate.md index f4f79391..0ff86159 100644 --- a/docs/models/components/customercreate.md +++ b/docs/models/components/customercreate.md @@ -6,7 +6,7 @@ import { CustomerCreate } from "@polar-sh/sdk/models/components"; let value: CustomerCreate = { - email: "Caleb.Larson71@gmail.com", + email: "Tierra61@gmail.com", }; ``` diff --git a/docs/models/components/customercreatetaxid.md b/docs/models/components/customercreatetaxid.md index 6f16b4a9..b7b81905 100644 --- a/docs/models/components/customercreatetaxid.md +++ b/docs/models/components/customercreatetaxid.md @@ -12,6 +12,6 @@ const value: string = ""; ### `components.TaxIDFormat` ```typescript -const value: components.TaxIDFormat = "gb_vat"; +const value: components.TaxIDFormat = "mx_rfc"; ``` diff --git a/docs/models/components/customermetadata1.md b/docs/models/components/customermetadata1.md index c8eb5c9e..bc9ae8fa 100644 --- a/docs/models/components/customermetadata1.md +++ b/docs/models/components/customermetadata1.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 617440; +const value: number = 283619; ``` ### `boolean` diff --git a/docs/models/components/customerorder.md b/docs/models/components/customerorder.md index 22255d5b..cfbc2730 100644 --- a/docs/models/components/customerorder.md +++ b/docs/models/components/customerorder.md @@ -6,47 +6,43 @@ import { CustomerOrder } from "@polar-sh/sdk/models/components"; let value: CustomerOrder = { - createdAt: new Date("2024-06-16T23:00:03.457Z"), - modifiedAt: new Date("2022-03-25T21:04:22.867Z"), + createdAt: new Date("2025-03-01T10:44:40.614Z"), + modifiedAt: new Date("2023-08-25T14:51:17.867Z"), id: "", - amount: 22523, - taxAmount: 460636, - currency: "Venezuelan bolívar", + amount: 625659, + taxAmount: 581991, + currency: "North Korean Won", customerId: "", productId: "", productPriceId: "", subscriptionId: "", userId: "", product: { - createdAt: new Date("2024-03-02T17:01:51.399Z"), - modifiedAt: new Date("2024-12-31T07:50:18.161Z"), + createdAt: new Date("2025-06-14T07:55:46.836Z"), + modifiedAt: new Date("2023-09-02T02:21:11.091Z"), id: "", name: "", - description: "concerning obedient er jeopardise or yet shovel ouch", + description: "minority absent bathhouse maul excluding exotic", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2024-11-11T15:10:16.010Z"), - modifiedAt: new Date("2024-12-14T21:14:15.864Z"), + createdAt: new Date("2025-08-20T00:50:52.223Z"), + modifiedAt: new Date("2024-02-22T21:24:01.011Z"), id: "", isArchived: false, productId: "", - priceCurrency: "", - minimumAmount: 578404, - maximumAmount: 14318, - presetAmount: 839896, - recurringInterval: "year", }, ], benefits: [ { - createdAt: new Date("2022-01-28T01:12:49.790Z"), - modifiedAt: new Date("2024-04-09T07:14:03.361Z"), + createdAt: new Date("2024-08-16T02:43:11.535Z"), + modifiedAt: new Date("2025-07-16T04:08:55.447Z"), id: "", type: "downloadables", - description: "miserable actually truthfully", + description: + "qua hence meaningfully beside doorpost yuck glimmer while", selectable: false, deletable: false, organizationId: "", @@ -57,63 +53,62 @@ let value: CustomerOrder = { id: "", organizationId: "", name: "", - path: "/boot/defaults", + path: "/usr/share", mimeType: "", - size: 615622, + size: 606816, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2023-01-19T03:04:57.148Z"), + lastModifiedAt: new Date("2024-02-12T10:28:51.314Z"), version: "", isUploaded: false, - createdAt: new Date("2023-08-25T10:22:25.518Z"), + createdAt: new Date("2024-02-09T12:38:41.237Z"), sizeReadable: "", - publicUrl: "https://enraged-spear.net/", + publicUrl: "https://grounded-developmental.name/", }, ], organization: { - createdAt: new Date("2024-07-25T08:12:52.029Z"), - modifiedAt: new Date("2023-06-09T07:31:01.739Z"), + createdAt: new Date("2025-02-28T07:10:49.167Z"), + modifiedAt: new Date("2023-11-17T11:56:31.982Z"), id: "", name: "", slug: "", - avatarUrl: "https://lavish-digit.com", + avatarUrl: "https://splendid-pants.net", bio: "", - company: "Predovic, Sauer and Blanda", + company: "Nicolas - Goodwin", blog: "", location: "", - email: "Caden_Runolfsdottir68@hotmail.com", + email: "Donato34@gmail.com", twitterUsername: "", - pledgeMinimumAmount: 657791, + pledgeMinimumAmount: 134627, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 108590, + defaultUpfrontSplitToContributors: 215724, profileSettings: {}, featureSettings: {}, }, }, productPrice: { - createdAt: new Date("2023-04-27T19:22:43.071Z"), - modifiedAt: new Date("2024-09-20T00:35:40.151Z"), + createdAt: new Date("2024-08-03T05:37:09.894Z"), + modifiedAt: new Date("2024-06-03T20:31:20.070Z"), id: "", isArchived: false, productId: "", - priceCurrency: "", - priceAmount: 795428, + recurringInterval: "month", }, subscription: { - createdAt: new Date("2022-02-11T18:46:03.521Z"), - modifiedAt: new Date("2023-06-20T09:39:58.377Z"), + createdAt: new Date("2025-11-19T15:09:26.906Z"), + modifiedAt: new Date("2025-07-14T02:36:39.601Z"), id: "", - amount: 525146, - currency: "Manat", + amount: 820374, + currency: "Tanzanian Shilling", recurringInterval: "year", status: "incomplete", - currentPeriodStart: new Date("2023-04-06T00:36:00.465Z"), - currentPeriodEnd: new Date("2023-12-25T13:54:38.176Z"), + currentPeriodStart: new Date("2025-11-30T18:08:12.857Z"), + currentPeriodEnd: new Date("2025-10-20T08:31:50.564Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2024-12-18T21:15:28.785Z"), - endedAt: new Date("2023-02-25T22:57:12.478Z"), + startedAt: new Date("2025-02-01T21:36:44.416Z"), + endedAt: new Date("2023-11-17T01:02:55.807Z"), customerId: "", productId: "", priceId: "", diff --git a/docs/models/components/customerorderinvoice.md b/docs/models/components/customerorderinvoice.md index 136cab73..b9efcd3c 100644 --- a/docs/models/components/customerorderinvoice.md +++ b/docs/models/components/customerorderinvoice.md @@ -8,7 +8,7 @@ Order's invoice data. import { CustomerOrderInvoice } from "@polar-sh/sdk/models/components"; let value: CustomerOrderInvoice = { - url: "https://necessary-anticodon.org/", + url: "https://wilted-surface.org", }; ``` diff --git a/docs/models/components/customerorderproduct.md b/docs/models/components/customerorderproduct.md index 963e9b45..eaccfa10 100644 --- a/docs/models/components/customerorderproduct.md +++ b/docs/models/components/customerorderproduct.md @@ -6,32 +6,33 @@ import { CustomerOrderProduct } from "@polar-sh/sdk/models/components"; let value: CustomerOrderProduct = { - createdAt: new Date("2023-07-09T21:40:19.769Z"), - modifiedAt: new Date("2022-09-12T04:43:40.792Z"), + createdAt: new Date("2025-09-01T19:47:14.357Z"), + modifiedAt: new Date("2025-05-19T07:19:58.851Z"), id: "", name: "", - description: - "ugh conversation er vice outnumber daily but triumphantly team yum", + description: "than indeed hassle", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2023-03-25T14:39:48.268Z"), - modifiedAt: new Date("2024-06-13T13:52:47.549Z"), + createdAt: new Date("2025-03-25T22:52:07.722Z"), + modifiedAt: new Date("2024-03-31T06:40:04.841Z"), id: "", isArchived: false, productId: "", + priceCurrency: "", + priceAmount: 151092, + recurringInterval: "year", }, ], benefits: [ { - createdAt: new Date("2022-01-13T15:47:28.412Z"), - modifiedAt: new Date("2024-05-13T07:35:58.550Z"), + createdAt: new Date("2024-11-29T23:56:50.889Z"), + modifiedAt: new Date("2024-06-04T01:21:54.034Z"), id: "", - type: "github_repository", - description: - "negligible yearly headline arrogantly priesthood absentmindedly knickers forenenst shudder", + type: "discord", + description: "collectivization geez discrete gym aha", selectable: false, deletable: false, organizationId: "", @@ -42,37 +43,37 @@ let value: CustomerOrderProduct = { id: "", organizationId: "", name: "", - path: "/usr/sbin", + path: "/Library", mimeType: "", - size: 944836, + size: 132707, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-11-29T02:24:30.639Z"), + lastModifiedAt: new Date("2024-09-17T16:51:01.606Z"), version: "", isUploaded: false, - createdAt: new Date("2024-05-05T03:19:00.639Z"), + createdAt: new Date("2025-10-06T18:59:00.388Z"), sizeReadable: "", - publicUrl: "https://moral-disadvantage.com", + publicUrl: "https://radiant-strait.net", }, ], organization: { - createdAt: new Date("2024-04-12T13:54:50.989Z"), - modifiedAt: new Date("2022-06-02T04:11:20.372Z"), + createdAt: new Date("2024-02-17T00:44:13.481Z"), + modifiedAt: new Date("2025-05-30T10:39:49.151Z"), id: "", name: "", slug: "", - avatarUrl: "https://fuzzy-heartbeat.org/", + avatarUrl: "https://trusting-language.name/", bio: "", - company: "Veum and Sons", + company: "Parker, Blick and Fritsch", blog: "", location: "", - email: "Emilie97@gmail.com", + email: "Augusta_Gislason@hotmail.com", twitterUsername: "", - pledgeMinimumAmount: 611872, + pledgeMinimumAmount: 426373, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 46238, + defaultUpfrontSplitToContributors: 73292, profileSettings: {}, featureSettings: {}, }, diff --git a/docs/models/components/customerordersortproperty.md b/docs/models/components/customerordersortproperty.md index c6e15550..344e1bde 100644 --- a/docs/models/components/customerordersortproperty.md +++ b/docs/models/components/customerordersortproperty.md @@ -5,7 +5,7 @@ ```typescript import { CustomerOrderSortProperty } from "@polar-sh/sdk/models/components"; -let value: CustomerOrderSortProperty = "-organization"; +let value: CustomerOrderSortProperty = "organization"; ``` ## Values diff --git a/docs/models/components/customerordersubscription.md b/docs/models/components/customerordersubscription.md index b71c4212..b2f13d98 100644 --- a/docs/models/components/customerordersubscription.md +++ b/docs/models/components/customerordersubscription.md @@ -6,18 +6,18 @@ import { CustomerOrderSubscription } from "@polar-sh/sdk/models/components"; let value: CustomerOrderSubscription = { - createdAt: new Date("2024-12-15T02:44:28.054Z"), - modifiedAt: new Date("2023-08-25T13:14:09.111Z"), + createdAt: new Date("2023-01-02T05:13:35.742Z"), + modifiedAt: new Date("2024-06-16T12:06:28.738Z"), id: "", - amount: 463754, - currency: "Jamaican Dollar", - recurringInterval: "year", - status: "trialing", - currentPeriodStart: new Date("2023-02-25T06:56:31.249Z"), - currentPeriodEnd: new Date("2024-12-08T01:45:26.161Z"), + amount: 594804, + currency: "Zimbabwe Dollar", + recurringInterval: "month", + status: "incomplete", + currentPeriodStart: new Date("2024-04-12T05:52:48.696Z"), + currentPeriodEnd: new Date("2025-04-03T01:09:08.894Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2023-06-26T23:32:50.164Z"), - endedAt: new Date("2024-05-05T02:04:56.941Z"), + startedAt: new Date("2024-01-08T17:12:35.810Z"), + endedAt: new Date("2024-12-26T22:43:26.713Z"), customerId: "", productId: "", priceId: "", diff --git a/docs/models/components/customerportalcustomer.md b/docs/models/components/customerportalcustomer.md index e5d6caa6..b59c0cab 100644 --- a/docs/models/components/customerportalcustomer.md +++ b/docs/models/components/customerportalcustomer.md @@ -6,17 +6,17 @@ import { CustomerPortalCustomer } from "@polar-sh/sdk/models/components"; let value: CustomerPortalCustomer = { - createdAt: new Date("2024-07-02T23:26:34.630Z"), - modifiedAt: new Date("2023-08-26T16:42:10.981Z"), + createdAt: new Date("2023-06-09T10:36:15.974Z"), + modifiedAt: new Date("2025-07-08T23:51:54.681Z"), id: "", - email: "Heather2@yahoo.com", + email: "Jerome.Corkery@gmail.com", emailVerified: false, name: "", billingAddress: { - country: "Benin", + country: "Guinea-Bissau", }, taxId: [ - "", + "my_sst", ], oauthAccounts: { "key": { diff --git a/docs/models/components/customerportalcustomertaxid.md b/docs/models/components/customerportalcustomertaxid.md index 11ac106c..a67b21f8 100644 --- a/docs/models/components/customerportalcustomertaxid.md +++ b/docs/models/components/customerportalcustomertaxid.md @@ -12,6 +12,6 @@ const value: string = ""; ### `components.TaxIDFormat` ```typescript -const value: components.TaxIDFormat = "ca_pst_sk"; +const value: components.TaxIDFormat = "ca_pst_bc"; ``` diff --git a/docs/models/components/customersession.md b/docs/models/components/customersession.md index 664bdfc2..6667e401 100644 --- a/docs/models/components/customersession.md +++ b/docs/models/components/customersession.md @@ -8,30 +8,31 @@ A customer session that can be used to authenticate as a customer. import { CustomerSession } from "@polar-sh/sdk/models/components"; let value: CustomerSession = { - createdAt: new Date("2023-02-02T05:55:21.427Z"), - modifiedAt: new Date("2023-04-22T14:18:59.007Z"), + createdAt: new Date("2023-09-02T17:34:26.813Z"), + modifiedAt: new Date("2025-01-04T04:06:45.165Z"), id: "", token: "", - expiresAt: new Date("2024-12-07T04:48:23.043Z"), + expiresAt: new Date("2025-05-20T00:02:58.462Z"), + customerPortalUrl: "https://glass-rawhide.biz/", customerId: "", customer: { - createdAt: new Date("2023-08-31T05:51:37.577Z"), - modifiedAt: new Date("2024-06-02T04:49:52.259Z"), + createdAt: new Date("2025-08-12T00:35:57.398Z"), + modifiedAt: new Date("2023-11-19T02:09:16.945Z"), id: "", metadata: { - "key": false, + "key": "", }, - email: "Araceli34@yahoo.com", + email: "Elinore_Greenholt@yahoo.com", emailVerified: false, name: "", billingAddress: { - country: "Tonga", + country: "Trinidad and Tobago", }, taxId: [ - "sv_nit", + "", ], organizationId: "", - avatarUrl: "https://staid-awareness.net/", + avatarUrl: "https://sniveling-fork.net", }, }; ``` @@ -45,5 +46,6 @@ let value: CustomerSession = { | `id` | *string* | :heavy_check_mark: | The ID of the object. | | `token` | *string* | :heavy_check_mark: | N/A | | `expiresAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | N/A | +| `customerPortalUrl` | *string* | :heavy_check_mark: | N/A | | `customerId` | *string* | :heavy_check_mark: | N/A | | `customer` | [components.Customer](../../models/components/customer.md) | :heavy_check_mark: | A customer in an organization. | \ No newline at end of file diff --git a/docs/models/components/customersubscription.md b/docs/models/components/customersubscription.md index 0139d118..06ce34a5 100644 --- a/docs/models/components/customersubscription.md +++ b/docs/models/components/customersubscription.md @@ -6,18 +6,18 @@ import { CustomerSubscription } from "@polar-sh/sdk/models/components"; let value: CustomerSubscription = { - createdAt: new Date("2023-08-22T13:51:49.769Z"), - modifiedAt: new Date("2024-05-12T15:20:34.562Z"), + createdAt: new Date("2024-09-23T07:45:05.288Z"), + modifiedAt: new Date("2023-07-08T20:56:24.426Z"), id: "", - amount: 641904, - currency: "Seychelles Rupee", + amount: 951614, + currency: "Yuan Renminbi", recurringInterval: "month", - status: "past_due", - currentPeriodStart: new Date("2022-10-28T01:37:21.257Z"), - currentPeriodEnd: new Date("2022-09-10T21:39:48.507Z"), + status: "trialing", + currentPeriodStart: new Date("2024-04-21T14:18:59.007Z"), + currentPeriodEnd: new Date("2025-12-07T04:48:23.043Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2022-10-24T22:44:03.087Z"), - endedAt: new Date("2023-02-06T17:05:13.398Z"), + startedAt: new Date("2024-08-30T05:51:37.577Z"), + endedAt: new Date("2025-06-02T04:49:52.259Z"), customerId: "", productId: "", priceId: "", @@ -25,35 +25,34 @@ let value: CustomerSubscription = { checkoutId: "", userId: "", product: { - createdAt: new Date("2023-06-01T03:37:00.180Z"), - modifiedAt: new Date("2022-09-09T06:29:34.747Z"), + createdAt: new Date("2025-04-22T19:20:53.019Z"), + modifiedAt: new Date("2024-03-16T20:09:33.162Z"), id: "", name: "", - description: "gah clone mythology gadzooks phew", + description: "tough reboot terribly", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2023-11-06T00:23:38.763Z"), - modifiedAt: new Date("2022-06-21T16:09:43.950Z"), + createdAt: new Date("2023-04-26T00:53:32.713Z"), + modifiedAt: new Date("2023-03-14T09:10:45.829Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - minimumAmount: 914823, - maximumAmount: 58501, - presetAmount: 919235, - recurringInterval: "month", + minimumAmount: 383981, + maximumAmount: 925252, + presetAmount: 226263, }, ], benefits: [ { - createdAt: new Date("2024-09-14T08:29:02.551Z"), - modifiedAt: new Date("2023-02-08T05:00:10.593Z"), + createdAt: new Date("2024-04-07T18:37:14.280Z"), + modifiedAt: new Date("2024-12-04T06:57:20.808Z"), id: "", - type: "downloadables", - description: "advancement frizz brr finally radiant ack", + type: "discord", + description: "descriptive seemingly allegation", selectable: false, deletable: false, organizationId: "", @@ -64,50 +63,52 @@ let value: CustomerSubscription = { id: "", organizationId: "", name: "", - path: "/opt/lib", + path: "/opt/include", mimeType: "", - size: 260492, + size: 306995, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-08-01T16:49:07.186Z"), + lastModifiedAt: new Date("2024-04-17T22:12:43.442Z"), version: "", isUploaded: false, - createdAt: new Date("2023-09-12T19:42:53.732Z"), + createdAt: new Date("2025-02-15T18:50:40.902Z"), sizeReadable: "", - publicUrl: "https://unique-folklore.info/", + publicUrl: "https://lone-seafood.biz/", }, ], organization: { - createdAt: new Date("2022-10-10T03:49:19.883Z"), - modifiedAt: new Date("2022-05-26T10:44:18.933Z"), + createdAt: new Date("2025-08-04T14:21:14.678Z"), + modifiedAt: new Date("2025-10-19T12:33:56.667Z"), id: "", name: "", slug: "", - avatarUrl: "https://utilized-pasta.name", + avatarUrl: "https://clean-parsnip.name/", bio: "", - company: "Prohaska, Hirthe and Schmitt", + company: "Schmitt, Kuvalis and Bernhard", blog: "", location: "", - email: "Saul_Lockman68@gmail.com", + email: "Isidro_Welch@gmail.com", twitterUsername: "", - pledgeMinimumAmount: 252906, + pledgeMinimumAmount: 80782, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 710767, + defaultUpfrontSplitToContributors: 249688, profileSettings: {}, featureSettings: {}, }, }, price: { - createdAt: new Date("2022-10-17T00:01:30.572Z"), - modifiedAt: new Date("2024-02-15T15:33:57.970Z"), + createdAt: new Date("2023-07-09T02:51:12.374Z"), + modifiedAt: new Date("2025-01-12T04:38:24.107Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - priceAmount: 51623, - recurringInterval: "month", + minimumAmount: 117649, + maximumAmount: 894127, + presetAmount: 626437, + recurringInterval: "year", }, }; ``` diff --git a/docs/models/components/customersubscriptionproduct.md b/docs/models/components/customersubscriptionproduct.md index 00de5122..6bcbe049 100644 --- a/docs/models/components/customersubscriptionproduct.md +++ b/docs/models/components/customersubscriptionproduct.md @@ -6,35 +6,36 @@ import { CustomerSubscriptionProduct } from "@polar-sh/sdk/models/components"; let value: CustomerSubscriptionProduct = { - createdAt: new Date("2023-04-13T07:18:48.482Z"), - modifiedAt: new Date("2022-03-22T07:53:37.413Z"), + createdAt: new Date("2023-07-25T05:59:40.299Z"), + modifiedAt: new Date("2025-03-22T23:51:41.745Z"), id: "", name: "", - description: "quizzically along about patroller what aw", + description: "powerful how stoop that", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2023-04-20T19:40:49.785Z"), - modifiedAt: new Date("2023-05-20T04:29:31.559Z"), + createdAt: new Date("2025-09-25T07:48:45.694Z"), + modifiedAt: new Date("2024-11-05T05:19:19.160Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - minimumAmount: 401780, - maximumAmount: 87393, - presetAmount: 159143, + minimumAmount: 184043, + maximumAmount: 306162, + presetAmount: 351558, recurringInterval: "month", }, ], benefits: [ { - createdAt: new Date("2023-02-28T15:59:22.619Z"), - modifiedAt: new Date("2024-12-28T09:14:27.366Z"), + createdAt: new Date("2025-01-20T02:39:15.832Z"), + modifiedAt: new Date("2025-11-07T04:52:23.286Z"), id: "", - type: "downloadables", - description: "since likewise lumpy while musty usually mortar", + type: "github_repository", + description: + "freely whose hmph bitterly punctually instead baritone pneumonia frantically", selectable: false, deletable: false, organizationId: "", @@ -45,37 +46,37 @@ let value: CustomerSubscriptionProduct = { id: "", organizationId: "", name: "", - path: "/usr/ports", + path: "/etc/defaults", mimeType: "", - size: 331335, + size: 518508, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-01-10T19:30:49.833Z"), + lastModifiedAt: new Date("2025-02-03T19:42:51.470Z"), version: "", isUploaded: false, - createdAt: new Date("2024-12-21T06:53:31.334Z"), + createdAt: new Date("2023-04-16T16:44:01.041Z"), sizeReadable: "", - publicUrl: "https://cheap-recommendation.biz/", + publicUrl: "https://alienated-precedent.org", }, ], organization: { - createdAt: new Date("2022-07-04T15:05:09.060Z"), - modifiedAt: new Date("2022-05-10T20:46:28.355Z"), + createdAt: new Date("2024-05-15T14:47:43.808Z"), + modifiedAt: new Date("2023-03-14T05:11:25.734Z"), id: "", name: "", slug: "", - avatarUrl: "https://yellowish-grandpa.net", + avatarUrl: "https://crazy-knickers.biz/", bio: "", - company: "Jones Group", + company: "Johnston, Howell and Bergnaum", blog: "", location: "", - email: "Alessia_Jast-Mayert57@yahoo.com", + email: "Bradley.Gusikowski83@yahoo.com", twitterUsername: "", - pledgeMinimumAmount: 951614, + pledgeMinimumAmount: 483005, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 187940, + defaultUpfrontSplitToContributors: 289062, profileSettings: {}, featureSettings: {}, }, diff --git a/docs/models/components/customersubscriptionsortproperty.md b/docs/models/components/customersubscriptionsortproperty.md index 1e379876..d99bccf8 100644 --- a/docs/models/components/customersubscriptionsortproperty.md +++ b/docs/models/components/customersubscriptionsortproperty.md @@ -5,7 +5,7 @@ ```typescript import { CustomerSubscriptionSortProperty } from "@polar-sh/sdk/models/components"; -let value: CustomerSubscriptionSortProperty = "-started_at"; +let value: CustomerSubscriptionSortProperty = "amount"; ``` ## Values diff --git a/docs/models/components/customertaxid.md b/docs/models/components/customertaxid.md index 352c3885..abe889c8 100644 --- a/docs/models/components/customertaxid.md +++ b/docs/models/components/customertaxid.md @@ -12,6 +12,6 @@ const value: string = ""; ### `components.TaxIDFormat` ```typescript -const value: components.TaxIDFormat = "ad_nrt"; +const value: components.TaxIDFormat = "cn_tin"; ``` diff --git a/docs/models/components/customerupdatetaxid.md b/docs/models/components/customerupdatetaxid.md index dd4cca17..2babada5 100644 --- a/docs/models/components/customerupdatetaxid.md +++ b/docs/models/components/customerupdatetaxid.md @@ -12,6 +12,6 @@ const value: string = ""; ### `components.TaxIDFormat` ```typescript -const value: components.TaxIDFormat = "ge_vat"; +const value: components.TaxIDFormat = "il_vat"; ``` diff --git a/docs/models/components/customfield.md b/docs/models/components/customfield.md index 24b7243e..957e9a2c 100644 --- a/docs/models/components/customfield.md +++ b/docs/models/components/customfield.md @@ -7,8 +7,8 @@ ```typescript const value: components.CustomFieldCheckbox = { - createdAt: new Date("2022-09-21T01:29:35.775Z"), - modifiedAt: new Date("2022-06-25T22:48:47.472Z"), + createdAt: new Date("2023-09-21T01:29:35.775Z"), + modifiedAt: new Date("2023-06-25T22:48:47.472Z"), id: "", metadata: { "key": false, @@ -24,8 +24,8 @@ const value: components.CustomFieldCheckbox = { ```typescript const value: components.CustomFieldDate = { - createdAt: new Date("2024-11-17T05:55:05.975Z"), - modifiedAt: new Date("2023-05-18T02:53:01.364Z"), + createdAt: new Date("2025-11-17T05:55:05.975Z"), + modifiedAt: new Date("2024-05-17T02:53:01.364Z"), id: "", metadata: { "key": 857723, @@ -41,8 +41,8 @@ const value: components.CustomFieldDate = { ```typescript const value: components.CustomFieldNumber = { - createdAt: new Date("2023-05-17T02:48:20.581Z"), - modifiedAt: new Date("2024-11-09T06:06:22.459Z"), + createdAt: new Date("2024-05-16T02:48:20.581Z"), + modifiedAt: new Date("2025-11-09T06:06:22.459Z"), id: "", metadata: { "key": 820767, @@ -58,8 +58,8 @@ const value: components.CustomFieldNumber = { ```typescript const value: components.CustomFieldSelect = { - createdAt: new Date("2024-09-23T02:13:30.609Z"), - modifiedAt: new Date("2024-06-12T19:32:18.704Z"), + createdAt: new Date("2025-09-23T02:13:30.609Z"), + modifiedAt: new Date("2025-06-12T19:32:18.704Z"), id: "", metadata: { "key": "", @@ -82,8 +82,8 @@ const value: components.CustomFieldSelect = { ```typescript const value: components.CustomFieldText = { - createdAt: new Date("2023-11-21T06:32:40.348Z"), - modifiedAt: new Date("2023-03-13T16:24:53.059Z"), + createdAt: new Date("2024-11-20T06:32:40.348Z"), + modifiedAt: new Date("2024-03-12T16:24:53.059Z"), id: "", metadata: { "key": "", diff --git a/docs/models/components/customfieldcheckbox.md b/docs/models/components/customfieldcheckbox.md index 6e0cb80a..0ad371ed 100644 --- a/docs/models/components/customfieldcheckbox.md +++ b/docs/models/components/customfieldcheckbox.md @@ -8,8 +8,8 @@ Schema for a custom field of type checkbox. import { CustomFieldCheckbox } from "@polar-sh/sdk/models/components"; let value: CustomFieldCheckbox = { - createdAt: new Date("2024-08-10T23:01:34.707Z"), - modifiedAt: new Date("2023-05-13T18:17:15.678Z"), + createdAt: new Date("2025-08-10T23:01:34.707Z"), + modifiedAt: new Date("2024-05-12T18:17:15.678Z"), id: "", metadata: { "key": "", @@ -29,7 +29,7 @@ let value: CustomFieldCheckbox = { | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the object. | | `metadata` | Record | :heavy_check_mark: | N/A | -| `type` | [components.CustomFieldCheckboxType](../../models/components/customfieldcheckboxtype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `slug` | *string* | :heavy_check_mark: | Identifier of the custom field. It'll be used as key when storing the value. | | `name` | *string* | :heavy_check_mark: | Name of the custom field. | | `organizationId` | *string* | :heavy_check_mark: | The ID of the organization owning the custom field. | diff --git a/docs/models/components/customfieldcheckboxtype.md b/docs/models/components/customfieldcheckboxtype.md deleted file mode 100644 index 92bc8219..00000000 --- a/docs/models/components/customfieldcheckboxtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldCheckboxType - -## Example Usage - -```typescript -import { CustomFieldCheckboxType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldCheckboxType = "checkbox"; -``` - -## Values - -```typescript -"checkbox" -``` \ No newline at end of file diff --git a/docs/models/components/customfieldcreatecheckbox.md b/docs/models/components/customfieldcreatecheckbox.md index 1f1a9b70..74e21ef1 100644 --- a/docs/models/components/customfieldcreatecheckbox.md +++ b/docs/models/components/customfieldcreatecheckbox.md @@ -19,7 +19,7 @@ let value: CustomFieldCreateCheckbox = { | Field | Type | Required | Description | | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | | `metadata` | Record | :heavy_minus_sign: | Key-value object allowing you to store additional information.

The key must be a string with a maximum length of **40 characters**.
The value must be either:

* A string with a maximum length of **500 characters**
* An integer
* A boolean

You can store up to **50 key-value pairs**. | -| `type` | [components.CustomFieldCreateCheckboxType](../../models/components/customfieldcreatecheckboxtype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `slug` | *string* | :heavy_check_mark: | Identifier of the custom field. It'll be used as key when storing the value. Must be unique across the organization.It can only contain ASCII letters, numbers and hyphens. | | `name` | *string* | :heavy_check_mark: | Name of the custom field. | | `organizationId` | *string* | :heavy_minus_sign: | The ID of the organization owning the custom field. **Required unless you use an organization token.** | diff --git a/docs/models/components/customfieldcreatecheckboxmetadata.md b/docs/models/components/customfieldcreatecheckboxmetadata.md index b4e650c3..e456ca16 100644 --- a/docs/models/components/customfieldcreatecheckboxmetadata.md +++ b/docs/models/components/customfieldcreatecheckboxmetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 833758; +const value: number = 615665; ``` ### `boolean` diff --git a/docs/models/components/customfieldcreatecheckboxtype.md b/docs/models/components/customfieldcreatecheckboxtype.md deleted file mode 100644 index f3bccf17..00000000 --- a/docs/models/components/customfieldcreatecheckboxtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldCreateCheckboxType - -## Example Usage - -```typescript -import { CustomFieldCreateCheckboxType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldCreateCheckboxType = "checkbox"; -``` - -## Values - -```typescript -"checkbox" -``` \ No newline at end of file diff --git a/docs/models/components/customfieldcreatedate.md b/docs/models/components/customfieldcreatedate.md index bc1342d3..392bb1d0 100644 --- a/docs/models/components/customfieldcreatedate.md +++ b/docs/models/components/customfieldcreatedate.md @@ -19,7 +19,7 @@ let value: CustomFieldCreateDate = { | Field | Type | Required | Description | | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | | `metadata` | Record | :heavy_minus_sign: | Key-value object allowing you to store additional information.

The key must be a string with a maximum length of **40 characters**.
The value must be either:

* A string with a maximum length of **500 characters**
* An integer
* A boolean

You can store up to **50 key-value pairs**. | -| `type` | [components.CustomFieldCreateDateType](../../models/components/customfieldcreatedatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `slug` | *string* | :heavy_check_mark: | Identifier of the custom field. It'll be used as key when storing the value. Must be unique across the organization.It can only contain ASCII letters, numbers and hyphens. | | `name` | *string* | :heavy_check_mark: | Name of the custom field. | | `organizationId` | *string* | :heavy_minus_sign: | The ID of the organization owning the custom field. **Required unless you use an organization token.** | diff --git a/docs/models/components/customfieldcreatedatemetadata.md b/docs/models/components/customfieldcreatedatemetadata.md index 6aa013e2..cff22480 100644 --- a/docs/models/components/customfieldcreatedatemetadata.md +++ b/docs/models/components/customfieldcreatedatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 397657; +const value: number = 118794; ``` ### `boolean` diff --git a/docs/models/components/customfieldcreatedatetype.md b/docs/models/components/customfieldcreatedatetype.md deleted file mode 100644 index 060c34a4..00000000 --- a/docs/models/components/customfieldcreatedatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldCreateDateType - -## Example Usage - -```typescript -import { CustomFieldCreateDateType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldCreateDateType = "date"; -``` - -## Values - -```typescript -"date" -``` \ No newline at end of file diff --git a/docs/models/components/customfieldcreatenumber.md b/docs/models/components/customfieldcreatenumber.md index e2a50a49..1a35a29a 100644 --- a/docs/models/components/customfieldcreatenumber.md +++ b/docs/models/components/customfieldcreatenumber.md @@ -19,7 +19,7 @@ let value: CustomFieldCreateNumber = { | Field | Type | Required | Description | | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | | `metadata` | Record | :heavy_minus_sign: | Key-value object allowing you to store additional information.

The key must be a string with a maximum length of **40 characters**.
The value must be either:

* A string with a maximum length of **500 characters**
* An integer
* A boolean

You can store up to **50 key-value pairs**. | -| `type` | [components.CustomFieldCreateNumberType](../../models/components/customfieldcreatenumbertype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `slug` | *string* | :heavy_check_mark: | Identifier of the custom field. It'll be used as key when storing the value. Must be unique across the organization.It can only contain ASCII letters, numbers and hyphens. | | `name` | *string* | :heavy_check_mark: | Name of the custom field. | | `organizationId` | *string* | :heavy_minus_sign: | The ID of the organization owning the custom field. **Required unless you use an organization token.** | diff --git a/docs/models/components/customfieldcreatenumbermetadata.md b/docs/models/components/customfieldcreatenumbermetadata.md index 66b4197c..cf91a99e 100644 --- a/docs/models/components/customfieldcreatenumbermetadata.md +++ b/docs/models/components/customfieldcreatenumbermetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 368343; +const value: number = 883379; ``` ### `boolean` diff --git a/docs/models/components/customfieldcreatenumbertype.md b/docs/models/components/customfieldcreatenumbertype.md deleted file mode 100644 index 0a72a7ef..00000000 --- a/docs/models/components/customfieldcreatenumbertype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldCreateNumberType - -## Example Usage - -```typescript -import { CustomFieldCreateNumberType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldCreateNumberType = "number"; -``` - -## Values - -```typescript -"number" -``` \ No newline at end of file diff --git a/docs/models/components/customfieldcreateselect.md b/docs/models/components/customfieldcreateselect.md index 6af2d58d..fbca28c7 100644 --- a/docs/models/components/customfieldcreateselect.md +++ b/docs/models/components/customfieldcreateselect.md @@ -26,7 +26,7 @@ let value: CustomFieldCreateSelect = { | Field | Type | Required | Description | | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | | `metadata` | Record | :heavy_minus_sign: | Key-value object allowing you to store additional information.

The key must be a string with a maximum length of **40 characters**.
The value must be either:

* A string with a maximum length of **500 characters**
* An integer
* A boolean

You can store up to **50 key-value pairs**. | -| `type` | [components.CustomFieldCreateSelectType](../../models/components/customfieldcreateselecttype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `slug` | *string* | :heavy_check_mark: | Identifier of the custom field. It'll be used as key when storing the value. Must be unique across the organization.It can only contain ASCII letters, numbers and hyphens. | | `name` | *string* | :heavy_check_mark: | Name of the custom field. | | `organizationId` | *string* | :heavy_minus_sign: | The ID of the organization owning the custom field. **Required unless you use an organization token.** | diff --git a/docs/models/components/customfieldcreateselectmetadata.md b/docs/models/components/customfieldcreateselectmetadata.md index 52fd6c0f..e81b4821 100644 --- a/docs/models/components/customfieldcreateselectmetadata.md +++ b/docs/models/components/customfieldcreateselectmetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 509783; +const value: number = 619689; ``` ### `boolean` diff --git a/docs/models/components/customfieldcreateselecttype.md b/docs/models/components/customfieldcreateselecttype.md deleted file mode 100644 index d5085107..00000000 --- a/docs/models/components/customfieldcreateselecttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldCreateSelectType - -## Example Usage - -```typescript -import { CustomFieldCreateSelectType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldCreateSelectType = "select"; -``` - -## Values - -```typescript -"select" -``` \ No newline at end of file diff --git a/docs/models/components/customfieldcreatetext.md b/docs/models/components/customfieldcreatetext.md index 3ad4999b..d5994388 100644 --- a/docs/models/components/customfieldcreatetext.md +++ b/docs/models/components/customfieldcreatetext.md @@ -19,7 +19,7 @@ let value: CustomFieldCreateText = { | Field | Type | Required | Description | | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | | `metadata` | Record | :heavy_minus_sign: | Key-value object allowing you to store additional information.

The key must be a string with a maximum length of **40 characters**.
The value must be either:

* A string with a maximum length of **500 characters**
* An integer
* A boolean

You can store up to **50 key-value pairs**. | -| `type` | [components.CustomFieldCreateTextType](../../models/components/customfieldcreatetexttype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `slug` | *string* | :heavy_check_mark: | Identifier of the custom field. It'll be used as key when storing the value. Must be unique across the organization.It can only contain ASCII letters, numbers and hyphens. | | `name` | *string* | :heavy_check_mark: | Name of the custom field. | | `organizationId` | *string* | :heavy_minus_sign: | The ID of the organization owning the custom field. **Required unless you use an organization token.** | diff --git a/docs/models/components/customfieldcreatetextmetadata.md b/docs/models/components/customfieldcreatetextmetadata.md index e11eb325..e54b1a34 100644 --- a/docs/models/components/customfieldcreatetextmetadata.md +++ b/docs/models/components/customfieldcreatetextmetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 115028; +const value: number = 764666; ``` ### `boolean` diff --git a/docs/models/components/customfieldcreatetexttype.md b/docs/models/components/customfieldcreatetexttype.md deleted file mode 100644 index 90b61afc..00000000 --- a/docs/models/components/customfieldcreatetexttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldCreateTextType - -## Example Usage - -```typescript -import { CustomFieldCreateTextType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldCreateTextType = "text"; -``` - -## Values - -```typescript -"text" -``` \ No newline at end of file diff --git a/docs/models/components/customfielddate.md b/docs/models/components/customfielddate.md index 81a99778..e6050eeb 100644 --- a/docs/models/components/customfielddate.md +++ b/docs/models/components/customfielddate.md @@ -8,8 +8,8 @@ Schema for a custom field of type date. import { CustomFieldDate } from "@polar-sh/sdk/models/components"; let value: CustomFieldDate = { - createdAt: new Date("2023-03-16T18:43:47.673Z"), - modifiedAt: new Date("2024-10-15T12:04:53.187Z"), + createdAt: new Date("2024-03-15T18:43:47.673Z"), + modifiedAt: new Date("2025-10-15T12:04:53.187Z"), id: "", metadata: { "key": "", @@ -29,7 +29,7 @@ let value: CustomFieldDate = { | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the object. | | `metadata` | Record | :heavy_check_mark: | N/A | -| `type` | [components.CustomFieldDateType](../../models/components/customfielddatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `slug` | *string* | :heavy_check_mark: | Identifier of the custom field. It'll be used as key when storing the value. | | `name` | *string* | :heavy_check_mark: | Name of the custom field. | | `organizationId` | *string* | :heavy_check_mark: | The ID of the organization owning the custom field. | diff --git a/docs/models/components/customfielddatetype.md b/docs/models/components/customfielddatetype.md deleted file mode 100644 index f3de52c9..00000000 --- a/docs/models/components/customfielddatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldDateType - -## Example Usage - -```typescript -import { CustomFieldDateType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldDateType = "date"; -``` - -## Values - -```typescript -"date" -``` \ No newline at end of file diff --git a/docs/models/components/customfieldnumber.md b/docs/models/components/customfieldnumber.md index d4135434..6aa36ced 100644 --- a/docs/models/components/customfieldnumber.md +++ b/docs/models/components/customfieldnumber.md @@ -8,8 +8,8 @@ Schema for a custom field of type number. import { CustomFieldNumber } from "@polar-sh/sdk/models/components"; let value: CustomFieldNumber = { - createdAt: new Date("2023-01-25T11:37:19.885Z"), - modifiedAt: new Date("2023-01-26T22:49:04.962Z"), + createdAt: new Date("2024-01-25T11:37:19.885Z"), + modifiedAt: new Date("2024-01-26T22:49:04.962Z"), id: "", metadata: { "key": "", @@ -29,7 +29,7 @@ let value: CustomFieldNumber = { | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the object. | | `metadata` | Record | :heavy_check_mark: | N/A | -| `type` | [components.CustomFieldNumberType](../../models/components/customfieldnumbertype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `slug` | *string* | :heavy_check_mark: | Identifier of the custom field. It'll be used as key when storing the value. | | `name` | *string* | :heavy_check_mark: | Name of the custom field. | | `organizationId` | *string* | :heavy_check_mark: | The ID of the organization owning the custom field. | diff --git a/docs/models/components/customfieldnumbertype.md b/docs/models/components/customfieldnumbertype.md deleted file mode 100644 index d7462753..00000000 --- a/docs/models/components/customfieldnumbertype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldNumberType - -## Example Usage - -```typescript -import { CustomFieldNumberType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldNumberType = "number"; -``` - -## Values - -```typescript -"number" -``` \ No newline at end of file diff --git a/docs/models/components/customfieldselect.md b/docs/models/components/customfieldselect.md index 212b7f6f..185073fe 100644 --- a/docs/models/components/customfieldselect.md +++ b/docs/models/components/customfieldselect.md @@ -8,8 +8,8 @@ Schema for a custom field of type select. import { CustomFieldSelect } from "@polar-sh/sdk/models/components"; let value: CustomFieldSelect = { - createdAt: new Date("2023-11-05T10:52:46.701Z"), - modifiedAt: new Date("2022-02-06T05:59:38.595Z"), + createdAt: new Date("2024-11-04T10:52:46.701Z"), + modifiedAt: new Date("2023-02-06T05:59:38.595Z"), id: "", metadata: { "key": "", @@ -36,7 +36,7 @@ let value: CustomFieldSelect = { | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the object. | | `metadata` | Record | :heavy_check_mark: | N/A | -| `type` | [components.CustomFieldSelectType](../../models/components/customfieldselecttype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `slug` | *string* | :heavy_check_mark: | Identifier of the custom field. It'll be used as key when storing the value. | | `name` | *string* | :heavy_check_mark: | Name of the custom field. | | `organizationId` | *string* | :heavy_check_mark: | The ID of the organization owning the custom field. | diff --git a/docs/models/components/customfieldselecttype.md b/docs/models/components/customfieldselecttype.md deleted file mode 100644 index 75dec38b..00000000 --- a/docs/models/components/customfieldselecttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldSelectType - -## Example Usage - -```typescript -import { CustomFieldSelectType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldSelectType = "select"; -``` - -## Values - -```typescript -"select" -``` \ No newline at end of file diff --git a/docs/models/components/customfieldsortproperty.md b/docs/models/components/customfieldsortproperty.md index d53c5ed5..90f10ca0 100644 --- a/docs/models/components/customfieldsortproperty.md +++ b/docs/models/components/customfieldsortproperty.md @@ -5,7 +5,7 @@ ```typescript import { CustomFieldSortProperty } from "@polar-sh/sdk/models/components"; -let value: CustomFieldSortProperty = "type"; +let value: CustomFieldSortProperty = "-created_at"; ``` ## Values diff --git a/docs/models/components/customfieldtext.md b/docs/models/components/customfieldtext.md index d3558a39..a69cd9e4 100644 --- a/docs/models/components/customfieldtext.md +++ b/docs/models/components/customfieldtext.md @@ -8,8 +8,8 @@ Schema for a custom field of type text. import { CustomFieldText } from "@polar-sh/sdk/models/components"; let value: CustomFieldText = { - createdAt: new Date("2022-10-11T12:25:32.503Z"), - modifiedAt: new Date("2024-07-19T13:06:13.194Z"), + createdAt: new Date("2023-10-11T12:25:32.503Z"), + modifiedAt: new Date("2025-07-19T13:06:13.194Z"), id: "", metadata: { "key": "", @@ -29,7 +29,7 @@ let value: CustomFieldText = { | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the object. | | `metadata` | Record | :heavy_check_mark: | N/A | -| `type` | [components.CustomFieldTextType](../../models/components/customfieldtexttype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `slug` | *string* | :heavy_check_mark: | Identifier of the custom field. It'll be used as key when storing the value. | | `name` | *string* | :heavy_check_mark: | Name of the custom field. | | `organizationId` | *string* | :heavy_check_mark: | The ID of the organization owning the custom field. | diff --git a/docs/models/components/customfieldtexttype.md b/docs/models/components/customfieldtexttype.md deleted file mode 100644 index 600025ce..00000000 --- a/docs/models/components/customfieldtexttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldTextType - -## Example Usage - -```typescript -import { CustomFieldTextType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldTextType = "text"; -``` - -## Values - -```typescript -"text" -``` \ No newline at end of file diff --git a/docs/models/components/customfieldupdatecheckbox.md b/docs/models/components/customfieldupdatecheckbox.md index b439659f..c701704d 100644 --- a/docs/models/components/customfieldupdatecheckbox.md +++ b/docs/models/components/customfieldupdatecheckbox.md @@ -17,5 +17,5 @@ let value: CustomFieldUpdateCheckbox = {}; | `metadata` | Record | :heavy_minus_sign: | N/A | | `name` | *string* | :heavy_minus_sign: | N/A | | `slug` | *string* | :heavy_minus_sign: | N/A | -| `type` | [components.CustomFieldUpdateCheckboxType](../../models/components/customfieldupdatecheckboxtype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `properties` | [components.CustomFieldCheckboxProperties](../../models/components/customfieldcheckboxproperties.md) | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/customfieldupdatecheckboxmetadata.md b/docs/models/components/customfieldupdatecheckboxmetadata.md index 0ca621f6..045d22f4 100644 --- a/docs/models/components/customfieldupdatecheckboxmetadata.md +++ b/docs/models/components/customfieldupdatecheckboxmetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 457962; +const value: number = 107645; ``` ### `boolean` diff --git a/docs/models/components/customfieldupdatecheckboxtype.md b/docs/models/components/customfieldupdatecheckboxtype.md deleted file mode 100644 index 023767b0..00000000 --- a/docs/models/components/customfieldupdatecheckboxtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldUpdateCheckboxType - -## Example Usage - -```typescript -import { CustomFieldUpdateCheckboxType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldUpdateCheckboxType = "checkbox"; -``` - -## Values - -```typescript -"checkbox" -``` \ No newline at end of file diff --git a/docs/models/components/customfieldupdatedate.md b/docs/models/components/customfieldupdatedate.md index 33f68082..29775617 100644 --- a/docs/models/components/customfieldupdatedate.md +++ b/docs/models/components/customfieldupdatedate.md @@ -17,5 +17,5 @@ let value: CustomFieldUpdateDate = {}; | `metadata` | Record | :heavy_minus_sign: | N/A | | `name` | *string* | :heavy_minus_sign: | N/A | | `slug` | *string* | :heavy_minus_sign: | N/A | -| `type` | [components.CustomFieldUpdateDateType](../../models/components/customfieldupdatedatetype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `properties` | [components.CustomFieldDateProperties](../../models/components/customfielddateproperties.md) | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/customfieldupdatedatemetadata.md b/docs/models/components/customfieldupdatedatemetadata.md index b76a48b5..7a943136 100644 --- a/docs/models/components/customfieldupdatedatemetadata.md +++ b/docs/models/components/customfieldupdatedatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 66963; +const value: number = 433282; ``` ### `boolean` diff --git a/docs/models/components/customfieldupdatedatetype.md b/docs/models/components/customfieldupdatedatetype.md deleted file mode 100644 index ec048ccc..00000000 --- a/docs/models/components/customfieldupdatedatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldUpdateDateType - -## Example Usage - -```typescript -import { CustomFieldUpdateDateType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldUpdateDateType = "date"; -``` - -## Values - -```typescript -"date" -``` \ No newline at end of file diff --git a/docs/models/components/customfieldupdatenumber.md b/docs/models/components/customfieldupdatenumber.md index b7a3b38d..182d22e0 100644 --- a/docs/models/components/customfieldupdatenumber.md +++ b/docs/models/components/customfieldupdatenumber.md @@ -17,5 +17,5 @@ let value: CustomFieldUpdateNumber = {}; | `metadata` | Record | :heavy_minus_sign: | N/A | | `name` | *string* | :heavy_minus_sign: | N/A | | `slug` | *string* | :heavy_minus_sign: | N/A | -| `type` | [components.CustomFieldUpdateNumberType](../../models/components/customfieldupdatenumbertype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `properties` | [components.CustomFieldNumberProperties](../../models/components/customfieldnumberproperties.md) | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/customfieldupdatenumbermetadata.md b/docs/models/components/customfieldupdatenumbermetadata.md index 6c5467df..60474661 100644 --- a/docs/models/components/customfieldupdatenumbermetadata.md +++ b/docs/models/components/customfieldupdatenumbermetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 424698; +const value: number = 588513; ``` ### `boolean` diff --git a/docs/models/components/customfieldupdatenumbertype.md b/docs/models/components/customfieldupdatenumbertype.md deleted file mode 100644 index 6c4a7ccd..00000000 --- a/docs/models/components/customfieldupdatenumbertype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldUpdateNumberType - -## Example Usage - -```typescript -import { CustomFieldUpdateNumberType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldUpdateNumberType = "number"; -``` - -## Values - -```typescript -"number" -``` \ No newline at end of file diff --git a/docs/models/components/customfieldupdateselect.md b/docs/models/components/customfieldupdateselect.md index 40318f03..9fa46e01 100644 --- a/docs/models/components/customfieldupdateselect.md +++ b/docs/models/components/customfieldupdateselect.md @@ -17,5 +17,5 @@ let value: CustomFieldUpdateSelect = {}; | `metadata` | Record | :heavy_minus_sign: | N/A | | `name` | *string* | :heavy_minus_sign: | N/A | | `slug` | *string* | :heavy_minus_sign: | N/A | -| `type` | [components.CustomFieldUpdateSelectType](../../models/components/customfieldupdateselecttype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `properties` | [components.CustomFieldSelectProperties](../../models/components/customfieldselectproperties.md) | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/customfieldupdateselectmetadata.md b/docs/models/components/customfieldupdateselectmetadata.md index 854ca210..c2a04f4b 100644 --- a/docs/models/components/customfieldupdateselectmetadata.md +++ b/docs/models/components/customfieldupdateselectmetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 411009; +const value: number = 958248; ``` ### `boolean` diff --git a/docs/models/components/customfieldupdateselecttype.md b/docs/models/components/customfieldupdateselecttype.md deleted file mode 100644 index 840ceeeb..00000000 --- a/docs/models/components/customfieldupdateselecttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldUpdateSelectType - -## Example Usage - -```typescript -import { CustomFieldUpdateSelectType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldUpdateSelectType = "select"; -``` - -## Values - -```typescript -"select" -``` \ No newline at end of file diff --git a/docs/models/components/customfieldupdatetext.md b/docs/models/components/customfieldupdatetext.md index 4026b0df..1642eaab 100644 --- a/docs/models/components/customfieldupdatetext.md +++ b/docs/models/components/customfieldupdatetext.md @@ -17,5 +17,5 @@ let value: CustomFieldUpdateText = {}; | `metadata` | Record | :heavy_minus_sign: | N/A | | `name` | *string* | :heavy_minus_sign: | N/A | | `slug` | *string* | :heavy_minus_sign: | N/A | -| `type` | [components.CustomFieldUpdateTextType](../../models/components/customfieldupdatetexttype.md) | :heavy_check_mark: | N/A | +| `type` | *string* | :heavy_check_mark: | N/A | | `properties` | [components.CustomFieldTextProperties](../../models/components/customfieldtextproperties.md) | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/customfieldupdatetextmetadata.md b/docs/models/components/customfieldupdatetextmetadata.md index 3b09c8ef..cd43e9b1 100644 --- a/docs/models/components/customfieldupdatetextmetadata.md +++ b/docs/models/components/customfieldupdatetextmetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 917965; +const value: number = 281326; ``` ### `boolean` diff --git a/docs/models/components/customfieldupdatetexttype.md b/docs/models/components/customfieldupdatetexttype.md deleted file mode 100644 index de2586e6..00000000 --- a/docs/models/components/customfieldupdatetexttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# CustomFieldUpdateTextType - -## Example Usage - -```typescript -import { CustomFieldUpdateTextType } from "@polar-sh/sdk/models/components"; - -let value: CustomFieldUpdateTextType = "text"; -``` - -## Values - -```typescript -"text" -``` \ No newline at end of file diff --git a/docs/models/components/discount.md b/docs/models/components/discount.md index bdeb8629..54243ca5 100644 --- a/docs/models/components/discount.md +++ b/docs/models/components/discount.md @@ -7,31 +7,30 @@ ```typescript const value: components.DiscountFixedOnceForeverDuration = { - duration: "repeating", - type: "fixed", - amount: 615665, - currency: "Cordoba Oro", - createdAt: new Date("2022-11-05T08:00:43.230Z"), - modifiedAt: new Date("2023-10-08T00:15:06.736Z"), + duration: "forever", + type: "percentage", + amount: 401543, + currency: "Sudanese Pound", + createdAt: new Date("2025-08-18T17:37:40.864Z"), + modifiedAt: new Date("2024-06-20T17:53:47.217Z"), id: "", metadata: { - "key": 107645, + "key": 295537, }, name: "", code: "", - startsAt: new Date("2024-11-16T05:43:50.992Z"), - endsAt: new Date("2024-01-14T18:49:36.050Z"), - maxRedemptions: 953960, - redemptionsCount: 151023, + startsAt: new Date("2024-11-16T10:35:42.718Z"), + endsAt: new Date("2024-11-27T05:20:13.228Z"), + maxRedemptions: 511975, + redemptionsCount: 159846, organizationId: "", products: [ { - createdAt: new Date("2024-05-20T09:25:06.072Z"), - modifiedAt: new Date("2023-04-07T00:08:29.443Z"), + createdAt: new Date("2025-03-05T22:33:02.662Z"), + modifiedAt: new Date("2023-12-17T08:26:41.063Z"), id: "", name: "", - description: - "mechanically wrongly naturally worriedly nor a inasmuch oh request merry", + description: "aha eek morning strict meh out", isRecurring: false, isArchived: false, organizationId: "", @@ -44,31 +43,32 @@ const value: components.DiscountFixedOnceForeverDuration = { ```typescript const value: components.DiscountFixedRepeatDuration = { - duration: "once", - durationInMonths: 725310, + duration: "forever", + durationInMonths: 341772, type: "fixed", - amount: 388215, - currency: "Turkish Lira", - createdAt: new Date("2024-01-17T12:18:48.322Z"), - modifiedAt: new Date("2022-04-01T14:34:31.000Z"), + amount: 464473, + currency: "New Israeli Sheqel", + createdAt: new Date("2025-06-12T17:28:17.909Z"), + modifiedAt: new Date("2023-01-17T18:22:37.801Z"), id: "", metadata: { - "key": 86920, + "key": 618459, }, name: "", code: "", - startsAt: new Date("2023-12-09T10:05:15.071Z"), - endsAt: new Date("2023-03-09T12:56:03.909Z"), - maxRedemptions: 812999, - redemptionsCount: 780179, + startsAt: new Date("2025-12-18T17:37:50.504Z"), + endsAt: new Date("2025-08-28T08:37:13.354Z"), + maxRedemptions: 517567, + redemptionsCount: 288515, organizationId: "", products: [ { - createdAt: new Date("2024-12-31T16:19:45.104Z"), - modifiedAt: new Date("2022-11-24T21:22:29.476Z"), + createdAt: new Date("2023-01-12T03:54:22.379Z"), + modifiedAt: new Date("2023-09-21T21:29:51.348Z"), id: "", name: "", - description: "now new usually excepting", + description: + "concerning hm coolly submitter yahoo what whoever likewise which", isRecurring: false, isArchived: false, organizationId: "", @@ -81,29 +81,29 @@ const value: components.DiscountFixedRepeatDuration = { ```typescript const value: components.DiscountPercentageOnceForeverDuration = { - duration: "forever", + duration: "once", type: "percentage", - basisPoints: 499329, - createdAt: new Date("2023-01-10T13:58:51.311Z"), - modifiedAt: new Date("2022-07-31T07:38:02.828Z"), + basisPoints: 4891, + createdAt: new Date("2025-11-06T07:58:52.676Z"), + modifiedAt: new Date("2023-03-01T13:04:14.388Z"), id: "", metadata: { - "key": 375553, + "key": "", }, name: "", code: "", - startsAt: new Date("2024-06-12T17:28:17.909Z"), - endsAt: new Date("2022-01-17T18:22:37.801Z"), - maxRedemptions: 570398, - redemptionsCount: 618459, + startsAt: new Date("2023-01-28T06:36:58.753Z"), + endsAt: new Date("2025-11-17T10:52:20.252Z"), + maxRedemptions: 51685, + redemptionsCount: 349003, organizationId: "", products: [ { - createdAt: new Date("2024-12-18T17:37:50.504Z"), - modifiedAt: new Date("2024-08-28T08:37:13.354Z"), + createdAt: new Date("2024-12-28T13:39:18.754Z"), + modifiedAt: new Date("2023-12-19T22:18:12.650Z"), id: "", name: "", - description: "next after duh brochure nicely blaring abaft", + description: "burdensome pants unless", isRecurring: false, isArchived: false, organizationId: "", @@ -116,30 +116,30 @@ const value: components.DiscountPercentageOnceForeverDuration = { ```typescript const value: components.DiscountPercentageRepeatDuration = { - duration: "repeating", - durationInMonths: 164585, - type: "percentage", - basisPoints: 940497, - createdAt: new Date("2024-11-25T09:37:16.236Z"), - modifiedAt: new Date("2024-07-14T07:13:26.291Z"), + duration: "forever", + durationInMonths: 99209, + type: "fixed", + basisPoints: 616016, + createdAt: new Date("2025-05-23T09:25:40.012Z"), + modifiedAt: new Date("2025-12-28T07:19:49.051Z"), id: "", metadata: { - "key": false, + "key": 229497, }, name: "", code: "", - startsAt: new Date("2024-09-18T22:39:55.324Z"), - endsAt: new Date("2022-03-25T21:43:26.476Z"), - maxRedemptions: 857243, - redemptionsCount: 415732, + startsAt: new Date("2024-03-19T23:08:02.167Z"), + endsAt: new Date("2023-04-27T21:02:57.653Z"), + maxRedemptions: 413871, + redemptionsCount: 840168, organizationId: "", products: [ { - createdAt: new Date("2022-02-16T18:16:38.541Z"), - modifiedAt: new Date("2023-08-08T08:31:57.424Z"), + createdAt: new Date("2024-03-03T15:48:47.598Z"), + modifiedAt: new Date("2023-02-26T16:47:59.921Z"), id: "", name: "", - description: "a following throughout", + description: "if jam-packed tuxedo dreary", isRecurring: false, isArchived: false, organizationId: "", diff --git a/docs/models/components/discountcreate.md b/docs/models/components/discountcreate.md index 82774e01..1d6d4499 100644 --- a/docs/models/components/discountcreate.md +++ b/docs/models/components/discountcreate.md @@ -7,9 +7,9 @@ ```typescript const value: components.DiscountFixedOnceForeverDurationCreate = { - duration: "forever", - type: "fixed", - amount: 44740, + duration: "repeating", + type: "percentage", + amount: 755041, name: "", }; ``` @@ -18,10 +18,10 @@ const value: components.DiscountFixedOnceForeverDurationCreate = { ```typescript const value: components.DiscountFixedRepeatDurationCreate = { - duration: "once", - durationInMonths: 350470, - type: "fixed", - amount: 706735, + duration: "repeating", + durationInMonths: 543473, + type: "percentage", + amount: 268483, name: "", }; ``` @@ -31,8 +31,8 @@ const value: components.DiscountFixedRepeatDurationCreate = { ```typescript const value: components.DiscountPercentageOnceForeverDurationCreate = { duration: "repeating", - type: "percentage", - basisPoints: 942754, + type: "fixed", + basisPoints: 530216, name: "", }; ``` @@ -41,10 +41,10 @@ const value: components.DiscountPercentageOnceForeverDurationCreate = { ```typescript const value: components.DiscountPercentageRepeatDurationCreate = { - duration: "forever", - durationInMonths: 593682, + duration: "once", + durationInMonths: 35044, type: "fixed", - basisPoints: 570826, + basisPoints: 2178, name: "", }; ``` diff --git a/docs/models/components/discountfixedonceforeverduration.md b/docs/models/components/discountfixedonceforeverduration.md index e5708c99..763e18e8 100644 --- a/docs/models/components/discountfixedonceforeverduration.md +++ b/docs/models/components/discountfixedonceforeverduration.md @@ -10,28 +10,28 @@ import { DiscountFixedOnceForeverDuration } from "@polar-sh/sdk/models/component let value: DiscountFixedOnceForeverDuration = { duration: "forever", type: "fixed", - amount: 982000, - currency: "Moroccan Dirham", - createdAt: new Date("2022-10-13T03:45:21.275Z"), - modifiedAt: new Date("2023-10-22T22:32:58.315Z"), + amount: 120524, + currency: "Turkish Lira", + createdAt: new Date("2025-01-02T06:57:33.906Z"), + modifiedAt: new Date("2023-01-29T06:24:38.751Z"), id: "", metadata: { - "key": false, + "key": 153803, }, name: "", code: "", - startsAt: new Date("2023-05-28T09:14:17.968Z"), - endsAt: new Date("2023-12-05T10:43:19.828Z"), - maxRedemptions: 108040, - redemptionsCount: 874066, + startsAt: new Date("2024-07-14T07:08:04.117Z"), + endsAt: new Date("2025-04-25T07:01:38.359Z"), + maxRedemptions: 413054, + redemptionsCount: 596865, organizationId: "", products: [ { - createdAt: new Date("2024-01-17T01:47:37.881Z"), - modifiedAt: new Date("2024-04-27T04:38:56.421Z"), + createdAt: new Date("2024-08-21T21:31:46.524Z"), + modifiedAt: new Date("2024-09-25T01:20:40.326Z"), id: "", name: "", - description: "than times thankfully", + description: "besides backburn altruistic deed second geez", isRecurring: false, isArchived: false, organizationId: "", diff --git a/docs/models/components/discountfixedonceforeverdurationbase.md b/docs/models/components/discountfixedonceforeverdurationbase.md index 2279bd46..d1dfe875 100644 --- a/docs/models/components/discountfixedonceforeverdurationbase.md +++ b/docs/models/components/discountfixedonceforeverdurationbase.md @@ -10,16 +10,16 @@ let value: DiscountFixedOnceForeverDurationBase = { type: "fixed", amount: 758985, currency: "Lek", - createdAt: new Date("2024-11-25T21:24:45.235Z"), - modifiedAt: new Date("2023-11-06T02:29:10.229Z"), + createdAt: new Date("2025-11-25T21:24:45.235Z"), + modifiedAt: new Date("2024-11-05T02:29:10.229Z"), id: "", metadata: { "key": 295950, }, name: "", code: "", - startsAt: new Date("2024-10-15T12:05:17.265Z"), - endsAt: new Date("2022-10-19T10:22:53.837Z"), + startsAt: new Date("2025-10-15T12:05:17.265Z"), + endsAt: new Date("2023-10-19T10:22:53.837Z"), maxRedemptions: 828147, redemptionsCount: 985109, organizationId: "", diff --git a/docs/models/components/discountfixedonceforeverdurationcreate.md b/docs/models/components/discountfixedonceforeverdurationcreate.md index 7bcb2f0f..18571e47 100644 --- a/docs/models/components/discountfixedonceforeverdurationcreate.md +++ b/docs/models/components/discountfixedonceforeverdurationcreate.md @@ -8,9 +8,9 @@ Schema to create a fixed amount discount that is applied once or forever. import { DiscountFixedOnceForeverDurationCreate } from "@polar-sh/sdk/models/components"; let value: DiscountFixedOnceForeverDurationCreate = { - duration: "once", + duration: "repeating", type: "fixed", - amount: 653738, + amount: 608634, name: "", }; ``` diff --git a/docs/models/components/discountfixedonceforeverdurationcreatemetadata.md b/docs/models/components/discountfixedonceforeverdurationcreatemetadata.md index f7c94aab..88f2acb8 100644 --- a/docs/models/components/discountfixedonceforeverdurationcreatemetadata.md +++ b/docs/models/components/discountfixedonceforeverdurationcreatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 260562; +const value: number = 770626; ``` ### `boolean` diff --git a/docs/models/components/discountfixedonceforeverdurationmetadata.md b/docs/models/components/discountfixedonceforeverdurationmetadata.md index 91c8b210..90d83c6b 100644 --- a/docs/models/components/discountfixedonceforeverdurationmetadata.md +++ b/docs/models/components/discountfixedonceforeverdurationmetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 738980; +const value: number = 74279; ``` ### `boolean` diff --git a/docs/models/components/discountfixedrepeatduration.md b/docs/models/components/discountfixedrepeatduration.md index 3b569dbe..8174a6b9 100644 --- a/docs/models/components/discountfixedrepeatduration.md +++ b/docs/models/components/discountfixedrepeatduration.md @@ -9,31 +9,32 @@ for a certain number of months. import { DiscountFixedRepeatDuration } from "@polar-sh/sdk/models/components"; let value: DiscountFixedRepeatDuration = { - duration: "forever", - durationInMonths: 167032, - type: "fixed", - amount: 894050, - currency: "Solomon Islands Dollar", - createdAt: new Date("2024-12-13T05:18:10.863Z"), - modifiedAt: new Date("2022-03-01T07:50:15.091Z"), + duration: "once", + durationInMonths: 788582, + type: "percentage", + amount: 404610, + currency: "Denar", + createdAt: new Date("2024-04-10T16:12:05.280Z"), + modifiedAt: new Date("2023-09-03T18:31:34.012Z"), id: "", metadata: { - "key": "", + "key": false, }, name: "", code: "", - startsAt: new Date("2024-11-17T09:06:12.283Z"), - endsAt: new Date("2023-04-27T13:25:12.871Z"), - maxRedemptions: 604338, - redemptionsCount: 569742, + startsAt: new Date("2025-03-26T21:37:08.155Z"), + endsAt: new Date("2024-12-10T04:09:29.451Z"), + maxRedemptions: 455640, + redemptionsCount: 464806, organizationId: "", products: [ { - createdAt: new Date("2022-06-04T04:41:38.622Z"), - modifiedAt: new Date("2024-03-12T06:58:02.887Z"), + createdAt: new Date("2023-11-24T02:16:01.160Z"), + modifiedAt: new Date("2023-10-19T05:37:10.667Z"), id: "", name: "", - description: "altruistic deed second", + description: + "fisherman tentacle provided slight acknowledge indeed misfire drug igloo", isRecurring: false, isArchived: false, organizationId: "", diff --git a/docs/models/components/discountfixedrepeatdurationbase.md b/docs/models/components/discountfixedrepeatdurationbase.md index 472319c6..41985239 100644 --- a/docs/models/components/discountfixedrepeatdurationbase.md +++ b/docs/models/components/discountfixedrepeatdurationbase.md @@ -11,16 +11,16 @@ let value: DiscountFixedRepeatDurationBase = { type: "fixed", amount: 438256, currency: "Cuban Peso", - createdAt: new Date("2023-04-10T06:02:57.106Z"), - modifiedAt: new Date("2023-01-28T02:27:48.178Z"), + createdAt: new Date("2024-04-09T06:02:57.106Z"), + modifiedAt: new Date("2024-01-28T02:27:48.178Z"), id: "", metadata: { "key": "", }, name: "", code: "", - startsAt: new Date("2023-04-29T17:54:19.678Z"), - endsAt: new Date("2022-10-16T00:41:24.184Z"), + startsAt: new Date("2024-04-28T17:54:19.678Z"), + endsAt: new Date("2023-10-16T00:41:24.184Z"), maxRedemptions: 522062, redemptionsCount: 35160, organizationId: "", diff --git a/docs/models/components/discountfixedrepeatdurationcreate.md b/docs/models/components/discountfixedrepeatdurationcreate.md index ed884cae..69658170 100644 --- a/docs/models/components/discountfixedrepeatdurationcreate.md +++ b/docs/models/components/discountfixedrepeatdurationcreate.md @@ -9,10 +9,10 @@ for a certain number of months. import { DiscountFixedRepeatDurationCreate } from "@polar-sh/sdk/models/components"; let value: DiscountFixedRepeatDurationCreate = { - duration: "once", - durationInMonths: 28751, + duration: "repeating", + durationInMonths: 621066, type: "fixed", - amount: 452831, + amount: 856289, name: "", }; ``` diff --git a/docs/models/components/discountfixedrepeatdurationcreatemetadata.md b/docs/models/components/discountfixedrepeatdurationcreatemetadata.md index fd7b5bd3..e88826ff 100644 --- a/docs/models/components/discountfixedrepeatdurationcreatemetadata.md +++ b/docs/models/components/discountfixedrepeatdurationcreatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 617330; +const value: number = 150044; ``` ### `boolean` diff --git a/docs/models/components/discountfixedrepeatdurationmetadata.md b/docs/models/components/discountfixedrepeatdurationmetadata.md index 71ff56dc..8137b488 100644 --- a/docs/models/components/discountfixedrepeatdurationmetadata.md +++ b/docs/models/components/discountfixedrepeatdurationmetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 577606; +const value: number = 572474; ``` ### `boolean` diff --git a/docs/models/components/discountpercentageonceforeverduration.md b/docs/models/components/discountpercentageonceforeverduration.md index daaca2db..0e63c134 100644 --- a/docs/models/components/discountpercentageonceforeverduration.md +++ b/docs/models/components/discountpercentageonceforeverduration.md @@ -8,29 +8,29 @@ Schema for a percentage discount that is applied once or forever. import { DiscountPercentageOnceForeverDuration } from "@polar-sh/sdk/models/components"; let value: DiscountPercentageOnceForeverDuration = { - duration: "once", - type: "fixed", - basisPoints: 258807, - createdAt: new Date("2022-08-02T09:03:13.181Z"), - modifiedAt: new Date("2022-09-07T18:36:36.075Z"), + duration: "forever", + type: "percentage", + basisPoints: 594028, + createdAt: new Date("2024-04-30T17:04:34.452Z"), + modifiedAt: new Date("2023-12-27T03:00:57.232Z"), id: "", metadata: { - "key": "", + "key": false, }, name: "", code: "", - startsAt: new Date("2023-04-17T21:05:59.681Z"), - endsAt: new Date("2023-02-22T06:19:27.101Z"), - maxRedemptions: 337047, - redemptionsCount: 881238, + startsAt: new Date("2024-06-08T03:51:14.602Z"), + endsAt: new Date("2024-01-29T17:37:29.584Z"), + maxRedemptions: 907729, + redemptionsCount: 811865, organizationId: "", products: [ { - createdAt: new Date("2022-08-11T04:48:17.830Z"), - modifiedAt: new Date("2022-06-29T08:44:46.296Z"), + createdAt: new Date("2024-10-07T06:12:11.011Z"), + modifiedAt: new Date("2024-09-12T09:45:13.036Z"), id: "", name: "", - description: "teeming anneal masquerade", + description: "than with pilot whenever discrete ha", isRecurring: false, isArchived: false, organizationId: "", diff --git a/docs/models/components/discountpercentageonceforeverdurationbase.md b/docs/models/components/discountpercentageonceforeverdurationbase.md index 6e0b0d2d..87ce50b1 100644 --- a/docs/models/components/discountpercentageonceforeverdurationbase.md +++ b/docs/models/components/discountpercentageonceforeverdurationbase.md @@ -9,16 +9,16 @@ let value: DiscountPercentageOnceForeverDurationBase = { duration: "repeating", type: "percentage", basisPoints: 851809, - createdAt: new Date("2024-11-20T18:50:24.078Z"), - modifiedAt: new Date("2022-05-02T03:10:42.322Z"), + createdAt: new Date("2025-11-20T18:50:24.078Z"), + modifiedAt: new Date("2023-05-02T03:10:42.322Z"), id: "", metadata: { "key": 997994, }, name: "", code: "", - startsAt: new Date("2024-12-18T17:26:12.157Z"), - endsAt: new Date("2023-10-24T05:48:28.761Z"), + startsAt: new Date("2025-12-18T17:26:12.157Z"), + endsAt: new Date("2024-10-23T05:48:28.761Z"), maxRedemptions: 128020, redemptionsCount: 583193, organizationId: "", diff --git a/docs/models/components/discountpercentageonceforeverdurationcreate.md b/docs/models/components/discountpercentageonceforeverdurationcreate.md index 4e13dbaa..7fc6c512 100644 --- a/docs/models/components/discountpercentageonceforeverdurationcreate.md +++ b/docs/models/components/discountpercentageonceforeverdurationcreate.md @@ -9,8 +9,8 @@ import { DiscountPercentageOnceForeverDurationCreate } from "@polar-sh/sdk/model let value: DiscountPercentageOnceForeverDurationCreate = { duration: "forever", - type: "percentage", - basisPoints: 594028, + type: "fixed", + basisPoints: 201515, name: "", }; ``` diff --git a/docs/models/components/discountpercentageonceforeverdurationcreatemetadata.md b/docs/models/components/discountpercentageonceforeverdurationcreatemetadata.md index 7ca2a022..e7262f57 100644 --- a/docs/models/components/discountpercentageonceforeverdurationcreatemetadata.md +++ b/docs/models/components/discountpercentageonceforeverdurationcreatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 909516; +const value: number = 710629; ``` ### `boolean` diff --git a/docs/models/components/discountpercentageonceforeverdurationmetadata.md b/docs/models/components/discountpercentageonceforeverdurationmetadata.md index 64f49fc7..0c4eafab 100644 --- a/docs/models/components/discountpercentageonceforeverdurationmetadata.md +++ b/docs/models/components/discountpercentageonceforeverdurationmetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 572670; +const value: number = 909516; ``` ### `boolean` diff --git a/docs/models/components/discountpercentagerepeatduration.md b/docs/models/components/discountpercentagerepeatduration.md index 793d4c04..87f1e496 100644 --- a/docs/models/components/discountpercentagerepeatduration.md +++ b/docs/models/components/discountpercentagerepeatduration.md @@ -10,29 +10,30 @@ import { DiscountPercentageRepeatDuration } from "@polar-sh/sdk/models/component let value: DiscountPercentageRepeatDuration = { duration: "forever", - durationInMonths: 261579, - type: "fixed", - basisPoints: 300893, - createdAt: new Date("2022-06-25T01:47:44.862Z"), - modifiedAt: new Date("2024-10-29T03:16:27.463Z"), + durationInMonths: 938217, + type: "percentage", + basisPoints: 681434, + createdAt: new Date("2025-03-28T01:33:27.085Z"), + modifiedAt: new Date("2024-05-04T14:22:26.737Z"), id: "", metadata: { - "key": 637803, + "key": 470204, }, name: "", code: "", - startsAt: new Date("2024-10-12T17:31:29.736Z"), - endsAt: new Date("2023-09-20T10:21:04.413Z"), - maxRedemptions: 126999, - redemptionsCount: 788582, + startsAt: new Date("2025-08-02T18:33:58.243Z"), + endsAt: new Date("2024-02-03T12:32:42.552Z"), + maxRedemptions: 885282, + redemptionsCount: 40916, organizationId: "", products: [ { - createdAt: new Date("2024-04-29T00:45:49.497Z"), - modifiedAt: new Date("2023-03-20T10:51:16.611Z"), + createdAt: new Date("2023-10-05T02:34:33.763Z"), + modifiedAt: new Date("2025-09-10T12:54:55.673Z"), id: "", name: "", - description: "injunction fence duh swathe option as trial", + description: + "exasperation uh-huh chilly repurpose ew happily woot snack as ugh", isRecurring: false, isArchived: false, organizationId: "", diff --git a/docs/models/components/discountpercentagerepeatdurationbase.md b/docs/models/components/discountpercentagerepeatdurationbase.md index 39dddafa..8559c541 100644 --- a/docs/models/components/discountpercentagerepeatdurationbase.md +++ b/docs/models/components/discountpercentagerepeatdurationbase.md @@ -10,16 +10,16 @@ let value: DiscountPercentageRepeatDurationBase = { durationInMonths: 956124, type: "fixed", basisPoints: 638390, - createdAt: new Date("2022-11-04T19:43:41.328Z"), - modifiedAt: new Date("2024-11-04T19:30:24.907Z"), + createdAt: new Date("2023-11-04T19:43:41.328Z"), + modifiedAt: new Date("2025-11-04T19:30:24.907Z"), id: "", metadata: { "key": false, }, name: "", code: "", - startsAt: new Date("2022-12-28T07:08:38.576Z"), - endsAt: new Date("2024-05-17T18:29:32.722Z"), + startsAt: new Date("2023-12-28T07:08:38.576Z"), + endsAt: new Date("2025-05-17T18:29:32.722Z"), maxRedemptions: 108165, redemptionsCount: 392319, organizationId: "", diff --git a/docs/models/components/discountpercentagerepeatdurationcreate.md b/docs/models/components/discountpercentagerepeatdurationcreate.md index 0c88de90..89951198 100644 --- a/docs/models/components/discountpercentagerepeatdurationcreate.md +++ b/docs/models/components/discountpercentagerepeatdurationcreate.md @@ -9,10 +9,10 @@ for a certain number of months. import { DiscountPercentageRepeatDurationCreate } from "@polar-sh/sdk/models/components"; let value: DiscountPercentageRepeatDurationCreate = { - duration: "once", - durationInMonths: 970094, + duration: "forever", + durationInMonths: 369976, type: "fixed", - basisPoints: 359247, + basisPoints: 310149, name: "", }; ``` diff --git a/docs/models/components/discountpercentagerepeatdurationcreatemetadata.md b/docs/models/components/discountpercentagerepeatdurationcreatemetadata.md index f9df5dd6..6d1491f3 100644 --- a/docs/models/components/discountpercentagerepeatdurationcreatemetadata.md +++ b/docs/models/components/discountpercentagerepeatdurationcreatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 443167; +const value: number = 174788; ``` ### `boolean` diff --git a/docs/models/components/discountpercentagerepeatdurationmetadata.md b/docs/models/components/discountpercentagerepeatdurationmetadata.md index 9ef7f524..6fcad5fa 100644 --- a/docs/models/components/discountpercentagerepeatdurationmetadata.md +++ b/docs/models/components/discountpercentagerepeatdurationmetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 29572; +const value: number = 265906; ``` ### `boolean` diff --git a/docs/models/components/discountproduct.md b/docs/models/components/discountproduct.md index 03163b8a..eb8265e1 100644 --- a/docs/models/components/discountproduct.md +++ b/docs/models/components/discountproduct.md @@ -8,11 +8,11 @@ A product that a discount can be applied to. import { DiscountProduct } from "@polar-sh/sdk/models/components"; let value: DiscountProduct = { - createdAt: new Date("2022-11-04T19:37:35.548Z"), - modifiedAt: new Date("2023-09-02T01:32:00.618Z"), + createdAt: new Date("2024-04-16T21:05:59.681Z"), + modifiedAt: new Date("2024-02-22T06:19:27.101Z"), id: "", name: "", - description: "jam-packed tuxedo dreary oh like", + description: "minus covenant mockingly ew transom", isRecurring: false, isArchived: false, organizationId: "", diff --git a/docs/models/components/discountsortproperty.md b/docs/models/components/discountsortproperty.md index e79b3139..6391f27a 100644 --- a/docs/models/components/discountsortproperty.md +++ b/docs/models/components/discountsortproperty.md @@ -5,7 +5,7 @@ ```typescript import { DiscountSortProperty } from "@polar-sh/sdk/models/components"; -let value: DiscountSortProperty = "-created_at"; +let value: DiscountSortProperty = "name"; ``` ## Values diff --git a/docs/models/components/discountupdatemetadata.md b/docs/models/components/discountupdatemetadata.md index d192e92e..c6e94058 100644 --- a/docs/models/components/discountupdatemetadata.md +++ b/docs/models/components/discountupdatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 907729; +const value: number = 133739; ``` ### `boolean` diff --git a/docs/models/components/downloadablefilecreate.md b/docs/models/components/downloadablefilecreate.md index 23a10234..d3e3f711 100644 --- a/docs/models/components/downloadablefilecreate.md +++ b/docs/models/components/downloadablefilecreate.md @@ -10,13 +10,13 @@ import { DownloadableFileCreate } from "@polar-sh/sdk/models/components"; let value: DownloadableFileCreate = { name: "", mimeType: "", - size: 887651, + size: 41111, upload: { parts: [ { - number: 709922, - chunkStart: 535382, - chunkEnd: 687828, + number: 850, + chunkStart: 887073, + chunkEnd: 964329, }, ], }, @@ -25,13 +25,13 @@ let value: DownloadableFileCreate = { ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | -| `organizationId` | *string* | :heavy_minus_sign: | N/A | -| `name` | *string* | :heavy_check_mark: | N/A | -| `mimeType` | *string* | :heavy_check_mark: | N/A | -| `size` | *number* | :heavy_check_mark: | N/A | -| `checksumSha256Base64` | *string* | :heavy_minus_sign: | N/A | -| `upload` | [components.S3FileCreateMultipart](../../models/components/s3filecreatemultipart.md) | :heavy_check_mark: | N/A | -| `service` | [components.DownloadableFileCreateService](../../models/components/downloadablefilecreateservice.md) | :heavy_check_mark: | N/A | -| `version` | *string* | :heavy_minus_sign: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------ | +| `organizationId` | *string* | :heavy_minus_sign: | N/A | +| `name` | *string* | :heavy_check_mark: | N/A | +| `mimeType` | *string* | :heavy_check_mark: | N/A | +| `size` | *number* | :heavy_check_mark: | N/A | +| `checksumSha256Base64` | *string* | :heavy_minus_sign: | N/A | +| `upload` | [components.S3FileCreateMultipart](../../models/components/s3filecreatemultipart.md) | :heavy_check_mark: | N/A | +| `service` | *string* | :heavy_check_mark: | N/A | +| `version` | *string* | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/downloadablefilecreateservice.md b/docs/models/components/downloadablefilecreateservice.md deleted file mode 100644 index c147105e..00000000 --- a/docs/models/components/downloadablefilecreateservice.md +++ /dev/null @@ -1,15 +0,0 @@ -# DownloadableFileCreateService - -## Example Usage - -```typescript -import { DownloadableFileCreateService } from "@polar-sh/sdk/models/components"; - -let value: DownloadableFileCreateService = "downloadable"; -``` - -## Values - -```typescript -"downloadable" -``` \ No newline at end of file diff --git a/docs/models/components/downloadablefileread.md b/docs/models/components/downloadablefileread.md index 3b45eefc..ff3bdb03 100644 --- a/docs/models/components/downloadablefileread.md +++ b/docs/models/components/downloadablefileread.md @@ -11,38 +11,38 @@ let value: DownloadableFileRead = { id: "", organizationId: "", name: "", - path: "/boot", + path: "/var", mimeType: "", - size: 260242, + size: 493974, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-02-10T15:31:03.717Z"), + lastModifiedAt: new Date("2025-04-25T07:59:30.702Z"), version: "", isUploaded: false, - createdAt: new Date("2023-01-13T11:08:19.872Z"), + createdAt: new Date("2023-06-07T18:13:23.173Z"), sizeReadable: "", }; ``` ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------ | -| `id` | *string* | :heavy_check_mark: | The ID of the object. | -| `organizationId` | *string* | :heavy_check_mark: | N/A | -| `name` | *string* | :heavy_check_mark: | N/A | -| `path` | *string* | :heavy_check_mark: | N/A | -| `mimeType` | *string* | :heavy_check_mark: | N/A | -| `size` | *number* | :heavy_check_mark: | N/A | -| `storageVersion` | *string* | :heavy_check_mark: | N/A | -| `checksumEtag` | *string* | :heavy_check_mark: | N/A | -| `checksumSha256Base64` | *string* | :heavy_check_mark: | N/A | -| `checksumSha256Hex` | *string* | :heavy_check_mark: | N/A | -| `lastModifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | N/A | -| `version` | *string* | :heavy_check_mark: | N/A | -| `service` | [components.DownloadableFileReadService](../../models/components/downloadablefilereadservice.md) | :heavy_check_mark: | N/A | -| `isUploaded` | *boolean* | :heavy_check_mark: | N/A | -| `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | N/A | -| `sizeReadable` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | +| `id` | *string* | :heavy_check_mark: | The ID of the object. | +| `organizationId` | *string* | :heavy_check_mark: | N/A | +| `name` | *string* | :heavy_check_mark: | N/A | +| `path` | *string* | :heavy_check_mark: | N/A | +| `mimeType` | *string* | :heavy_check_mark: | N/A | +| `size` | *number* | :heavy_check_mark: | N/A | +| `storageVersion` | *string* | :heavy_check_mark: | N/A | +| `checksumEtag` | *string* | :heavy_check_mark: | N/A | +| `checksumSha256Base64` | *string* | :heavy_check_mark: | N/A | +| `checksumSha256Hex` | *string* | :heavy_check_mark: | N/A | +| `lastModifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | N/A | +| `version` | *string* | :heavy_check_mark: | N/A | +| `service` | *string* | :heavy_check_mark: | N/A | +| `isUploaded` | *boolean* | :heavy_check_mark: | N/A | +| `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | N/A | +| `sizeReadable` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/downloadablefilereadservice.md b/docs/models/components/downloadablefilereadservice.md deleted file mode 100644 index a476777e..00000000 --- a/docs/models/components/downloadablefilereadservice.md +++ /dev/null @@ -1,15 +0,0 @@ -# DownloadableFileReadService - -## Example Usage - -```typescript -import { DownloadableFileReadService } from "@polar-sh/sdk/models/components"; - -let value: DownloadableFileReadService = "downloadable"; -``` - -## Values - -```typescript -"downloadable" -``` \ No newline at end of file diff --git a/docs/models/components/downloadableread.md b/docs/models/components/downloadableread.md index e52c7ed7..8919948f 100644 --- a/docs/models/components/downloadableread.md +++ b/docs/models/components/downloadableread.md @@ -12,21 +12,21 @@ let value: DownloadableRead = { id: "", organizationId: "", name: "", - path: "/opt/lib", + path: "/usr/sbin", mimeType: "", - size: 545503, + size: 478388, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-07-09T11:32:01.340Z"), + lastModifiedAt: new Date("2024-12-26T16:42:31.674Z"), download: { - url: "https://inborn-consistency.name", - expiresAt: new Date("2023-12-02T20:03:30.175Z"), + url: "https://extra-large-account.org/", + expiresAt: new Date("2025-02-03T00:36:36.509Z"), }, version: "", isUploaded: false, - service: "product_media", + service: "organization_avatar", sizeReadable: "", }, }; diff --git a/docs/models/components/externalorganization.md b/docs/models/components/externalorganization.md index 2c549876..68260cf5 100644 --- a/docs/models/components/externalorganization.md +++ b/docs/models/components/externalorganization.md @@ -7,6 +7,7 @@ import { ExternalOrganization } from "@polar-sh/sdk/models/components"; let value: ExternalOrganization = { id: "5282f82b-1c72-40f4-8f88-1fb812658108", + platform: "github", name: "", avatarUrl: "https://huge-bar.info/", isPersonal: false, diff --git a/docs/models/components/filecreate.md b/docs/models/components/filecreate.md index 477adc33..01214b29 100644 --- a/docs/models/components/filecreate.md +++ b/docs/models/components/filecreate.md @@ -9,13 +9,13 @@ const value: components.DownloadableFileCreate = { name: "", mimeType: "", - size: 906143, + size: 104080, upload: { parts: [ { - number: 489096, - chunkStart: 169341, - chunkEnd: 409633, + number: 175216, + chunkStart: 752959, + chunkEnd: 534786, }, ], }, @@ -28,13 +28,13 @@ const value: components.DownloadableFileCreate = { const value: components.OrganizationAvatarFileCreate = { name: "", mimeType: "", - size: 593679, + size: 639968, upload: { parts: [ { - number: 541245, - chunkStart: 896306, - chunkEnd: 592378, + number: 816753, + chunkStart: 583827, + chunkEnd: 313949, }, ], }, @@ -47,13 +47,13 @@ const value: components.OrganizationAvatarFileCreate = { const value: components.ProductMediaFileCreate = { name: "", mimeType: "", - size: 256631, + size: 523250, upload: { parts: [ { - number: 952587, - chunkStart: 173926, - chunkEnd: 476438, + number: 130391, + chunkStart: 272077, + chunkEnd: 655131, }, ], }, diff --git a/docs/models/components/filedownload.md b/docs/models/components/filedownload.md index 5c3d0b4d..4775d0f7 100644 --- a/docs/models/components/filedownload.md +++ b/docs/models/components/filedownload.md @@ -9,17 +9,17 @@ let value: FileDownload = { id: "", organizationId: "", name: "", - path: "/bin", + path: "/dev", mimeType: "", - size: 661646, + size: 882911, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-09-18T14:12:48.441Z"), + lastModifiedAt: new Date("2023-06-10T19:42:24.859Z"), download: { - url: "https://sugary-label.info/", - expiresAt: new Date("2024-04-07T07:22:12.777Z"), + url: "https://sneaky-recovery.net", + expiresAt: new Date("2023-08-10T22:36:17.996Z"), }, version: "", isUploaded: false, diff --git a/docs/models/components/fileread.md b/docs/models/components/fileread.md index 045a8aff..8a478893 100644 --- a/docs/models/components/fileread.md +++ b/docs/models/components/fileread.md @@ -10,17 +10,17 @@ const value: components.DownloadableFileRead = { id: "", organizationId: "", name: "", - path: "/usr/include", + path: "/opt/include", mimeType: "", - size: 878289, + size: 681458, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-12-07T01:45:08.619Z"), + lastModifiedAt: new Date("2023-09-21T03:37:48.018Z"), version: "", isUploaded: false, - createdAt: new Date("2024-05-15T18:42:19.653Z"), + createdAt: new Date("2024-01-19T02:35:45.165Z"), sizeReadable: "", }; ``` @@ -32,19 +32,19 @@ const value: components.OrganizationAvatarFileRead = { id: "", organizationId: "", name: "", - path: "/etc", + path: "/dev", mimeType: "", - size: 577549, + size: 816230, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2023-08-09T10:13:51.600Z"), + lastModifiedAt: new Date("2023-03-19T19:33:36.442Z"), version: "", isUploaded: false, - createdAt: new Date("2023-04-18T14:04:46.675Z"), + createdAt: new Date("2023-11-24T11:33:05.047Z"), sizeReadable: "", - publicUrl: "https://intent-starboard.net/", + publicUrl: "https://noted-daddy.org", }; ``` @@ -55,19 +55,19 @@ const value: components.ProductMediaFileRead = { id: "", organizationId: "", name: "", - path: "/opt/share", + path: "/usr/share", mimeType: "", - size: 967589, + size: 68180, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-05-10T16:19:06.783Z"), + lastModifiedAt: new Date("2023-09-10T09:25:05.806Z"), version: "", isUploaded: false, - createdAt: new Date("2022-02-18T12:13:52.647Z"), + createdAt: new Date("2024-12-04T22:01:21.527Z"), sizeReadable: "", - publicUrl: "https://secret-asset.org", + publicUrl: "https://mysterious-collaboration.net/", }; ``` diff --git a/docs/models/components/fileservicetypes.md b/docs/models/components/fileservicetypes.md index a4f5674e..bc4a73d3 100644 --- a/docs/models/components/fileservicetypes.md +++ b/docs/models/components/fileservicetypes.md @@ -5,7 +5,7 @@ ```typescript import { FileServiceTypes } from "@polar-sh/sdk/models/components"; -let value: FileServiceTypes = "organization_avatar"; +let value: FileServiceTypes = "product_media"; ``` ## Values diff --git a/docs/models/components/fileupload.md b/docs/models/components/fileupload.md index 53a58c7d..8152464e 100644 --- a/docs/models/components/fileupload.md +++ b/docs/models/components/fileupload.md @@ -9,29 +9,29 @@ let value: FileUpload = { id: "", organizationId: "", name: "", - path: "/private", + path: "/rescue", mimeType: "", - size: 280690, + size: 224411, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-11-18T12:31:27.009Z"), + lastModifiedAt: new Date("2023-11-23T04:46:09.251Z"), upload: { id: "", - path: "/var/tmp", + path: "/System", parts: [ { - number: 44220, - chunkStart: 25897, - chunkEnd: 935145, - url: "https://artistic-impostor.org/", - expiresAt: new Date("2022-12-02T10:43:36.676Z"), + number: 351246, + chunkStart: 995655, + chunkEnd: 228221, + url: "https://twin-humor.org", + expiresAt: new Date("2023-11-06T22:46:44.719Z"), }, ], }, version: "", - service: "organization_avatar", + service: "downloadable", sizeReadable: "", }; ``` diff --git a/docs/models/components/fileuploadcompleted.md b/docs/models/components/fileuploadcompleted.md index 0e895772..94c2cc8e 100644 --- a/docs/models/components/fileuploadcompleted.md +++ b/docs/models/components/fileuploadcompleted.md @@ -7,10 +7,10 @@ import { FileUploadCompleted } from "@polar-sh/sdk/models/components"; let value: FileUploadCompleted = { id: "", - path: "/usr/libexec", + path: "/var/yp", parts: [ { - number: 392658, + number: 836620, checksumEtag: "", checksumSha256Base64: "", }, diff --git a/docs/models/components/granttype.md b/docs/models/components/granttype.md deleted file mode 100644 index 241e8b63..00000000 --- a/docs/models/components/granttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# GrantType - -## Example Usage - -```typescript -import { GrantType } from "@polar-sh/sdk/models/components"; - -let value: GrantType = "authorization_code"; -``` - -## Values - -```typescript -"authorization_code" -``` \ No newline at end of file diff --git a/docs/models/components/granttypes.md b/docs/models/components/granttypes.md index 05aab3b3..76041845 100644 --- a/docs/models/components/granttypes.md +++ b/docs/models/components/granttypes.md @@ -5,7 +5,7 @@ ```typescript import { GrantTypes } from "@polar-sh/sdk/models/components"; -let value: GrantTypes = "refresh_token"; +let value: GrantTypes = "authorization_code"; ``` ## Values diff --git a/docs/models/components/interval.md b/docs/models/components/interval.md index cc0daf08..dc60fec2 100644 --- a/docs/models/components/interval.md +++ b/docs/models/components/interval.md @@ -5,7 +5,7 @@ ```typescript import { Interval } from "@polar-sh/sdk/models/components"; -let value: Interval = "day"; +let value: Interval = "year"; ``` ## Values diff --git a/docs/models/components/introspecttokenresponse.md b/docs/models/components/introspecttokenresponse.md index 42672878..aa44470e 100644 --- a/docs/models/components/introspecttokenresponse.md +++ b/docs/models/components/introspecttokenresponse.md @@ -8,28 +8,28 @@ import { IntrospectTokenResponse } from "@polar-sh/sdk/models/components"; let value: IntrospectTokenResponse = { active: false, clientId: "", - tokenType: "refresh_token", + tokenType: "access_token", scope: "", subType: "organization", sub: "", aud: "", iss: "", - exp: 582474, - iat: 578110, + exp: 566826, + iat: 946161, }; ``` ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | -| `active` | *boolean* | :heavy_check_mark: | N/A | -| `clientId` | *string* | :heavy_check_mark: | N/A | -| `tokenType` | [components.IntrospectTokenResponseTokenType](../../models/components/introspecttokenresponsetokentype.md) | :heavy_check_mark: | N/A | -| `scope` | *string* | :heavy_check_mark: | N/A | -| `subType` | [components.SubType](../../models/components/subtype.md) | :heavy_check_mark: | N/A | -| `sub` | *string* | :heavy_check_mark: | N/A | -| `aud` | *string* | :heavy_check_mark: | N/A | -| `iss` | *string* | :heavy_check_mark: | N/A | -| `exp` | *number* | :heavy_check_mark: | N/A | -| `iat` | *number* | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------------------ | ------------------------------------------------------------ | ------------------------------------------------------------ | ------------------------------------------------------------ | +| `active` | *boolean* | :heavy_check_mark: | N/A | +| `clientId` | *string* | :heavy_check_mark: | N/A | +| `tokenType` | [components.TokenType](../../models/components/tokentype.md) | :heavy_check_mark: | N/A | +| `scope` | *string* | :heavy_check_mark: | N/A | +| `subType` | [components.SubType](../../models/components/subtype.md) | :heavy_check_mark: | N/A | +| `sub` | *string* | :heavy_check_mark: | N/A | +| `aud` | *string* | :heavy_check_mark: | N/A | +| `iss` | *string* | :heavy_check_mark: | N/A | +| `exp` | *number* | :heavy_check_mark: | N/A | +| `iat` | *number* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/introspecttokenresponsetokentype.md b/docs/models/components/introspecttokenresponsetokentype.md deleted file mode 100644 index 56c8f0eb..00000000 --- a/docs/models/components/introspecttokenresponsetokentype.md +++ /dev/null @@ -1,15 +0,0 @@ -# IntrospectTokenResponseTokenType - -## Example Usage - -```typescript -import { IntrospectTokenResponseTokenType } from "@polar-sh/sdk/models/components"; - -let value: IntrospectTokenResponseTokenType = "refresh_token"; -``` - -## Values - -```typescript -"access_token" | "refresh_token" -``` \ No newline at end of file diff --git a/docs/models/components/issue.md b/docs/models/components/issue.md index 721143cc..611fffb9 100644 --- a/docs/models/components/issue.md +++ b/docs/models/components/issue.md @@ -7,14 +7,16 @@ import { Issue } from "@polar-sh/sdk/models/components"; let value: Issue = { id: "03b2937d-4a71-45df-ad25-d8cc157fe616", + platform: "github", number: 904398, title: "", state: "open", - issueCreatedAt: new Date("2022-12-05T12:21:44.955Z"), + issueCreatedAt: new Date("2023-12-05T12:21:44.955Z"), needsConfirmationSolved: false, funding: {}, repository: { id: "a8327ccf-660d-4ac7-9e01-61193aed31ff", + platform: "github", isPrivate: false, name: "MyOrg", description: "beyond political inasmuch deduction cop ack", @@ -24,6 +26,7 @@ let value: Issue = { profileSettings: {}, organization: { id: "5a060d2a-42e9-4e4d-8f6e-55ff3d5fde94", + platform: "github", name: "", avatarUrl: "https://reckless-release.biz", isPersonal: false, @@ -37,8 +40,8 @@ let value: Issue = { organizationId: "", }, internalOrganization: { - createdAt: new Date("2022-05-14T15:19:31.084Z"), - modifiedAt: new Date("2023-11-22T11:58:20.036Z"), + createdAt: new Date("2023-05-14T15:19:31.084Z"), + modifiedAt: new Date("2024-11-21T11:58:20.036Z"), id: "", name: "", slug: "", diff --git a/docs/models/components/licensekeyactivationbase.md b/docs/models/components/licensekeyactivationbase.md index 6f269605..cfa7b191 100644 --- a/docs/models/components/licensekeyactivationbase.md +++ b/docs/models/components/licensekeyactivationbase.md @@ -10,8 +10,8 @@ let value: LicenseKeyActivationBase = { licenseKeyId: "", label: "", meta: {}, - createdAt: new Date("2022-09-01T22:40:44.792Z"), - modifiedAt: new Date("2024-01-28T00:15:15.202Z"), + createdAt: new Date("2024-06-21T12:17:16.742Z"), + modifiedAt: new Date("2025-06-13T22:38:03.801Z"), }; ``` diff --git a/docs/models/components/licensekeyactivationread.md b/docs/models/components/licensekeyactivationread.md index 18bb770f..12913e43 100644 --- a/docs/models/components/licensekeyactivationread.md +++ b/docs/models/components/licensekeyactivationread.md @@ -10,8 +10,8 @@ let value: LicenseKeyActivationRead = { licenseKeyId: "", label: "", meta: {}, - createdAt: new Date("2022-03-13T11:24:21.889Z"), - modifiedAt: new Date("2024-01-24T09:32:26.939Z"), + createdAt: new Date("2024-01-23T09:56:09.230Z"), + modifiedAt: new Date("2023-02-10T02:38:46.323Z"), licenseKey: { id: "", organizationId: "", @@ -19,38 +19,38 @@ let value: LicenseKeyActivationRead = { customerId: "", user: { id: "", - email: "Bryon.Labadie-Grimes@yahoo.com", + email: "Marco.DuBuque47@hotmail.com", publicName: "", }, customer: { - createdAt: new Date("2022-09-27T08:48:38.427Z"), - modifiedAt: new Date("2023-09-16T21:19:37.654Z"), + createdAt: new Date("2024-07-19T04:11:44.002Z"), + modifiedAt: new Date("2025-09-05T03:00:40.973Z"), id: "", metadata: { - "key": "", + "key": 369529, }, - email: "Harmony38@gmail.com", + email: "Maurice.Larson@hotmail.com", emailVerified: false, name: "", billingAddress: { - country: "Nauru", + country: "Malta", }, taxId: [ "", ], organizationId: "", - avatarUrl: "https://rapid-toothbrush.name/", + avatarUrl: "https://merry-sonar.biz", }, benefitId: "", key: "", displayKey: "", status: "disabled", - limitActivations: 684229, - usage: 947182, - limitUsage: 407209, - validations: 772726, - lastValidatedAt: new Date("2023-07-13T01:37:39.797Z"), - expiresAt: new Date("2022-02-24T05:49:24.787Z"), + limitActivations: 578185, + usage: 75685, + limitUsage: 313717, + validations: 982685, + lastValidatedAt: new Date("2024-11-03T05:08:26.435Z"), + expiresAt: new Date("2024-04-05T01:01:35.221Z"), }, }; ``` diff --git a/docs/models/components/licensekeycustomer.md b/docs/models/components/licensekeycustomer.md index 1ea7c8f8..64a7792f 100644 --- a/docs/models/components/licensekeycustomer.md +++ b/docs/models/components/licensekeycustomer.md @@ -6,23 +6,23 @@ import { LicenseKeyCustomer } from "@polar-sh/sdk/models/components"; let value: LicenseKeyCustomer = { - createdAt: new Date("2022-04-16T13:09:43.732Z"), - modifiedAt: new Date("2023-09-18T23:44:01.372Z"), + createdAt: new Date("2024-08-21T10:14:28.976Z"), + modifiedAt: new Date("2023-08-18T13:45:43.796Z"), id: "", metadata: { "key": "", }, - email: "Ahmad66@yahoo.com", + email: "Elwin_DAmore@hotmail.com", emailVerified: false, name: "", billingAddress: { - country: "Syrian Arab Republic", + country: "Tuvalu", }, taxId: [ - "", + "no_vat", ], organizationId: "", - avatarUrl: "https://unlawful-rationale.org/", + avatarUrl: "https://enchanting-aftermath.org", }; ``` diff --git a/docs/models/components/licensekeycustomermetadata.md b/docs/models/components/licensekeycustomermetadata.md index bca8a917..bc77b707 100644 --- a/docs/models/components/licensekeycustomermetadata.md +++ b/docs/models/components/licensekeycustomermetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 389932; +const value: number = 929429; ``` ### `boolean` diff --git a/docs/models/components/licensekeycustomertaxid.md b/docs/models/components/licensekeycustomertaxid.md index fbdd98ab..c1999c76 100644 --- a/docs/models/components/licensekeycustomertaxid.md +++ b/docs/models/components/licensekeycustomertaxid.md @@ -12,6 +12,6 @@ const value: string = ""; ### `components.TaxIDFormat` ```typescript -const value: components.TaxIDFormat = "ch_uid"; +const value: components.TaxIDFormat = "ph_tin"; ``` diff --git a/docs/models/components/licensekeyread.md b/docs/models/components/licensekeyread.md index e1c9ab5a..a8f41aa1 100644 --- a/docs/models/components/licensekeyread.md +++ b/docs/models/components/licensekeyread.md @@ -12,38 +12,38 @@ let value: LicenseKeyRead = { customerId: "", user: { id: "", - email: "Magnus79@gmail.com", + email: "Florian62@yahoo.com", publicName: "", }, customer: { - createdAt: new Date("2022-04-28T19:28:15.954Z"), - modifiedAt: new Date("2024-07-11T04:31:02.339Z"), + createdAt: new Date("2025-01-19T21:57:03.473Z"), + modifiedAt: new Date("2025-11-04T02:39:44.261Z"), id: "", metadata: { - "key": 51410, + "key": 772726, }, - email: "Jaylen_Heaney@yahoo.com", + email: "Amara_Kautzer86@yahoo.com", emailVerified: false, name: "", billingAddress: { - country: "Malaysia", + country: "United Kingdom", }, taxId: [ - "", + "sv_nit", ], organizationId: "", - avatarUrl: "https://exotic-remark.org/", + avatarUrl: "https://lighthearted-settler.biz", }, benefitId: "", key: "", displayKey: "", status: "granted", - limitActivations: 547940, - usage: 147103, - limitUsage: 54255, - validations: 39457, - lastValidatedAt: new Date("2023-04-16T01:57:22.078Z"), - expiresAt: new Date("2023-04-12T03:41:23.498Z"), + limitActivations: 172693, + usage: 997982, + limitUsage: 192181, + validations: 700751, + lastValidatedAt: new Date("2024-05-21T10:20:56.336Z"), + expiresAt: new Date("2023-02-06T11:47:57.029Z"), }; ``` diff --git a/docs/models/components/licensekeystatus.md b/docs/models/components/licensekeystatus.md index 20a60da0..104dfebf 100644 --- a/docs/models/components/licensekeystatus.md +++ b/docs/models/components/licensekeystatus.md @@ -5,7 +5,7 @@ ```typescript import { LicenseKeyStatus } from "@polar-sh/sdk/models/components"; -let value: LicenseKeyStatus = "revoked"; +let value: LicenseKeyStatus = "granted"; ``` ## Values diff --git a/docs/models/components/licensekeyuser.md b/docs/models/components/licensekeyuser.md index 176054e8..a0dc187f 100644 --- a/docs/models/components/licensekeyuser.md +++ b/docs/models/components/licensekeyuser.md @@ -7,7 +7,7 @@ import { LicenseKeyUser } from "@polar-sh/sdk/models/components"; let value: LicenseKeyUser = { id: "", - email: "Jessy42@yahoo.com", + email: "Wava_Gottlieb81@gmail.com", publicName: "", }; ``` diff --git a/docs/models/components/licensekeywithactivations.md b/docs/models/components/licensekeywithactivations.md index 8c709e37..378a5ba9 100644 --- a/docs/models/components/licensekeywithactivations.md +++ b/docs/models/components/licensekeywithactivations.md @@ -12,46 +12,46 @@ let value: LicenseKeyWithActivations = { customerId: "", user: { id: "", - email: "Iliana67@yahoo.com", + email: "Carmel.Moore@yahoo.com", publicName: "", }, customer: { - createdAt: new Date("2024-11-29T00:56:56.666Z"), - modifiedAt: new Date("2022-03-16T03:46:29.479Z"), + createdAt: new Date("2025-10-26T06:09:24.035Z"), + modifiedAt: new Date("2025-10-06T17:08:38.130Z"), id: "", metadata: { - "key": "", + "key": 502713, }, - email: "Tyshawn.Mann27@gmail.com", + email: "Tia7@yahoo.com", emailVerified: false, name: "", billingAddress: { - country: "Pitcairn Islands", + country: "North Macedonia", }, taxId: [ - "", + "hu_tin", ], organizationId: "", - avatarUrl: "https://frozen-reasoning.info", + avatarUrl: "https://tattered-jazz.name", }, benefitId: "", key: "", displayKey: "", - status: "revoked", - limitActivations: 125830, - usage: 106842, - limitUsage: 541842, - validations: 637070, - lastValidatedAt: new Date("2022-04-11T23:24:18.548Z"), - expiresAt: new Date("2022-06-02T19:37:32.666Z"), + status: "granted", + limitActivations: 330422, + usage: 287648, + limitUsage: 45663, + validations: 583034, + lastValidatedAt: new Date("2025-07-12T13:06:18.566Z"), + expiresAt: new Date("2025-04-24T06:18:14.536Z"), activations: [ { id: "", licenseKeyId: "", label: "", meta: {}, - createdAt: new Date("2022-02-05T13:22:26.842Z"), - modifiedAt: new Date("2022-06-27T23:59:54.198Z"), + createdAt: new Date("2023-09-28T06:11:19.187Z"), + modifiedAt: new Date("2024-10-04T14:17:24.216Z"), }, ], }; diff --git a/docs/models/components/listresourcebenefit.md b/docs/models/components/listresourcebenefit.md index f683572e..72230128 100644 --- a/docs/models/components/listresourcebenefit.md +++ b/docs/models/components/listresourcebenefit.md @@ -8,27 +8,19 @@ import { ListResourceBenefit } from "@polar-sh/sdk/models/components"; let value: ListResourceBenefit = { items: [ { - createdAt: new Date("2023-09-16T09:06:29.012Z"), - modifiedAt: new Date("2024-01-28T04:45:11.023Z"), + createdAt: new Date("2025-11-24T23:28:20.095Z"), + modifiedAt: new Date("2024-02-29T02:47:26.443Z"), id: "", - description: - "cumbersome drag battle briskly nor tame bravely fill essence", + description: "fill essence coincide", selectable: false, deletable: false, organizationId: "", - properties: { - archived: { - "key": false, - }, - files: [ - "", - ], - }, + properties: {}, }, ], pagination: { - totalCount: 355674, - maxPage: 805165, + totalCount: 479035, + maxPage: 480043, }, }; ``` diff --git a/docs/models/components/listresourcebenefitgrant.md b/docs/models/components/listresourcebenefitgrant.md index ac92d7ba..4badc15d 100644 --- a/docs/models/components/listresourcebenefitgrant.md +++ b/docs/models/components/listresourcebenefitgrant.md @@ -8,8 +8,8 @@ import { ListResourceBenefitGrant } from "@polar-sh/sdk/models/components"; let value: ListResourceBenefitGrant = { items: [ { - createdAt: new Date("2024-09-30T03:17:45.166Z"), - modifiedAt: new Date("2022-06-17T16:03:26.154Z"), + createdAt: new Date("2024-10-09T22:41:15.933Z"), + modifiedAt: new Date("2023-10-30T11:14:17.437Z"), id: "", isGranted: false, isRevoked: false, @@ -18,12 +18,31 @@ let value: ListResourceBenefitGrant = { customerId: "", userId: "", benefitId: "", + customer: { + createdAt: new Date("2023-01-25T13:17:01.010Z"), + modifiedAt: new Date("2025-01-21T08:21:59.543Z"), + id: "", + metadata: { + "key": 724231, + }, + email: "Justina_Considine22@gmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Burkina Faso", + }, + taxId: [ + "", + ], + organizationId: "", + avatarUrl: "https://overcooked-seafood.biz", + }, properties: {}, }, ], pagination: { - totalCount: 59303, - maxPage: 58922, + totalCount: 898908, + maxPage: 533956, }, }; ``` diff --git a/docs/models/components/listresourcecheckout.md b/docs/models/components/listresourcecheckout.md index 16f3b612..3248b350 100644 --- a/docs/models/components/listresourcecheckout.md +++ b/docs/models/components/listresourcecheckout.md @@ -8,20 +8,21 @@ import { ListResourceCheckout } from "@polar-sh/sdk/models/components"; let value: ListResourceCheckout = { items: [ { - createdAt: new Date("2024-03-15T06:55:36.691Z"), - modifiedAt: new Date("2022-03-11T06:32:22.622Z"), + createdAt: new Date("2024-11-29T08:31:54.256Z"), + modifiedAt: new Date("2024-11-23T01:06:43.392Z"), id: "", - status: "expired", + paymentProcessor: "stripe", + status: "open", clientSecret: "", - url: "https://puny-t-shirt.com/", - expiresAt: new Date("2024-06-13T14:44:19.237Z"), - successUrl: "https://ample-rubric.name", + url: "https://elegant-avalanche.com", + expiresAt: new Date("2024-12-20T19:57:52.166Z"), + successUrl: "https://that-bump.net", embedOrigin: "", - amount: 799929, - taxAmount: 408868, - currency: "Kina", - subtotalAmount: 198804, - totalAmount: 191844, + amount: 650918, + taxAmount: 214929, + currency: "Solomon Islands Dollar", + subtotalAmount: 741334, + totalAmount: 108001, productId: "", productPriceId: "", discountId: "", @@ -33,42 +34,45 @@ let value: ListResourceCheckout = { isPaymentFormRequired: false, customerId: "", customerName: "", - customerEmail: "Josiane42@yahoo.com", + customerEmail: "Loyce_Runolfsdottir85@gmail.com", customerIpAddress: "", customerBillingAddress: { - country: "Bonaire, Sint Eustatius and Saba", + country: "Romania", }, customerTaxId: "", paymentProcessorMetadata: {}, metadata: { - "key": "", + "key": 519391, }, product: { - createdAt: new Date("2024-01-20T08:30:25.562Z"), - modifiedAt: new Date("2022-10-06T03:14:11.675Z"), + createdAt: new Date("2023-11-08T07:32:04.078Z"), + modifiedAt: new Date("2023-10-22T21:26:13.900Z"), id: "", name: "", - description: "astride yahoo lotion daddy", + description: "gerbil crafty er if", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2022-05-21T04:29:40.711Z"), - modifiedAt: new Date("2023-02-27T13:23:36.620Z"), + createdAt: new Date("2024-08-02T20:34:34.106Z"), + modifiedAt: new Date("2023-01-12T17:05:53.623Z"), id: "", isArchived: false, productId: "", + priceCurrency: "", + minimumAmount: 348739, + maximumAmount: 790463, + presetAmount: 346895, }, ], benefits: [ { - createdAt: new Date("2023-06-22T00:09:40.274Z"), - modifiedAt: new Date("2022-07-19T21:06:20.014Z"), + createdAt: new Date("2024-07-12T06:43:06.103Z"), + modifiedAt: new Date("2024-01-15T21:48:36.807Z"), id: "", - type: "downloadables", - description: - "but quizzically questionably pale whereas jet likewise miserable captain", + type: "ads", + description: "now yawningly properly reconsideration", selectable: false, deletable: false, organizationId: "", @@ -79,39 +83,34 @@ let value: ListResourceCheckout = { id: "", organizationId: "", name: "", - path: "/media", + path: "/home/user/dir", mimeType: "", - size: 692805, + size: 227674, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-07-29T22:36:00.302Z"), + lastModifiedAt: new Date("2024-11-19T03:49:47.610Z"), version: "", isUploaded: false, - createdAt: new Date("2022-05-25T01:58:48.147Z"), + createdAt: new Date("2024-12-15T08:19:30.151Z"), sizeReadable: "", - publicUrl: "https://that-desk.biz/", + publicUrl: "https://chilly-editor.com", }, ], }, productPrice: { - createdAt: new Date("2023-10-05T12:58:35.956Z"), - modifiedAt: new Date("2024-10-09T07:53:41.828Z"), + createdAt: new Date("2025-10-05T20:19:18.073Z"), + modifiedAt: new Date("2023-04-07T08:31:51.847Z"), id: "", isArchived: false, productId: "", - priceCurrency: "", - minimumAmount: 681972, - maximumAmount: 561972, - presetAmount: 711598, - recurringInterval: "year", }, discount: { - duration: "forever", - durationInMonths: 807291, + duration: "repeating", + durationInMonths: 997706, type: "percentage", - basisPoints: 696477, + basisPoints: 262638, id: "", name: "", code: "", @@ -121,18 +120,18 @@ let value: ListResourceCheckout = { { customFieldId: "", customField: { - createdAt: new Date("2022-11-03T20:32:51.033Z"), - modifiedAt: new Date("2023-11-30T08:31:54.256Z"), + createdAt: new Date("2025-01-24T06:51:24.305Z"), + modifiedAt: new Date("2025-01-14T23:41:16.557Z"), id: "", metadata: { - "key": 23910, + "key": 353121, }, slug: "", name: "", organizationId: "", properties: {}, }, - order: 747110, + order: 519797, required: false, }, ], @@ -142,8 +141,8 @@ let value: ListResourceCheckout = { }, ], pagination: { - totalCount: 54490, - maxPage: 153199, + totalCount: 596791, + maxPage: 772402, }, }; ``` diff --git a/docs/models/components/listresourcecheckoutlink.md b/docs/models/components/listresourcecheckoutlink.md index 63478432..ed49c283 100644 --- a/docs/models/components/listresourcecheckoutlink.md +++ b/docs/models/components/listresourcecheckoutlink.md @@ -8,48 +8,49 @@ import { ListResourceCheckoutLink } from "@polar-sh/sdk/models/components"; let value: ListResourceCheckoutLink = { items: [ { - createdAt: new Date("2022-01-15T12:50:59.883Z"), - modifiedAt: new Date("2023-04-11T22:26:51.446Z"), + createdAt: new Date("2025-09-30T14:20:49.162Z"), + modifiedAt: new Date("2024-01-31T23:13:50.155Z"), id: "", metadata: { - "key": 863273, + "key": false, }, + paymentProcessor: "stripe", clientSecret: "", - successUrl: "https://waterlogged-switchboard.org/", + successUrl: "https://ruddy-junior.info/", label: "", allowDiscountCodes: false, productId: "", productPriceId: "", discountId: "", product: { - createdAt: new Date("2023-12-06T08:47:09.306Z"), - modifiedAt: new Date("2023-05-27T10:58:25.218Z"), + createdAt: new Date("2023-09-11T20:14:52.407Z"), + modifiedAt: new Date("2025-12-18T06:02:19.380Z"), id: "", name: "", - description: - "nor yuck bah verbally busy quarrelsomely wry zowie inasmuch", + description: "malfunction keel tune-up", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2023-10-02T00:07:14.901Z"), - modifiedAt: new Date("2024-07-12T13:06:18.566Z"), + createdAt: new Date("2023-03-21T05:24:16.803Z"), + modifiedAt: new Date("2023-07-07T13:31:28.655Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - priceAmount: 770313, + priceAmount: 634157, recurringInterval: "month", }, ], benefits: [ { - createdAt: new Date("2023-10-05T14:17:24.216Z"), - modifiedAt: new Date("2023-06-22T12:17:16.742Z"), + createdAt: new Date("2025-10-02T08:39:37.015Z"), + modifiedAt: new Date("2025-05-19T10:16:04.212Z"), id: "", - type: "downloadables", - description: "meaningfully royal chip bloom representation", + type: "ads", + description: + "pivot proud gee yippee hm white scorn as thankfully vista", selectable: false, deletable: false, organizationId: "", @@ -60,57 +61,56 @@ let value: ListResourceCheckoutLink = { id: "", organizationId: "", name: "", - path: "/etc/namedb", + path: "/etc/mail", mimeType: "", - size: 697160, + size: 396784, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2023-06-23T14:49:51.984Z"), + lastModifiedAt: new Date("2023-02-23T08:23:08.142Z"), version: "", isUploaded: false, - createdAt: new Date("2023-04-11T09:26:51.246Z"), + createdAt: new Date("2024-11-27T18:36:35.061Z"), sizeReadable: "", - publicUrl: "https://wretched-casket.biz/", + publicUrl: "https://roasted-gown.net", }, ], }, productPrice: { - createdAt: new Date("2024-10-22T02:46:29.890Z"), - modifiedAt: new Date("2024-09-24T18:40:19.566Z"), + createdAt: new Date("2025-06-26T13:10:48.126Z"), + modifiedAt: new Date("2023-12-24T14:14:54.996Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - priceAmount: 438193, - recurringInterval: "month", + priceAmount: 747067, }, discount: { - duration: "repeating", + duration: "once", type: "percentage", - amount: 393289, - currency: "Cayman Islands Dollar", - createdAt: new Date("2023-12-24T15:51:09.728Z"), - modifiedAt: new Date("2023-05-26T06:35:27.544Z"), + amount: 767388, + currency: "Syrian Pound", + createdAt: new Date("2025-04-10T01:04:29.834Z"), + modifiedAt: new Date("2023-04-16T01:33:18.918Z"), id: "", metadata: { - "key": "", + "key": false, }, name: "", code: "", - startsAt: new Date("2022-11-23T01:03:25.540Z"), - endsAt: new Date("2023-07-21T23:24:04.907Z"), - maxRedemptions: 994532, - redemptionsCount: 489926, + startsAt: new Date("2024-02-18T20:51:07.229Z"), + endsAt: new Date("2023-08-29T18:03:19.269Z"), + maxRedemptions: 567567, + redemptionsCount: 345865, organizationId: "", }, - url: "https://warmhearted-excess.com/", + url: "https://rowdy-step.org", }, ], pagination: { - totalCount: 72285, - maxPage: 171134, + totalCount: 799564, + maxPage: 141549, }, }; ``` diff --git a/docs/models/components/listresourcecustomer.md b/docs/models/components/listresourcecustomer.md index 9c78ea4b..564a0ce6 100644 --- a/docs/models/components/listresourcecustomer.md +++ b/docs/models/components/listresourcecustomer.md @@ -8,28 +8,28 @@ import { ListResourceCustomer } from "@polar-sh/sdk/models/components"; let value: ListResourceCustomer = { items: [ { - createdAt: new Date("2024-06-08T19:16:48.368Z"), - modifiedAt: new Date("2023-10-08T06:12:11.011Z"), + createdAt: new Date("2025-05-29T02:01:29.899Z"), + modifiedAt: new Date("2024-06-08T02:59:50.162Z"), id: "", metadata: { - "key": 497351, + "key": "", }, - email: "Marshall12@gmail.com", + email: "Rebeka.Kuvalis@gmail.com", emailVerified: false, name: "", billingAddress: { - country: "Ecuador", + country: "Botswana", }, taxId: [ - "kr_brn", + "", ], organizationId: "", - avatarUrl: "https://joyful-skyscraper.org/", + avatarUrl: "https://winged-birdcage.name/", }, ], pagination: { - totalCount: 18165, - maxPage: 146654, + totalCount: 920860, + maxPage: 76856, }, }; ``` diff --git a/docs/models/components/listresourcecustomerbenefitgrant.md b/docs/models/components/listresourcecustomerbenefitgrant.md index 21c3c322..f615b211 100644 --- a/docs/models/components/listresourcecustomerbenefitgrant.md +++ b/docs/models/components/listresourcecustomerbenefitgrant.md @@ -8,55 +8,84 @@ import { ListResourceCustomerBenefitGrant } from "@polar-sh/sdk/models/component let value: ListResourceCustomerBenefitGrant = { items: [ { - createdAt: new Date("2023-09-14T12:44:39.147Z"), - modifiedAt: new Date("2024-01-17T20:25:36.336Z"), + createdAt: new Date("2024-04-30T14:47:06.099Z"), + modifiedAt: new Date("2024-08-10T20:04:48.452Z"), id: "", - grantedAt: new Date("2024-03-28T01:33:27.085Z"), - revokedAt: new Date("2023-05-05T14:22:26.737Z"), + grantedAt: new Date("2023-10-23T05:03:16.724Z"), + revokedAt: new Date("2025-01-31T15:21:17.859Z"), customerId: "", benefitId: "", subscriptionId: "", orderId: "", isGranted: false, isRevoked: false, + customer: { + createdAt: new Date("2025-02-17T01:57:41.434Z"), + modifiedAt: new Date("2024-07-24T20:12:09.049Z"), + id: "", + email: "Magnus7@hotmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Sri Lanka", + }, + taxId: [ + "", + ], + oauthAccounts: { + "key": { + accountId: "", + accountUsername: "", + }, + }, + }, benefit: { - createdAt: new Date("2023-04-18T04:00:42.753Z"), - modifiedAt: new Date("2023-05-31T08:15:17.595Z"), + createdAt: new Date("2025-04-24T09:01:08.745Z"), + modifiedAt: new Date("2025-12-11T00:30:42.283Z"), id: "", description: - "crocodile till what now conceal gadzooks sleepily ostrich at", + "indolent geez brr tabletop deserted vibrant redress provided happy", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2023-08-31T15:14:32.439Z"), - modifiedAt: new Date("2024-05-06T08:24:14.767Z"), + createdAt: new Date("2023-08-09T05:17:44.333Z"), + modifiedAt: new Date("2024-07-30T13:05:52.298Z"), id: "", name: "", slug: "", - avatarUrl: "https://mealy-gym.com/", + avatarUrl: "https://unusual-accompanist.org", bio: "", - company: "Jacobson, Hintz and Pacocha", + company: "Weimann LLC", blog: "", location: "", - email: "Gaetano75@yahoo.com", + email: "Lori.Waelchi@yahoo.com", twitterUsername: "", - pledgeMinimumAmount: 790346, + pledgeMinimumAmount: 190139, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 543473, + defaultUpfrontSplitToContributors: 428147, profileSettings: {}, featureSettings: {}, }, properties: { - note: "", + prefix: "", + expires: { + ttl: 296892, + timeframe: "day", + }, + activations: { + limit: 753129, + enableCustomerAdmin: false, + }, + limitUsage: 771396, }, }, properties: {}, }, ], pagination: { - totalCount: 820068, - maxPage: 268483, + totalCount: 394352, + maxPage: 191389, }, }; ``` diff --git a/docs/models/components/listresourcecustomerorder.md b/docs/models/components/listresourcecustomerorder.md index 89673145..672d2503 100644 --- a/docs/models/components/listresourcecustomerorder.md +++ b/docs/models/components/listresourcecustomerorder.md @@ -8,49 +8,47 @@ import { ListResourceCustomerOrder } from "@polar-sh/sdk/models/components"; let value: ListResourceCustomerOrder = { items: [ { - createdAt: new Date("2023-11-10T04:02:31.063Z"), - modifiedAt: new Date("2022-08-30T19:42:05.316Z"), + createdAt: new Date("2023-08-20T22:40:34.497Z"), + modifiedAt: new Date("2023-10-18T09:20:55.521Z"), id: "", - amount: 294893, - taxAmount: 402178, - currency: "Saint Helena Pound", + amount: 678571, + taxAmount: 747040, + currency: "Mexican Peso", customerId: "", productId: "", productPriceId: "", subscriptionId: "", userId: "", product: { - createdAt: new Date("2024-09-17T23:36:54.053Z"), - modifiedAt: new Date("2022-01-27T21:17:56.684Z"), + createdAt: new Date("2023-11-05T10:37:25.746Z"), + modifiedAt: new Date("2023-07-24T16:49:09.098Z"), id: "", name: "", - description: - "trench schedule gladly limply fidget aw elegant culture inasmuch ugh", + description: "diver merry neglect arrogantly which nor and reiterate", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2022-04-25T11:53:31.235Z"), - modifiedAt: new Date("2022-05-03T03:10:03.746Z"), + createdAt: new Date("2025-06-13T13:52:47.549Z"), + modifiedAt: new Date("2023-01-13T15:47:28.412Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - minimumAmount: 927286, - maximumAmount: 218555, - presetAmount: 270281, - recurringInterval: "year", + minimumAmount: 787698, + maximumAmount: 525954, + presetAmount: 833729, }, ], benefits: [ { - createdAt: new Date("2023-06-18T14:25:02.046Z"), - modifiedAt: new Date("2023-09-02T01:59:47.325Z"), + createdAt: new Date("2023-09-03T13:09:52.861Z"), + modifiedAt: new Date("2024-02-17T21:50:42.420Z"), id: "", - type: "discord", + type: "downloadables", description: - "vibration incidentally up round sophisticated violently", + "wetly frankly when gloat unearth up brandish uselessly since", selectable: false, deletable: false, organizationId: "", @@ -61,65 +59,63 @@ let value: ListResourceCustomerOrder = { id: "", organizationId: "", name: "", - path: "/usr/src", + path: "/var/yp", mimeType: "", - size: 268674, + size: 527006, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-07-09T22:51:22.991Z"), + lastModifiedAt: new Date("2023-10-04T20:17:34.089Z"), version: "", isUploaded: false, - createdAt: new Date("2024-04-09T16:23:40.595Z"), + createdAt: new Date("2023-02-12T16:51:53.079Z"), sizeReadable: "", - publicUrl: "https://dapper-technologist.com", + publicUrl: "https://content-governance.biz", }, ], organization: { - createdAt: new Date("2024-01-08T16:17:32.860Z"), - modifiedAt: new Date("2024-01-04T09:31:36.839Z"), + createdAt: new Date("2024-04-01T20:50:24.365Z"), + modifiedAt: new Date("2025-09-19T23:23:51.226Z"), id: "", name: "", slug: "", - avatarUrl: "https://enchanted-commodity.name", + avatarUrl: "https://unwieldy-shark.biz/", bio: "", - company: "Gottlieb, Schinner and Hammes", + company: "Hills - Moen", blog: "", location: "", - email: "Markus_Ankunding@gmail.com", + email: "Ward.Moore@hotmail.com", twitterUsername: "", - pledgeMinimumAmount: 785318, + pledgeMinimumAmount: 544779, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 355921, + defaultUpfrontSplitToContributors: 40176, profileSettings: {}, featureSettings: {}, }, }, productPrice: { - createdAt: new Date("2023-05-07T01:33:06.900Z"), - modifiedAt: new Date("2023-06-17T05:41:02.707Z"), + createdAt: new Date("2023-10-26T20:34:22.774Z"), + modifiedAt: new Date("2023-03-21T01:09:01.645Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - minimumAmount: 156181, - maximumAmount: 803459, - presetAmount: 290592, + priceAmount: 547611, }, subscription: { - createdAt: new Date("2023-07-20T20:38:40.921Z"), - modifiedAt: new Date("2022-10-27T06:47:16.886Z"), + createdAt: new Date("2024-01-21T14:13:42.501Z"), + modifiedAt: new Date("2024-02-16T07:53:13.439Z"), id: "", - amount: 859284, - currency: "Manat", - recurringInterval: "year", - status: "trialing", - currentPeriodStart: new Date("2024-08-30T02:25:42.565Z"), - currentPeriodEnd: new Date("2024-07-30T07:23:10.648Z"), + amount: 789168, + currency: "Uzbekistan Sum", + recurringInterval: "month", + status: "incomplete_expired", + currentPeriodStart: new Date("2024-06-02T02:39:13.052Z"), + currentPeriodEnd: new Date("2023-05-04T17:14:22.025Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2023-09-21T21:20:54.703Z"), - endedAt: new Date("2022-06-11T17:47:53.592Z"), + startedAt: new Date("2024-02-28T15:29:51.757Z"), + endedAt: new Date("2023-11-28T02:07:26.226Z"), customerId: "", productId: "", priceId: "", @@ -129,8 +125,8 @@ let value: ListResourceCustomerOrder = { }, ], pagination: { - totalCount: 704149, - maxPage: 944788, + totalCount: 921977, + maxPage: 198534, }, }; ``` diff --git a/docs/models/components/listresourcecustomersubscription.md b/docs/models/components/listresourcecustomersubscription.md index bd6cbc4b..76cb9081 100644 --- a/docs/models/components/listresourcecustomersubscription.md +++ b/docs/models/components/listresourcecustomersubscription.md @@ -8,18 +8,18 @@ import { ListResourceCustomerSubscription } from "@polar-sh/sdk/models/component let value: ListResourceCustomerSubscription = { items: [ { - createdAt: new Date("2022-03-04T10:13:58.711Z"), - modifiedAt: new Date("2022-10-26T20:34:22.774Z"), + createdAt: new Date("2023-10-24T17:16:51.911Z"), + modifiedAt: new Date("2023-06-14T13:59:56.674Z"), id: "", - amount: 72124, - currency: "Kyat", - recurringInterval: "month", - status: "trialing", - currentPeriodStart: new Date("2024-05-14T22:15:44.887Z"), - currentPeriodEnd: new Date("2024-09-17T19:20:42.432Z"), + amount: 638493, + currency: "Cuban Peso", + recurringInterval: "year", + status: "incomplete_expired", + currentPeriodStart: new Date("2023-03-13T09:32:54.501Z"), + currentPeriodEnd: new Date("2024-05-07T00:30:07.587Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2022-07-01T14:29:36.398Z"), - endedAt: new Date("2022-11-02T18:12:33.953Z"), + startedAt: new Date("2024-11-28T13:10:32.383Z"), + endedAt: new Date("2023-04-14T04:07:05.692Z"), customerId: "", productId: "", priceId: "", @@ -27,30 +27,34 @@ let value: ListResourceCustomerSubscription = { checkoutId: "", userId: "", product: { - createdAt: new Date("2023-06-03T02:39:13.052Z"), - modifiedAt: new Date("2022-05-04T17:14:22.025Z"), + createdAt: new Date("2024-08-25T11:47:00.419Z"), + modifiedAt: new Date("2024-04-23T18:30:17.394Z"), id: "", name: "", - description: "yippee narrate apud fully curse decisive", + description: "till salty astride lazily worth", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2024-09-19T18:07:16.947Z"), - modifiedAt: new Date("2023-04-22T10:31:33.307Z"), + createdAt: new Date("2024-08-23T10:15:12.130Z"), + modifiedAt: new Date("2023-02-24T19:05:40.409Z"), id: "", isArchived: false, productId: "", + priceCurrency: "", + minimumAmount: 676732, + maximumAmount: 565430, + presetAmount: 515900, }, ], benefits: [ { - createdAt: new Date("2024-08-08T08:09:49.487Z"), - modifiedAt: new Date("2024-02-05T02:33:57.609Z"), + createdAt: new Date("2025-04-20T00:33:39.135Z"), + modifiedAt: new Date("2025-05-08T03:46:45.933Z"), id: "", type: "ads", - description: "husky avalanche squid noxious connect amused", + description: "duh enraged proofread blah", selectable: false, deletable: false, organizationId: "", @@ -61,57 +65,57 @@ let value: ListResourceCustomerSubscription = { id: "", organizationId: "", name: "", - path: "/private", + path: "/etc/mail", mimeType: "", - size: 473905, + size: 574906, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-01-29T05:16:30.896Z"), + lastModifiedAt: new Date("2023-03-22T03:07:22.809Z"), version: "", isUploaded: false, - createdAt: new Date("2022-10-19T23:23:19.077Z"), + createdAt: new Date("2024-05-11T13:10:25.231Z"), sizeReadable: "", - publicUrl: "https://impolite-bowling.name", + publicUrl: "https://our-wallaby.biz", }, ], organization: { - createdAt: new Date("2022-01-29T22:14:42.973Z"), - modifiedAt: new Date("2024-02-25T14:45:53.645Z"), + createdAt: new Date("2024-12-13T07:19:22.635Z"), + modifiedAt: new Date("2025-10-21T11:47:33.986Z"), id: "", name: "", slug: "", - avatarUrl: "https://partial-sunbeam.net/", + avatarUrl: "https://murky-stay.biz/", bio: "", - company: "Kemmer Inc", + company: "Zboncak - Jaskolski", blog: "", location: "", - email: "Garnett_Conroy@yahoo.com", + email: "Myah69@gmail.com", twitterUsername: "", - pledgeMinimumAmount: 982213, + pledgeMinimumAmount: 391915, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 872528, + defaultUpfrontSplitToContributors: 763739, profileSettings: {}, featureSettings: {}, }, }, price: { - createdAt: new Date("2023-02-09T12:38:41.237Z"), - modifiedAt: new Date("2022-03-15T02:39:13.427Z"), + createdAt: new Date("2023-02-23T15:09:30.145Z"), + modifiedAt: new Date("2024-03-24T17:37:09.177Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - minimumAmount: 342521, - maximumAmount: 245684, - presetAmount: 608551, + minimumAmount: 29265, + maximumAmount: 952242, + presetAmount: 409388, }, }, ], pagination: { - totalCount: 720164, - maxPage: 292425, + totalCount: 579240, + maxPage: 940735, }, }; ``` diff --git a/docs/models/components/listresourcecustomfield.md b/docs/models/components/listresourcecustomfield.md index 97e0c283..98d5a9ac 100644 --- a/docs/models/components/listresourcecustomfield.md +++ b/docs/models/components/listresourcecustomfield.md @@ -8,8 +8,8 @@ import { ListResourceCustomField } from "@polar-sh/sdk/models/components"; let value: ListResourceCustomField = { items: [ { - createdAt: new Date("2024-07-13T15:18:15.743Z"), - modifiedAt: new Date("2022-04-13T08:13:23.724Z"), + createdAt: new Date("2023-08-07T11:34:37.599Z"), + modifiedAt: new Date("2023-05-30T14:52:38.641Z"), id: "", metadata: { "key": "", @@ -17,19 +17,12 @@ let value: ListResourceCustomField = { slug: "", name: "", organizationId: "", - properties: { - options: [ - { - value: "", - label: "", - }, - ], - }, + properties: {}, }, ], pagination: { - totalCount: 817785, - maxPage: 441969, + totalCount: 619134, + maxPage: 98946, }, }; ``` diff --git a/docs/models/components/listresourcediscount.md b/docs/models/components/listresourcediscount.md index 31a9393b..82d6a4dd 100644 --- a/docs/models/components/listresourcediscount.md +++ b/docs/models/components/listresourcediscount.md @@ -8,29 +8,29 @@ import { ListResourceDiscount } from "@polar-sh/sdk/models/components"; let value: ListResourceDiscount = { items: [ { - duration: "forever", + duration: "repeating", type: "fixed", - basisPoints: 617530, - createdAt: new Date("2022-05-25T23:19:35.845Z"), - modifiedAt: new Date("2023-04-19T06:24:50.359Z"), + basisPoints: 794154, + createdAt: new Date("2024-04-06T00:08:29.443Z"), + modifiedAt: new Date("2025-10-15T22:27:51.866Z"), id: "", metadata: { "key": false, }, name: "", code: "", - startsAt: new Date("2022-05-27T16:26:09.723Z"), - endsAt: new Date("2022-08-17T19:12:36.222Z"), - maxRedemptions: 423019, - redemptionsCount: 60393, + startsAt: new Date("2023-06-11T07:02:23.326Z"), + endsAt: new Date("2023-02-05T14:12:40.672Z"), + maxRedemptions: 125622, + redemptionsCount: 712690, organizationId: "", products: [ { - createdAt: new Date("2022-11-10T18:13:12.189Z"), - modifiedAt: new Date("2022-03-26T21:44:52.578Z"), + createdAt: new Date("2023-01-12T13:17:30.759Z"), + modifiedAt: new Date("2024-06-08T04:16:09.888Z"), id: "", name: "", - description: "now after over round despite consequently", + description: "procrastinate under on ick lovingly paintwork versus", isRecurring: false, isArchived: false, organizationId: "", @@ -39,8 +39,8 @@ let value: ListResourceDiscount = { }, ], pagination: { - totalCount: 99113, - maxPage: 764666, + totalCount: 496921, + maxPage: 485972, }, }; ``` diff --git a/docs/models/components/listresourcedownloadableread.md b/docs/models/components/listresourcedownloadableread.md index 019005cb..179d9ddc 100644 --- a/docs/models/components/listresourcedownloadableread.md +++ b/docs/models/components/listresourcedownloadableread.md @@ -16,15 +16,15 @@ let value: ListResourceDownloadableRead = { name: "", path: "/usr/ports", mimeType: "", - size: 421550, + size: 322813, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-09-30T15:10:49.815Z"), + lastModifiedAt: new Date("2025-07-08T07:53:48.135Z"), download: { - url: "https://superb-apricot.info/", - expiresAt: new Date("2022-08-01T01:58:51.711Z"), + url: "https://plump-following.name/", + expiresAt: new Date("2023-07-30T08:59:41.027Z"), }, version: "", isUploaded: false, @@ -34,8 +34,8 @@ let value: ListResourceDownloadableRead = { }, ], pagination: { - totalCount: 785555, - maxPage: 14482, + totalCount: 836386, + maxPage: 797594, }, }; ``` diff --git a/docs/models/components/listresourceexternalorganization.md b/docs/models/components/listresourceexternalorganization.md index 11015f0d..af39dfdc 100644 --- a/docs/models/components/listresourceexternalorganization.md +++ b/docs/models/components/listresourceexternalorganization.md @@ -8,23 +8,24 @@ import { ListResourceExternalOrganization } from "@polar-sh/sdk/models/component let value: ListResourceExternalOrganization = { items: [ { - id: "a082d91a-eb1a-49ac-9453-76131825d98f", + id: "ce7a6e76-f05d-4759-a654-5ef1baa04b70", + platform: "github", name: "", - avatarUrl: "https://orderly-haircut.info", + avatarUrl: "https://unaware-tectonics.name", isPersonal: false, bio: "", prettyName: "", - company: "Mann, Fritsch and Leannon", + company: "Frami and Sons", blog: "", location: "", - email: "Dayna_Pollich@gmail.com", + email: "Salvador91@hotmail.com", twitterUsername: "", organizationId: "", }, ], pagination: { - totalCount: 793068, - maxPage: 16303, + totalCount: 528631, + maxPage: 642105, }, }; ``` diff --git a/docs/models/components/listresourcefileread.md b/docs/models/components/listresourcefileread.md index 02a6f6d6..e7381a3a 100644 --- a/docs/models/components/listresourcefileread.md +++ b/docs/models/components/listresourcefileread.md @@ -11,24 +11,24 @@ let value: ListResourceFileRead = { id: "", organizationId: "", name: "", - path: "/lib", + path: "/var/tmp", mimeType: "", - size: 448226, + size: 133813, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-07-02T19:45:41.035Z"), + lastModifiedAt: new Date("2024-08-04T16:05:30.256Z"), version: "", isUploaded: false, - createdAt: new Date("2022-10-02T13:18:18.281Z"), + createdAt: new Date("2023-12-08T15:35:06.694Z"), sizeReadable: "", - publicUrl: "https://better-bonnet.name", + publicUrl: "https://doting-translation.info", }, ], pagination: { - totalCount: 509797, - maxPage: 671505, + totalCount: 431771, + maxPage: 786325, }, }; ``` diff --git a/docs/models/components/listresourcelicensekeyread.md b/docs/models/components/listresourcelicensekeyread.md index cbd81c8f..81253573 100644 --- a/docs/models/components/listresourcelicensekeyread.md +++ b/docs/models/components/listresourcelicensekeyread.md @@ -14,43 +14,43 @@ let value: ListResourceLicenseKeyRead = { customerId: "", user: { id: "", - email: "Zoe83@gmail.com", + email: "Frederick.Cassin@hotmail.com", publicName: "", }, customer: { - createdAt: new Date("2024-12-26T16:52:12.542Z"), - modifiedAt: new Date("2023-08-29T06:32:45.499Z"), + createdAt: new Date("2023-04-11T23:24:18.548Z"), + modifiedAt: new Date("2023-06-02T19:37:32.666Z"), id: "", metadata: { "key": "", }, - email: "Myah_Goldner@yahoo.com", + email: "Dameon_Bergnaum40@gmail.com", emailVerified: false, name: "", billingAddress: { - country: "Montserrat", + country: "Wallis and Futuna", }, taxId: [ - "rs_pib", + "cr_tin", ], organizationId: "", - avatarUrl: "https://acceptable-volleyball.info", + avatarUrl: "https://gifted-nun.biz/", }, benefitId: "", key: "", displayKey: "", status: "revoked", - limitActivations: 367683, - usage: 844364, - limitUsage: 736793, - validations: 178911, - lastValidatedAt: new Date("2023-03-24T06:29:34.406Z"), - expiresAt: new Date("2022-01-03T23:43:26.209Z"), + limitActivations: 278278, + usage: 44454, + limitUsage: 413166, + validations: 356620, + lastValidatedAt: new Date("2023-09-27T11:53:41.126Z"), + expiresAt: new Date("2024-08-02T18:04:30.206Z"), }, ], pagination: { - totalCount: 803114, - maxPage: 236280, + totalCount: 389623, + maxPage: 949946, }, }; ``` diff --git a/docs/models/components/listresourceoauth2client.md b/docs/models/components/listresourceoauth2client.md index 3376e006..2c911fa7 100644 --- a/docs/models/components/listresourceoauth2client.md +++ b/docs/models/components/listresourceoauth2client.md @@ -9,20 +9,20 @@ let value: ListResourceOAuth2Client = { items: [ { redirectUris: [ - "https://minor-grandpa.name", + "https://sniveling-pepper.net/", ], clientName: "", - createdAt: new Date("2022-06-09T04:26:57.182Z"), - modifiedAt: new Date("2022-10-18T13:51:15.254Z"), + createdAt: new Date("2025-01-02T03:01:54.888Z"), + modifiedAt: new Date("2024-05-10T08:04:00.367Z"), clientId: "", clientSecret: "", - clientIdIssuedAt: 306682, - clientSecretExpiresAt: 515159, + clientIdIssuedAt: 277082, + clientSecretExpiresAt: 55600, }, ], pagination: { - totalCount: 695511, - maxPage: 287202, + totalCount: 307936, + maxPage: 46258, }, }; ``` diff --git a/docs/models/components/listresourceorder.md b/docs/models/components/listresourceorder.md index f40314bc..08ec6b6f 100644 --- a/docs/models/components/listresourceorder.md +++ b/docs/models/components/listresourceorder.md @@ -8,18 +8,18 @@ import { ListResourceOrder } from "@polar-sh/sdk/models/components"; let value: ListResourceOrder = { items: [ { - createdAt: new Date("2022-04-13T06:46:54.478Z"), - modifiedAt: new Date("2022-06-05T10:08:11.440Z"), + createdAt: new Date("2023-10-16T01:37:14.449Z"), + modifiedAt: new Date("2025-09-30T14:09:22.071Z"), id: "", metadata: { - "key": "", + "key": false, }, - amount: 843824, - taxAmount: 589943, - currency: "South Sudanese pound", - billingReason: "subscription_create", + amount: 686314, + taxAmount: 691711, + currency: "UAE Dirham", + billingReason: "subscription_update", billingAddress: { - country: "Nepal", + country: "Turkmenistan", }, customerId: "", productId: "", @@ -28,87 +28,83 @@ let value: ListResourceOrder = { subscriptionId: "", checkoutId: "", customer: { - createdAt: new Date("2024-09-12T04:51:54.984Z"), - modifiedAt: new Date("2023-08-09T05:09:54.823Z"), + createdAt: new Date("2023-01-22T06:14:40.431Z"), + modifiedAt: new Date("2024-10-17T17:31:30.443Z"), id: "", metadata: { "key": false, }, - email: "Vito.Ruecker@gmail.com", + email: "Rodrigo21@gmail.com", emailVerified: false, name: "", billingAddress: { - country: "French Polynesia", + country: "Kiribati", }, taxId: [ - "", + "bo_tin", ], organizationId: "", - avatarUrl: "https://writhing-outset.biz/", + avatarUrl: "https://downright-daughter.name", }, userId: "", user: { id: "", - email: "Duncan_Gislason@hotmail.com", + email: "Ima_Feil90@yahoo.com", publicName: "", }, product: { - createdAt: new Date("2023-05-18T22:46:14.781Z"), - modifiedAt: new Date("2022-09-24T03:44:56.785Z"), + createdAt: new Date("2025-04-27T14:10:19.519Z"), + modifiedAt: new Date("2023-02-01T17:24:49.733Z"), id: "", name: "", - description: - "incidentally interestingly gape notwithstanding onto fortunately per", + description: "fishery blah cooperative", isRecurring: false, isArchived: false, organizationId: "", }, productPrice: { - createdAt: new Date("2024-03-12T00:00:14.600Z"), - modifiedAt: new Date("2024-03-09T09:53:49.933Z"), + createdAt: new Date("2024-01-24T18:09:07.037Z"), + modifiedAt: new Date("2023-08-26T19:56:08.017Z"), id: "", isArchived: false, productId: "", - priceCurrency: "", - minimumAmount: 484977, - maximumAmount: 281476, - presetAmount: 206174, + recurringInterval: "year", }, discount: { - duration: "once", - durationInMonths: 337073, + duration: "forever", + durationInMonths: 388338, type: "percentage", - basisPoints: 600069, - createdAt: new Date("2023-04-20T19:22:55.409Z"), - modifiedAt: new Date("2022-04-25T05:44:28.693Z"), + basisPoints: 15557, + createdAt: new Date("2023-06-08T14:30:43.169Z"), + modifiedAt: new Date("2024-02-09T02:39:53.057Z"), id: "", metadata: { - "key": "", + "key": false, }, name: "", code: "", - startsAt: new Date("2024-02-03T09:20:15.518Z"), - endsAt: new Date("2023-06-15T03:09:20.689Z"), - maxRedemptions: 339551, - redemptionsCount: 374793, + startsAt: new Date("2023-11-30T12:43:32.164Z"), + endsAt: new Date("2023-03-05T10:15:44.066Z"), + maxRedemptions: 378735, + redemptionsCount: 241254, organizationId: "", }, subscription: { metadata: { - "key": 683057, + "key": "", }, - createdAt: new Date("2023-10-21T15:19:50.360Z"), - modifiedAt: new Date("2022-03-19T05:59:03.453Z"), + createdAt: new Date("2024-03-13T05:18:13.214Z"), + modifiedAt: new Date("2024-01-21T03:47:17.857Z"), id: "", - amount: 157478, - currency: "Convertible Marks", + amount: 733840, + currency: "Azerbaijanian Manat", recurringInterval: "month", - status: "canceled", - currentPeriodStart: new Date("2024-07-21T15:37:23.186Z"), - currentPeriodEnd: new Date("2023-04-02T03:08:30.116Z"), + status: "trialing", + currentPeriodStart: new Date("2024-12-09T21:59:36.211Z"), + currentPeriodEnd: new Date("2025-08-31T03:52:04.662Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2024-11-27T20:23:16.786Z"), - endedAt: new Date("2024-08-04T12:04:26.255Z"), + startedAt: new Date("2023-06-06T17:12:12.382Z"), + endedAt: new Date("2025-06-13T14:44:19.237Z"), customerId: "", productId: "", priceId: "", @@ -119,8 +115,8 @@ let value: ListResourceOrder = { }, ], pagination: { - totalCount: 860385, - maxPage: 367184, + totalCount: 609724, + maxPage: 29242, }, }; ``` diff --git a/docs/models/components/listresourceorganization.md b/docs/models/components/listresourceorganization.md index 23943008..ff208fa1 100644 --- a/docs/models/components/listresourceorganization.md +++ b/docs/models/components/listresourceorganization.md @@ -8,28 +8,28 @@ import { ListResourceOrganization } from "@polar-sh/sdk/models/components"; let value: ListResourceOrganization = { items: [ { - createdAt: new Date("2023-05-07T10:50:37.185Z"), - modifiedAt: new Date("2024-07-27T08:56:13.386Z"), + createdAt: new Date("2023-11-24T07:53:06.544Z"), + modifiedAt: new Date("2023-01-08T04:54:12.583Z"), id: "", name: "", slug: "", - avatarUrl: "https://plump-statue.net/", + avatarUrl: "https://any-council.com/", bio: "", - company: "Bechtelar - Gorczany", + company: "Frami - Schmeler", blog: "", location: "", - email: "Alena_Lebsack37@gmail.com", + email: "Winfield_Stroman77@gmail.com", twitterUsername: "", - pledgeMinimumAmount: 569306, + pledgeMinimumAmount: 257324, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 752367, + defaultUpfrontSplitToContributors: 664425, profileSettings: {}, featureSettings: {}, }, ], pagination: { - totalCount: 694952, - maxPage: 856985, + totalCount: 563154, + maxPage: 505663, }, }; ``` diff --git a/docs/models/components/listresourceproduct.md b/docs/models/components/listresourceproduct.md index b1e4246c..a86e6a16 100644 --- a/docs/models/components/listresourceproduct.md +++ b/docs/models/components/listresourceproduct.md @@ -8,42 +8,50 @@ import { ListResourceProduct } from "@polar-sh/sdk/models/components"; let value: ListResourceProduct = { items: [ { - createdAt: new Date("2022-09-28T13:02:06.335Z"), - modifiedAt: new Date("2023-06-03T00:43:09.210Z"), + createdAt: new Date("2024-12-06T19:21:30.268Z"), + modifiedAt: new Date("2024-09-19T16:28:52.728Z"), id: "", name: "", - description: - "boo oxygenate forenenst uproot rewarding brr even hmph joyfully and", + description: "of editor ack including angrily venom", isRecurring: false, isArchived: false, organizationId: "", metadata: { - "key": 201417, + "key": "", }, prices: [ { - createdAt: new Date("2023-06-05T04:51:45.961Z"), - modifiedAt: new Date("2023-02-27T02:39:42.244Z"), + createdAt: new Date("2024-10-13T16:24:24.825Z"), + modifiedAt: new Date("2025-10-12T17:44:21.842Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - priceAmount: 845385, + priceAmount: 238015, + recurringInterval: "month", }, ], benefits: [ { - createdAt: new Date("2023-06-05T13:12:25.088Z"), - modifiedAt: new Date("2023-10-16T10:17:17.179Z"), + createdAt: new Date("2025-02-15T06:40:47.027Z"), + modifiedAt: new Date("2024-08-02T00:03:08.625Z"), id: "", - description: "a overstay shinny before", + description: + "behold pace blank waft tabletop jealously liberalize monthly", selectable: false, deletable: false, organizationId: "", properties: { - repositoryOwner: "polarsource", - repositoryName: "private_repo", - permission: "pull", + prefix: "", + expires: { + ttl: 711557, + timeframe: "month", + }, + activations: { + limit: 459197, + enableCustomerAdmin: false, + }, + limitUsage: 940490, }, }, ], @@ -52,45 +60,52 @@ let value: ListResourceProduct = { id: "", organizationId: "", name: "", - path: "/proc", + path: "/opt", mimeType: "", - size: 299592, + size: 172985, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-12-15T00:04:42.925Z"), + lastModifiedAt: new Date("2024-06-01T09:57:43.473Z"), version: "", isUploaded: false, - createdAt: new Date("2022-02-13T16:01:02.803Z"), + createdAt: new Date("2024-12-16T05:46:11.787Z"), sizeReadable: "", - publicUrl: "https://slight-governance.name/", + publicUrl: "https://clumsy-event.org/", }, ], attachedCustomFields: [ { customFieldId: "", customField: { - createdAt: new Date("2024-01-01T21:10:10.994Z"), - modifiedAt: new Date("2023-10-24T11:48:21.731Z"), + createdAt: new Date("2023-09-01T05:45:21.778Z"), + modifiedAt: new Date("2024-10-23T10:08:12.461Z"), id: "", metadata: { - "key": false, + "key": 523055, }, slug: "", name: "", organizationId: "", - properties: {}, + properties: { + options: [ + { + value: "", + label: "", + }, + ], + }, }, - order: 64244, + order: 759383, required: false, }, ], }, ], pagination: { - totalCount: 97799, - maxPage: 607549, + totalCount: 24739, + maxPage: 191117, }, }; ``` diff --git a/docs/models/components/listresourcerepository.md b/docs/models/components/listresourcerepository.md index fc929260..cb32e627 100644 --- a/docs/models/components/listresourcerepository.md +++ b/docs/models/components/listresourcerepository.md @@ -8,53 +8,54 @@ import { ListResourceRepository } from "@polar-sh/sdk/models/components"; let value: ListResourceRepository = { items: [ { - id: "e0d89f24-379b-406e-97d1-4b97ace7a6e7", + id: "e790f725-823e-4d14-8a40-b354222fbf95", + platform: "github", isPrivate: false, name: "MyOrg", - description: - "hollow receptor aboard hence who which incidentally fully behind midwife", + description: "noisily thorn peter behind huzzah now", stars: 1337, license: "", homepage: "", profileSettings: {}, organization: { - id: "5277c83d-2805-4a28-98e7-124c491391b7", + id: "9c8bd450-8fbf-47b2-96a7-05a67d49dc30", + platform: "github", name: "", - avatarUrl: "https://red-barracks.net", + avatarUrl: "https://amazing-exasperation.name/", isPersonal: false, bio: "", prettyName: "", - company: "Waelchi - Cremin", + company: "Hodkiewicz Group", blog: "", location: "", - email: "Deanna_Hane@yahoo.com", + email: "Nia.Stiedemann@yahoo.com", twitterUsername: "", organizationId: "", }, internalOrganization: { - createdAt: new Date("2023-10-30T06:49:47.105Z"), - modifiedAt: new Date("2024-04-24T16:23:33.210Z"), + createdAt: new Date("2023-12-19T10:54:29.736Z"), + modifiedAt: new Date("2025-01-22T07:37:03.476Z"), id: "", name: "", slug: "", - avatarUrl: "https://salty-stranger.biz", + avatarUrl: "https://strange-analogy.info/", bio: "", - company: "Barrows LLC", + company: "Kassulke LLC", blog: "", location: "", - email: "Myah.Kling-Rogahn@hotmail.com", + email: "Sandra.Green1@gmail.com", twitterUsername: "", - pledgeMinimumAmount: 450312, + pledgeMinimumAmount: 851884, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 29722, + defaultUpfrontSplitToContributors: 775815, profileSettings: {}, featureSettings: {}, }, }, ], pagination: { - totalCount: 316842, - maxPage: 676068, + totalCount: 737994, + maxPage: 689296, }, }; ``` diff --git a/docs/models/components/listresourcesubscription.md b/docs/models/components/listresourcesubscription.md index 437e2a1b..aa0e6105 100644 --- a/docs/models/components/listresourcesubscription.md +++ b/docs/models/components/listresourcesubscription.md @@ -8,89 +8,91 @@ import { ListResourceSubscription } from "@polar-sh/sdk/models/components"; let value: ListResourceSubscription = { items: [ { - createdAt: new Date("2023-07-06T07:10:14.256Z"), - modifiedAt: new Date("2023-06-20T07:51:26.885Z"), + createdAt: new Date("2023-09-10T18:58:43.516Z"), + modifiedAt: new Date("2024-08-25T11:58:09.669Z"), id: "", - amount: 321582, - currency: "Zloty", - recurringInterval: "month", - status: "canceled", - currentPeriodStart: new Date("2022-02-10T03:13:50.725Z"), - currentPeriodEnd: new Date("2023-03-02T10:40:57.891Z"), + amount: 409918, + currency: "Yemeni Rial", + recurringInterval: "year", + status: "active", + currentPeriodStart: new Date("2025-11-07T20:33:08.048Z"), + currentPeriodEnd: new Date("2023-04-11T09:48:38.635Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2023-10-28T14:57:15.731Z"), - endedAt: new Date("2023-04-11T02:28:22.606Z"), + startedAt: new Date("2023-10-25T20:57:12.614Z"), + endedAt: new Date("2024-01-15T15:33:33.250Z"), customerId: "", productId: "", priceId: "", discountId: "", checkoutId: "", metadata: { - "key": 38800, + "key": false, }, customer: { - createdAt: new Date("2024-08-08T09:47:23.975Z"), - modifiedAt: new Date("2022-03-27T02:41:35.039Z"), + createdAt: new Date("2025-04-19T23:42:02.974Z"), + modifiedAt: new Date("2023-11-30T23:12:05.956Z"), id: "", metadata: { - "key": "", + "key": false, }, - email: "Adolf73@gmail.com", + email: "Jeremie.Hahn@gmail.com", emailVerified: false, name: "", billingAddress: { - country: "Bangladesh", + country: "French Southern Territories", }, taxId: [ "", ], organizationId: "", - avatarUrl: "https://basic-angle.biz/", + avatarUrl: "https://aged-swanling.com/", }, userId: "", user: { id: "", - email: "Agustin.Schmeler@gmail.com", + email: "Malika_Hammes47@gmail.com", publicName: "", }, product: { - createdAt: new Date("2024-08-08T00:51:23.196Z"), - modifiedAt: new Date("2023-12-26T03:04:40.757Z"), + createdAt: new Date("2024-03-23T13:34:49.566Z"), + modifiedAt: new Date("2023-02-02T17:07:23.419Z"), id: "", name: "", description: - "defendant brown across farmer reluctantly allegation indeed near whoever", + "er over aha probable steep telescope woot shallow ready likely", isRecurring: false, isArchived: false, organizationId: "", metadata: { - "key": 971752, + "key": 507819, }, prices: [ { - createdAt: new Date("2023-08-04T08:43:53.329Z"), - modifiedAt: new Date("2023-12-03T11:45:28.906Z"), + createdAt: new Date("2025-06-09T18:38:23.027Z"), + modifiedAt: new Date("2025-08-25T15:21:53.101Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - priceAmount: 666273, + minimumAmount: 666762, + maximumAmount: 288130, + presetAmount: 873245, + recurringInterval: "month", }, ], benefits: [ { - createdAt: new Date("2022-07-27T19:36:21.058Z"), - modifiedAt: new Date("2022-08-17T07:24:06.006Z"), + createdAt: new Date("2023-05-28T12:26:51.418Z"), + modifiedAt: new Date("2025-11-19T23:44:15.502Z"), id: "", - description: "hold till yellowish character", + description: "versus mmm however", selectable: false, deletable: false, organizationId: "", properties: { - repositoryOwner: "polarsource", - repositoryName: "private_repo", - permission: "triage", + note: "", }, + isTaxApplicable: false, }, ], medias: [ @@ -98,73 +100,78 @@ let value: ListResourceSubscription = { id: "", organizationId: "", name: "", - path: "/tmp", + path: "/usr/lib", mimeType: "", - size: 479139, + size: 621230, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-01-14T06:12:45.829Z"), + lastModifiedAt: new Date("2025-06-16T04:21:10.746Z"), version: "", isUploaded: false, - createdAt: new Date("2024-12-29T02:23:28.417Z"), + createdAt: new Date("2025-03-27T07:52:32.211Z"), sizeReadable: "", - publicUrl: "https://smart-skeleton.biz/", + publicUrl: "https://official-hundred.info/", }, ], attachedCustomFields: [ { customFieldId: "", customField: { - createdAt: new Date("2023-04-29T17:28:15.276Z"), - modifiedAt: new Date("2023-03-08T16:00:29.346Z"), + createdAt: new Date("2024-12-21T00:45:52.216Z"), + modifiedAt: new Date("2023-10-03T04:08:49.934Z"), id: "", metadata: { - "key": 211584, + "key": 95232, }, slug: "", name: "", organizationId: "", properties: {}, }, - order: 493800, + order: 745274, required: false, }, ], }, price: { - createdAt: new Date("2024-08-25T15:21:53.101Z"), - modifiedAt: new Date("2024-01-01T18:30:52.387Z"), + createdAt: new Date("2023-07-05T02:18:29.661Z"), + modifiedAt: new Date("2023-06-28T00:20:02.984Z"), id: "", isArchived: false, productId: "", + priceCurrency: "", + minimumAmount: 15228, + maximumAmount: 777881, + presetAmount: 728700, recurringInterval: "month", }, discount: { duration: "forever", - durationInMonths: 231807, + durationInMonths: 884089, type: "fixed", - basisPoints: 961669, - createdAt: new Date("2022-04-07T10:12:13.244Z"), - modifiedAt: new Date("2023-08-04T14:49:09.371Z"), + amount: 29564, + currency: "Czech Koruna", + createdAt: new Date("2024-07-24T16:06:53.635Z"), + modifiedAt: new Date("2023-01-09T10:05:29.328Z"), id: "", metadata: { "key": "", }, name: "", code: "", - startsAt: new Date("2024-08-09T15:14:51.080Z"), - endsAt: new Date("2022-08-02T04:49:48.526Z"), - maxRedemptions: 736480, - redemptionsCount: 165116, + startsAt: new Date("2025-02-03T20:36:51.045Z"), + endsAt: new Date("2024-05-06T01:50:43.417Z"), + maxRedemptions: 948639, + redemptionsCount: 910767, organizationId: "", }, }, ], pagination: { - totalCount: 938113, - maxPage: 663325, + totalCount: 276458, + maxPage: 377716, }, }; ``` diff --git a/docs/models/components/metric.md b/docs/models/components/metric.md index a4ee8790..9605887b 100644 --- a/docs/models/components/metric.md +++ b/docs/models/components/metric.md @@ -9,8 +9,8 @@ import { Metric } from "@polar-sh/sdk/models/components"; let value: Metric = { slug: "", - displayName: "Maryse.Grady21", - type: "currency", + displayName: "Carlos_Tremblay", + type: "scalar", }; ``` diff --git a/docs/models/components/metricperiod.md b/docs/models/components/metricperiod.md index 0b5d6da9..c4d02e82 100644 --- a/docs/models/components/metricperiod.md +++ b/docs/models/components/metricperiod.md @@ -6,18 +6,18 @@ import { MetricPeriod } from "@polar-sh/sdk/models/components"; let value: MetricPeriod = { - timestamp: new Date("2023-02-18T22:11:11.854Z"), - orders: 485638, - revenue: 261294, - averageOrderValue: 360333, - oneTimeProducts: 590966, - oneTimeProductsRevenue: 224524, - newSubscriptions: 461968, - newSubscriptionsRevenue: 574923, - renewedSubscriptions: 138094, - renewedSubscriptionsRevenue: 306970, - activeSubscriptions: 552212, - monthlyRecurringRevenue: 401260, + timestamp: new Date("2024-04-15T04:46:35.940Z"), + orders: 670168, + revenue: 424591, + averageOrderValue: 708007, + oneTimeProducts: 613225, + oneTimeProductsRevenue: 441603, + newSubscriptions: 549022, + newSubscriptionsRevenue: 598149, + renewedSubscriptions: 879059, + renewedSubscriptionsRevenue: 676871, + activeSubscriptions: 713755, + monthlyRecurringRevenue: 969927, }; ``` diff --git a/docs/models/components/metrics.md b/docs/models/components/metrics.md index 0787d45f..27ae2298 100644 --- a/docs/models/components/metrics.md +++ b/docs/models/components/metrics.md @@ -8,58 +8,58 @@ import { Metrics } from "@polar-sh/sdk/models/components"; let value: Metrics = { orders: { slug: "", - displayName: "Allan_Torphy90", + displayName: "Diamond83", type: "currency", }, revenue: { slug: "", - displayName: "Jaclyn72", + displayName: "Katrine_Leannon47", type: "currency", }, averageOrderValue: { slug: "", - displayName: "Chelsea99", + displayName: "Ricardo78", type: "scalar", }, oneTimeProducts: { slug: "", - displayName: "Tressie46", + displayName: "Waylon84", type: "scalar", }, oneTimeProductsRevenue: { slug: "", - displayName: "Keshaun_Hoppe48", - type: "currency", + displayName: "Hailey.Schmitt", + type: "scalar", }, newSubscriptions: { slug: "", - displayName: "Susanna.Wiegand", + displayName: "Katharina10", type: "scalar", }, newSubscriptionsRevenue: { slug: "", - displayName: "Nathan18", + displayName: "Amelie34", type: "scalar", }, renewedSubscriptions: { slug: "", - displayName: "Josianne2", - type: "scalar", + displayName: "Gilda24", + type: "currency", }, renewedSubscriptionsRevenue: { slug: "", - displayName: "Shane.Bartell52", - type: "currency", + displayName: "Brandy.Corkery", + type: "scalar", }, activeSubscriptions: { slug: "", - displayName: "Amya.Simonis78", - type: "currency", + displayName: "Malika.Fay57", + type: "scalar", }, monthlyRecurringRevenue: { slug: "", - displayName: "Otto.Jacobson39", - type: "scalar", + displayName: "Ahmad66", + type: "currency", }, }; ``` diff --git a/docs/models/components/metricsintervallimit.md b/docs/models/components/metricsintervallimit.md index 74426c35..557a3bd7 100644 --- a/docs/models/components/metricsintervallimit.md +++ b/docs/models/components/metricsintervallimit.md @@ -8,7 +8,7 @@ Date interval limit to get metrics for a given interval. import { MetricsIntervalLimit } from "@polar-sh/sdk/models/components"; let value: MetricsIntervalLimit = { - maxDays: 129904, + maxDays: 303546, }; ``` diff --git a/docs/models/components/metricsintervalslimits.md b/docs/models/components/metricsintervalslimits.md index d103c7e8..91e312d7 100644 --- a/docs/models/components/metricsintervalslimits.md +++ b/docs/models/components/metricsintervalslimits.md @@ -9,19 +9,19 @@ import { MetricsIntervalsLimits } from "@polar-sh/sdk/models/components"; let value: MetricsIntervalsLimits = { hour: { - maxDays: 479840, + maxDays: 270667, }, day: { - maxDays: 635909, + maxDays: 276109, }, week: { - maxDays: 541834, + maxDays: 708466, }, month: { - maxDays: 823250, + maxDays: 108829, }, year: { - maxDays: 186640, + maxDays: 756985, }, }; ``` diff --git a/docs/models/components/metricslimits.md b/docs/models/components/metricslimits.md index 786e601f..60afbc5c 100644 --- a/docs/models/components/metricslimits.md +++ b/docs/models/components/metricslimits.md @@ -9,22 +9,22 @@ import { MetricsLimits } from "@polar-sh/sdk/models/components"; import { RFCDate } from "@polar-sh/sdk/types"; let value: MetricsLimits = { - minDate: new RFCDate("2022-09-11"), + minDate: new RFCDate("2023-07-25"), intervals: { hour: { - maxDays: 470724, + maxDays: 318122, }, day: { - maxDays: 821046, + maxDays: 946068, }, week: { - maxDays: 142769, + maxDays: 228555, }, month: { - maxDays: 894928, + maxDays: 565095, }, year: { - maxDays: 447246, + maxDays: 117761, }, }, }; diff --git a/docs/models/components/metricsresponse.md b/docs/models/components/metricsresponse.md index 48071b83..c9d787c2 100644 --- a/docs/models/components/metricsresponse.md +++ b/docs/models/components/metricsresponse.md @@ -10,75 +10,75 @@ import { MetricsResponse } from "@polar-sh/sdk/models/components"; let value: MetricsResponse = { periods: [ { - timestamp: new Date("2023-10-30T23:05:13.740Z"), - orders: 765419, - revenue: 581098, - averageOrderValue: 386441, - oneTimeProducts: 681458, - oneTimeProductsRevenue: 240101, - newSubscriptions: 349551, - newSubscriptionsRevenue: 71631, - renewedSubscriptions: 816230, - renewedSubscriptionsRevenue: 70999, - activeSubscriptions: 298797, - monthlyRecurringRevenue: 925633, + timestamp: new Date("2025-10-24T11:05:44.448Z"), + orders: 875166, + revenue: 706234, + averageOrderValue: 936960, + oneTimeProducts: 462267, + oneTimeProductsRevenue: 713256, + newSubscriptions: 4087, + newSubscriptionsRevenue: 568581, + renewedSubscriptions: 723689, + renewedSubscriptionsRevenue: 383012, + activeSubscriptions: 867919, + monthlyRecurringRevenue: 485068, }, ], metrics: { orders: { slug: "", - displayName: "Keenan_Zemlak6", + displayName: "Easter_Ullrich", type: "currency", }, revenue: { slug: "", - displayName: "Cloyd53", + displayName: "Lloyd.Rodriguez57", type: "scalar", }, averageOrderValue: { slug: "", - displayName: "Justine.Moore", + displayName: "Wilhelm49", type: "scalar", }, oneTimeProducts: { slug: "", - displayName: "Palma_Kunde14", + displayName: "Mariane.Thiel3", type: "currency", }, oneTimeProductsRevenue: { slug: "", - displayName: "Tiffany_Collier9", + displayName: "Cristopher.Bednar83", type: "currency", }, newSubscriptions: { slug: "", - displayName: "Dana.Mosciski99", - type: "currency", + displayName: "Bert.Sawayn", + type: "scalar", }, newSubscriptionsRevenue: { slug: "", - displayName: "Sebastian.Zieme", + displayName: "Cortney.Pollich28", type: "scalar", }, renewedSubscriptions: { slug: "", - displayName: "Jarod25", - type: "currency", + displayName: "Alice.Jakubowski48", + type: "scalar", }, renewedSubscriptionsRevenue: { slug: "", - displayName: "Caroline_Morar78", - type: "scalar", + displayName: "Landen_Koepp13", + type: "currency", }, activeSubscriptions: { slug: "", - displayName: "Kim.Braun", + displayName: "Greta.Feeney82", type: "currency", }, monthlyRecurringRevenue: { slug: "", - displayName: "Reagan_Haley13", - type: "currency", + displayName: "Isadore_Nicolas82", + type: "scalar", }, }, }; diff --git a/docs/models/components/metrictype.md b/docs/models/components/metrictype.md index 7c6c9526..c26679e1 100644 --- a/docs/models/components/metrictype.md +++ b/docs/models/components/metrictype.md @@ -5,7 +5,7 @@ ```typescript import { MetricType } from "@polar-sh/sdk/models/components"; -let value: MetricType = "scalar"; +let value: MetricType = "currency"; ``` ## Values diff --git a/docs/models/components/oauth2client.md b/docs/models/components/oauth2client.md index 05055ab4..55a931c4 100644 --- a/docs/models/components/oauth2client.md +++ b/docs/models/components/oauth2client.md @@ -7,15 +7,15 @@ import { OAuth2Client } from "@polar-sh/sdk/models/components"; let value: OAuth2Client = { redirectUris: [ - "https://infinite-interchange.biz", + "https://electric-birdcage.org", ], clientName: "", - createdAt: new Date("2024-06-05T11:34:22.007Z"), - modifiedAt: new Date("2022-05-13T05:58:14.604Z"), + createdAt: new Date("2023-03-07T19:06:15.685Z"), + modifiedAt: new Date("2025-04-03T01:12:40.733Z"), clientId: "", clientSecret: "", - clientIdIssuedAt: 171088, - clientSecretExpiresAt: 999957, + clientIdIssuedAt: 929426, + clientSecretExpiresAt: 107129, }; ``` @@ -26,7 +26,7 @@ let value: OAuth2Client = { | `redirectUris` | *string*[] | :heavy_check_mark: | N/A | | `tokenEndpointAuthMethod` | [components.TokenEndpointAuthMethod](../../models/components/tokenendpointauthmethod.md) | :heavy_minus_sign: | N/A | | `grantTypes` | [components.GrantTypes](../../models/components/granttypes.md)[] | :heavy_minus_sign: | N/A | -| `responseTypes` | [components.ResponseTypes](../../models/components/responsetypes.md)[] | :heavy_minus_sign: | N/A | +| `responseTypes` | *string*[] | :heavy_minus_sign: | N/A | | `scope` | *string* | :heavy_minus_sign: | N/A | | `clientName` | *string* | :heavy_check_mark: | N/A | | `clientUri` | *string* | :heavy_minus_sign: | N/A | diff --git a/docs/models/components/oauth2clientconfiguration.md b/docs/models/components/oauth2clientconfiguration.md index 5a1098d9..e291f5b7 100644 --- a/docs/models/components/oauth2clientconfiguration.md +++ b/docs/models/components/oauth2clientconfiguration.md @@ -7,7 +7,7 @@ import { OAuth2ClientConfiguration } from "@polar-sh/sdk/models/components"; let value: OAuth2ClientConfiguration = { redirectUris: [ - "https://yummy-cope.net", + "https://posh-duster.com", ], clientName: "", }; @@ -20,7 +20,7 @@ let value: OAuth2ClientConfiguration = { | `redirectUris` | *string*[] | :heavy_check_mark: | N/A | | `tokenEndpointAuthMethod` | [components.OAuth2ClientConfigurationTokenEndpointAuthMethod](../../models/components/oauth2clientconfigurationtokenendpointauthmethod.md) | :heavy_minus_sign: | N/A | | `grantTypes` | [components.OAuth2ClientConfigurationGrantTypes](../../models/components/oauth2clientconfigurationgranttypes.md)[] | :heavy_minus_sign: | N/A | -| `responseTypes` | [components.OAuth2ClientConfigurationResponseTypes](../../models/components/oauth2clientconfigurationresponsetypes.md)[] | :heavy_minus_sign: | N/A | +| `responseTypes` | *string*[] | :heavy_minus_sign: | N/A | | `scope` | *string* | :heavy_minus_sign: | N/A | | `clientName` | *string* | :heavy_check_mark: | N/A | | `clientUri` | *string* | :heavy_minus_sign: | N/A | diff --git a/docs/models/components/oauth2clientconfigurationgranttypes.md b/docs/models/components/oauth2clientconfigurationgranttypes.md index e56dc464..8a13b57a 100644 --- a/docs/models/components/oauth2clientconfigurationgranttypes.md +++ b/docs/models/components/oauth2clientconfigurationgranttypes.md @@ -5,7 +5,7 @@ ```typescript import { OAuth2ClientConfigurationGrantTypes } from "@polar-sh/sdk/models/components"; -let value: OAuth2ClientConfigurationGrantTypes = "refresh_token"; +let value: OAuth2ClientConfigurationGrantTypes = "authorization_code"; ``` ## Values diff --git a/docs/models/components/oauth2clientconfigurationresponsetypes.md b/docs/models/components/oauth2clientconfigurationresponsetypes.md deleted file mode 100644 index 821ddce2..00000000 --- a/docs/models/components/oauth2clientconfigurationresponsetypes.md +++ /dev/null @@ -1,15 +0,0 @@ -# OAuth2ClientConfigurationResponseTypes - -## Example Usage - -```typescript -import { OAuth2ClientConfigurationResponseTypes } from "@polar-sh/sdk/models/components"; - -let value: OAuth2ClientConfigurationResponseTypes = "code"; -``` - -## Values - -```typescript -"code" -``` \ No newline at end of file diff --git a/docs/models/components/oauth2clientconfigurationtokenendpointauthmethod.md b/docs/models/components/oauth2clientconfigurationtokenendpointauthmethod.md index f8bd2241..58d6aa86 100644 --- a/docs/models/components/oauth2clientconfigurationtokenendpointauthmethod.md +++ b/docs/models/components/oauth2clientconfigurationtokenendpointauthmethod.md @@ -5,7 +5,8 @@ ```typescript import { OAuth2ClientConfigurationTokenEndpointAuthMethod } from "@polar-sh/sdk/models/components"; -let value: OAuth2ClientConfigurationTokenEndpointAuthMethod = "none"; +let value: OAuth2ClientConfigurationTokenEndpointAuthMethod = + "client_secret_post"; ``` ## Values diff --git a/docs/models/components/oauth2clientconfigurationupdate.md b/docs/models/components/oauth2clientconfigurationupdate.md index de2b8695..e2371861 100644 --- a/docs/models/components/oauth2clientconfigurationupdate.md +++ b/docs/models/components/oauth2clientconfigurationupdate.md @@ -7,7 +7,7 @@ import { OAuth2ClientConfigurationUpdate } from "@polar-sh/sdk/models/components let value: OAuth2ClientConfigurationUpdate = { redirectUris: [ - "https://zealous-cannon.com", + "https://colorful-strategy.com", ], clientName: "", clientId: "", @@ -21,7 +21,7 @@ let value: OAuth2ClientConfigurationUpdate = { | `redirectUris` | *string*[] | :heavy_check_mark: | N/A | | `tokenEndpointAuthMethod` | [components.OAuth2ClientConfigurationUpdateTokenEndpointAuthMethod](../../models/components/oauth2clientconfigurationupdatetokenendpointauthmethod.md) | :heavy_minus_sign: | N/A | | `grantTypes` | [components.OAuth2ClientConfigurationUpdateGrantTypes](../../models/components/oauth2clientconfigurationupdategranttypes.md)[] | :heavy_minus_sign: | N/A | -| `responseTypes` | [components.OAuth2ClientConfigurationUpdateResponseTypes](../../models/components/oauth2clientconfigurationupdateresponsetypes.md)[] | :heavy_minus_sign: | N/A | +| `responseTypes` | *string*[] | :heavy_minus_sign: | N/A | | `scope` | *string* | :heavy_minus_sign: | N/A | | `clientName` | *string* | :heavy_check_mark: | N/A | | `clientUri` | *string* | :heavy_minus_sign: | N/A | diff --git a/docs/models/components/oauth2clientconfigurationupdateresponsetypes.md b/docs/models/components/oauth2clientconfigurationupdateresponsetypes.md deleted file mode 100644 index aad8e255..00000000 --- a/docs/models/components/oauth2clientconfigurationupdateresponsetypes.md +++ /dev/null @@ -1,15 +0,0 @@ -# OAuth2ClientConfigurationUpdateResponseTypes - -## Example Usage - -```typescript -import { OAuth2ClientConfigurationUpdateResponseTypes } from "@polar-sh/sdk/models/components"; - -let value: OAuth2ClientConfigurationUpdateResponseTypes = "code"; -``` - -## Values - -```typescript -"code" -``` \ No newline at end of file diff --git a/docs/models/components/oauth2clientpublic.md b/docs/models/components/oauth2clientpublic.md index d9222343..5e5835a1 100644 --- a/docs/models/components/oauth2clientpublic.md +++ b/docs/models/components/oauth2clientpublic.md @@ -6,14 +6,14 @@ import { OAuth2ClientPublic } from "@polar-sh/sdk/models/components"; let value: OAuth2ClientPublic = { - createdAt: new Date("2022-03-17T04:26:37.100Z"), - modifiedAt: new Date("2023-01-22T08:53:03.092Z"), + createdAt: new Date("2025-05-03T03:06:38.832Z"), + modifiedAt: new Date("2024-06-27T17:40:06.266Z"), clientId: "", clientName: "", - clientUri: "https://snappy-cannon.com/", - logoUri: "https://formal-status.net/", - tosUri: "https://formal-farmer.name", - policyUri: "https://idealistic-language.org", + clientUri: "https://immense-premium.net", + logoUri: "https://terrible-moment.name", + tosUri: "https://victorious-league.info/", + policyUri: "https://courteous-doing.biz", }; ``` diff --git a/docs/models/components/onev11oauth21tokenpostxcomponentsauthorizationcodetokenrequest.md b/docs/models/components/onev11oauth21tokenpostxcomponentsauthorizationcodetokenrequest.md index 14c13b6f..7d7660af 100644 --- a/docs/models/components/onev11oauth21tokenpostxcomponentsauthorizationcodetokenrequest.md +++ b/docs/models/components/onev11oauth21tokenpostxcomponentsauthorizationcodetokenrequest.md @@ -9,16 +9,16 @@ let value: Onev11oauth21tokenPostXComponentsAuthorizationCodeTokenRequest = { clientId: "", clientSecret: "", code: "", - redirectUri: "https://severe-gray.net/", + redirectUri: "https://portly-tarragon.com/", }; ``` ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------ | ------------------------------------------------------------ | ------------------------------------------------------------ | ------------------------------------------------------------ | -| `grantType` | [components.GrantType](../../models/components/granttype.md) | :heavy_check_mark: | N/A | -| `clientId` | *string* | :heavy_check_mark: | N/A | -| `clientSecret` | *string* | :heavy_check_mark: | N/A | -| `code` | *string* | :heavy_check_mark: | N/A | -| `redirectUri` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------ | ------------------ | ------------------ | ------------------ | +| `grantType` | *string* | :heavy_check_mark: | N/A | +| `clientId` | *string* | :heavy_check_mark: | N/A | +| `clientSecret` | *string* | :heavy_check_mark: | N/A | +| `code` | *string* | :heavy_check_mark: | N/A | +| `redirectUri` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequest.md b/docs/models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequest.md index 5ad05b8b..2b6c19cc 100644 --- a/docs/models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequest.md +++ b/docs/models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequest.md @@ -14,9 +14,9 @@ let value: Onev11oauth21tokenPostXComponentsRefreshTokenRequest = { ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------------------------------------------------- | -| `grantType` | [components.Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType](../../models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequestgranttype.md) | :heavy_check_mark: | N/A | -| `clientId` | *string* | :heavy_check_mark: | N/A | -| `clientSecret` | *string* | :heavy_check_mark: | N/A | -| `refreshToken` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------ | ------------------ | ------------------ | ------------------ | +| `grantType` | *string* | :heavy_check_mark: | N/A | +| `clientId` | *string* | :heavy_check_mark: | N/A | +| `clientSecret` | *string* | :heavy_check_mark: | N/A | +| `refreshToken` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequestgranttype.md b/docs/models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequestgranttype.md deleted file mode 100644 index 66b8f371..00000000 --- a/docs/models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequestgranttype.md +++ /dev/null @@ -1,16 +0,0 @@ -# Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType - -## Example Usage - -```typescript -import { Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType } from "@polar-sh/sdk/models/components"; - -let value: Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType = - "refresh_token"; -``` - -## Values - -```typescript -"refresh_token" -``` \ No newline at end of file diff --git a/docs/models/components/order.md b/docs/models/components/order.md index c8a7309a..dc6000f0 100644 --- a/docs/models/components/order.md +++ b/docs/models/components/order.md @@ -6,8 +6,8 @@ import { Order } from "@polar-sh/sdk/models/components"; let value: Order = { - createdAt: new Date("2022-09-07T04:32:30.698Z"), - modifiedAt: new Date("2022-03-17T11:04:55.466Z"), + createdAt: new Date("2023-09-07T04:32:30.698Z"), + modifiedAt: new Date("2023-03-17T11:04:55.466Z"), id: "", metadata: { "key": false, @@ -26,8 +26,8 @@ let value: Order = { subscriptionId: "", checkoutId: "", customer: { - createdAt: new Date("2024-06-12T11:00:17.620Z"), - modifiedAt: new Date("2022-08-27T13:24:12.363Z"), + createdAt: new Date("2025-06-12T11:00:17.620Z"), + modifiedAt: new Date("2023-08-27T13:24:12.363Z"), id: "", metadata: { "key": false, @@ -51,8 +51,8 @@ let value: Order = { publicName: "", }, product: { - createdAt: new Date("2024-10-26T07:41:18.790Z"), - modifiedAt: new Date("2023-07-09T22:02:12.267Z"), + createdAt: new Date("2025-10-26T07:41:18.790Z"), + modifiedAt: new Date("2024-07-08T22:02:12.267Z"), id: "", name: "", description: @@ -62,8 +62,8 @@ let value: Order = { organizationId: "", }, productPrice: { - createdAt: new Date("2024-07-24T03:46:55.765Z"), - modifiedAt: new Date("2023-06-05T22:56:35.057Z"), + createdAt: new Date("2025-07-24T03:46:55.765Z"), + modifiedAt: new Date("2024-06-04T22:56:35.057Z"), id: "", isArchived: false, productId: "", @@ -79,16 +79,16 @@ let value: Order = { type: "fixed", amount: 791228, currency: "Russian Ruble", - createdAt: new Date("2023-09-04T14:58:47.025Z"), - modifiedAt: new Date("2024-02-12T14:57:13.755Z"), + createdAt: new Date("2024-09-03T14:58:47.025Z"), + modifiedAt: new Date("2025-02-11T14:57:13.755Z"), id: "", metadata: { "key": 5310, }, name: "", code: "", - startsAt: new Date("2022-01-13T10:41:07.081Z"), - endsAt: new Date("2023-07-15T07:10:40.441Z"), + startsAt: new Date("2023-01-13T10:41:07.081Z"), + endsAt: new Date("2024-07-14T07:10:40.441Z"), maxRedemptions: 83291, redemptionsCount: 51075, organizationId: "", @@ -97,18 +97,18 @@ let value: Order = { metadata: { "key": false, }, - createdAt: new Date("2024-07-30T11:12:19.561Z"), - modifiedAt: new Date("2022-06-16T14:55:27.064Z"), + createdAt: new Date("2025-07-30T11:12:19.561Z"), + modifiedAt: new Date("2023-06-16T14:55:27.064Z"), id: "", amount: 664, currency: "East Caribbean Dollar", recurringInterval: "month", status: "incomplete_expired", - currentPeriodStart: new Date("2024-01-28T21:25:45.366Z"), - currentPeriodEnd: new Date("2022-04-30T08:36:14.207Z"), + currentPeriodStart: new Date("2025-01-27T21:25:45.366Z"), + currentPeriodEnd: new Date("2023-04-30T08:36:14.207Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2022-10-18T01:20:34.893Z"), - endedAt: new Date("2024-12-04T16:53:25.686Z"), + startedAt: new Date("2023-10-18T01:20:34.893Z"), + endedAt: new Date("2025-12-04T16:53:25.686Z"), customerId: "", productId: "", priceId: "", diff --git a/docs/models/components/ordercustomer.md b/docs/models/components/ordercustomer.md index 28c07a50..8fa6e8b4 100644 --- a/docs/models/components/ordercustomer.md +++ b/docs/models/components/ordercustomer.md @@ -6,8 +6,8 @@ import { OrderCustomer } from "@polar-sh/sdk/models/components"; let value: OrderCustomer = { - createdAt: new Date("2024-02-04T06:34:29.704Z"), - modifiedAt: new Date("2023-03-03T22:41:02.174Z"), + createdAt: new Date("2025-02-03T06:34:29.704Z"), + modifiedAt: new Date("2024-03-02T22:41:02.174Z"), id: "", metadata: { "key": "", diff --git a/docs/models/components/orderdiscount.md b/docs/models/components/orderdiscount.md index 5e96648d..ecc80d72 100644 --- a/docs/models/components/orderdiscount.md +++ b/docs/models/components/orderdiscount.md @@ -11,16 +11,16 @@ const value: components.DiscountFixedOnceForeverDurationBase = { type: "percentage", amount: 627735, currency: "Iranian Rial", - createdAt: new Date("2023-04-02T16:39:35.905Z"), - modifiedAt: new Date("2024-06-07T16:17:56.157Z"), + createdAt: new Date("2024-04-01T16:39:35.905Z"), + modifiedAt: new Date("2025-06-07T16:17:56.157Z"), id: "", metadata: { "key": 211455, }, name: "", code: "", - startsAt: new Date("2022-03-07T02:00:55.358Z"), - endsAt: new Date("2024-08-18T03:00:36.748Z"), + startsAt: new Date("2023-03-07T02:00:55.358Z"), + endsAt: new Date("2025-08-18T03:00:36.748Z"), maxRedemptions: 918547, redemptionsCount: 120120, organizationId: "", @@ -36,16 +36,16 @@ const value: components.DiscountFixedRepeatDurationBase = { type: "fixed", amount: 899867, currency: "Aruban Guilder", - createdAt: new Date("2024-12-10T14:41:41.611Z"), - modifiedAt: new Date("2022-04-16T17:02:36.383Z"), + createdAt: new Date("2025-12-10T14:41:41.611Z"), + modifiedAt: new Date("2023-04-16T17:02:36.383Z"), id: "", metadata: { "key": false, }, name: "", code: "", - startsAt: new Date("2023-09-13T21:22:35.898Z"), - endsAt: new Date("2023-02-08T05:42:05.758Z"), + startsAt: new Date("2024-09-12T21:22:35.898Z"), + endsAt: new Date("2024-02-08T05:42:05.758Z"), maxRedemptions: 342342, redemptionsCount: 757364, organizationId: "", @@ -59,16 +59,16 @@ const value: components.DiscountPercentageOnceForeverDurationBase = { duration: "once", type: "percentage", basisPoints: 517326, - createdAt: new Date("2023-06-16T12:32:10.789Z"), - modifiedAt: new Date("2024-09-14T16:10:11.053Z"), + createdAt: new Date("2024-06-15T12:32:10.789Z"), + modifiedAt: new Date("2025-09-14T16:10:11.053Z"), id: "", metadata: { "key": 826862, }, name: "", code: "", - startsAt: new Date("2024-03-06T05:29:10.468Z"), - endsAt: new Date("2022-02-12T06:12:35.281Z"), + startsAt: new Date("2025-03-06T05:29:10.468Z"), + endsAt: new Date("2023-02-12T06:12:35.281Z"), maxRedemptions: 773110, redemptionsCount: 216870, organizationId: "", @@ -83,16 +83,16 @@ const value: components.DiscountPercentageRepeatDurationBase = { durationInMonths: 42924, type: "fixed", basisPoints: 99733, - createdAt: new Date("2023-06-06T05:53:46.089Z"), - modifiedAt: new Date("2024-06-17T17:52:12.552Z"), + createdAt: new Date("2024-06-05T05:53:46.089Z"), + modifiedAt: new Date("2025-06-17T17:52:12.552Z"), id: "", metadata: { "key": "", }, name: "", code: "", - startsAt: new Date("2022-06-15T10:11:29.540Z"), - endsAt: new Date("2022-12-28T23:20:38.785Z"), + startsAt: new Date("2023-06-15T10:11:29.540Z"), + endsAt: new Date("2023-12-28T23:20:38.785Z"), maxRedemptions: 813880, redemptionsCount: 140384, organizationId: "", diff --git a/docs/models/components/orderinvoice.md b/docs/models/components/orderinvoice.md index db16c9a6..13b45037 100644 --- a/docs/models/components/orderinvoice.md +++ b/docs/models/components/orderinvoice.md @@ -8,7 +8,7 @@ Order's invoice data. import { OrderInvoice } from "@polar-sh/sdk/models/components"; let value: OrderInvoice = { - url: "https://unhealthy-accelerator.name/", + url: "https://inborn-pick.biz", }; ``` diff --git a/docs/models/components/orderproduct.md b/docs/models/components/orderproduct.md index 21886069..a227b4fe 100644 --- a/docs/models/components/orderproduct.md +++ b/docs/models/components/orderproduct.md @@ -6,8 +6,8 @@ import { OrderProduct } from "@polar-sh/sdk/models/components"; let value: OrderProduct = { - createdAt: new Date("2022-08-31T10:55:17.874Z"), - modifiedAt: new Date("2024-01-20T08:44:25.689Z"), + createdAt: new Date("2023-08-31T10:55:17.874Z"), + modifiedAt: new Date("2025-01-19T08:44:25.689Z"), id: "", name: "", description: "bah before yuck", diff --git a/docs/models/components/ordersortproperty.md b/docs/models/components/ordersortproperty.md index 9c795c9e..10d29fca 100644 --- a/docs/models/components/ordersortproperty.md +++ b/docs/models/components/ordersortproperty.md @@ -5,7 +5,7 @@ ```typescript import { OrderSortProperty } from "@polar-sh/sdk/models/components"; -let value: OrderSortProperty = "-subscription"; +let value: OrderSortProperty = "-discount"; ``` ## Values diff --git a/docs/models/components/ordersubscription.md b/docs/models/components/ordersubscription.md index 1b268baa..82ece590 100644 --- a/docs/models/components/ordersubscription.md +++ b/docs/models/components/ordersubscription.md @@ -9,18 +9,18 @@ let value: OrderSubscription = { metadata: { "key": 397919, }, - createdAt: new Date("2024-04-28T20:28:23.222Z"), - modifiedAt: new Date("2022-06-04T11:44:43.665Z"), + createdAt: new Date("2025-04-28T20:28:23.222Z"), + modifiedAt: new Date("2023-06-04T11:44:43.665Z"), id: "", amount: 967338, currency: "Trinidad and Tobago Dollar", recurringInterval: "year", status: "incomplete", - currentPeriodStart: new Date("2024-02-08T03:18:25.211Z"), - currentPeriodEnd: new Date("2024-09-27T23:01:52.690Z"), + currentPeriodStart: new Date("2025-02-07T03:18:25.211Z"), + currentPeriodEnd: new Date("2025-09-27T23:01:52.690Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2023-07-29T22:28:30.659Z"), - endedAt: new Date("2023-01-24T05:31:46.968Z"), + startedAt: new Date("2024-07-28T22:28:30.659Z"), + endedAt: new Date("2024-01-24T05:31:46.968Z"), customerId: "", productId: "", priceId: "", diff --git a/docs/models/components/organization.md b/docs/models/components/organization.md index 64de91c2..b862d4d9 100644 --- a/docs/models/components/organization.md +++ b/docs/models/components/organization.md @@ -6,8 +6,8 @@ import { Organization } from "@polar-sh/sdk/models/components"; let value: Organization = { - createdAt: new Date("2022-04-04T03:54:32.981Z"), - modifiedAt: new Date("2022-12-19T23:19:10.766Z"), + createdAt: new Date("2023-04-04T03:54:32.981Z"), + modifiedAt: new Date("2023-12-19T23:19:10.766Z"), id: "", name: "", slug: "", diff --git a/docs/models/components/organizationavatarfilecreate.md b/docs/models/components/organizationavatarfilecreate.md index 6dde769f..88112169 100644 --- a/docs/models/components/organizationavatarfilecreate.md +++ b/docs/models/components/organizationavatarfilecreate.md @@ -10,13 +10,13 @@ import { OrganizationAvatarFileCreate } from "@polar-sh/sdk/models/components"; let value: OrganizationAvatarFileCreate = { name: "", mimeType: "", - size: 80904, + size: 179420, upload: { parts: [ { - number: 656811, - chunkStart: 673487, - chunkEnd: 973823, + number: 795413, + chunkStart: 659824, + chunkEnd: 726468, }, ], }, @@ -25,13 +25,13 @@ let value: OrganizationAvatarFileCreate = { ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------- | -| `organizationId` | *string* | :heavy_minus_sign: | N/A | -| `name` | *string* | :heavy_check_mark: | N/A | -| `mimeType` | *string* | :heavy_check_mark: | MIME type of the file. Only images are supported for this type of file. | -| `size` | *number* | :heavy_check_mark: | Size of the file. A maximum of 1 MB is allowed for this type of file. | -| `checksumSha256Base64` | *string* | :heavy_minus_sign: | N/A | -| `upload` | [components.S3FileCreateMultipart](../../models/components/s3filecreatemultipart.md) | :heavy_check_mark: | N/A | -| `service` | [components.OrganizationAvatarFileCreateService](../../models/components/organizationavatarfilecreateservice.md) | :heavy_check_mark: | N/A | -| `version` | *string* | :heavy_minus_sign: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------ | +| `organizationId` | *string* | :heavy_minus_sign: | N/A | +| `name` | *string* | :heavy_check_mark: | N/A | +| `mimeType` | *string* | :heavy_check_mark: | MIME type of the file. Only images are supported for this type of file. | +| `size` | *number* | :heavy_check_mark: | Size of the file. A maximum of 1 MB is allowed for this type of file. | +| `checksumSha256Base64` | *string* | :heavy_minus_sign: | N/A | +| `upload` | [components.S3FileCreateMultipart](../../models/components/s3filecreatemultipart.md) | :heavy_check_mark: | N/A | +| `service` | *string* | :heavy_check_mark: | N/A | +| `version` | *string* | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/organizationavatarfilecreateservice.md b/docs/models/components/organizationavatarfilecreateservice.md deleted file mode 100644 index 168deb0c..00000000 --- a/docs/models/components/organizationavatarfilecreateservice.md +++ /dev/null @@ -1,15 +0,0 @@ -# OrganizationAvatarFileCreateService - -## Example Usage - -```typescript -import { OrganizationAvatarFileCreateService } from "@polar-sh/sdk/models/components"; - -let value: OrganizationAvatarFileCreateService = "organization_avatar"; -``` - -## Values - -```typescript -"organization_avatar" -``` \ No newline at end of file diff --git a/docs/models/components/organizationavatarfileread.md b/docs/models/components/organizationavatarfileread.md index 6fd3bac5..1bfc9565 100644 --- a/docs/models/components/organizationavatarfileread.md +++ b/docs/models/components/organizationavatarfileread.md @@ -11,40 +11,40 @@ let value: OrganizationAvatarFileRead = { id: "", organizationId: "", name: "", - path: "/mnt", + path: "/Library", mimeType: "", - size: 819777, + size: 692991, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-05-22T11:38:34.003Z"), + lastModifiedAt: new Date("2025-10-12T17:09:21.424Z"), version: "", isUploaded: false, - createdAt: new Date("2024-03-27T12:14:29.936Z"), + createdAt: new Date("2023-05-09T11:03:31.723Z"), sizeReadable: "", - publicUrl: "https://well-made-airbus.com", + publicUrl: "https://witty-bookend.com/", }; ``` ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------ | -| `id` | *string* | :heavy_check_mark: | The ID of the object. | -| `organizationId` | *string* | :heavy_check_mark: | N/A | -| `name` | *string* | :heavy_check_mark: | N/A | -| `path` | *string* | :heavy_check_mark: | N/A | -| `mimeType` | *string* | :heavy_check_mark: | N/A | -| `size` | *number* | :heavy_check_mark: | N/A | -| `storageVersion` | *string* | :heavy_check_mark: | N/A | -| `checksumEtag` | *string* | :heavy_check_mark: | N/A | -| `checksumSha256Base64` | *string* | :heavy_check_mark: | N/A | -| `checksumSha256Hex` | *string* | :heavy_check_mark: | N/A | -| `lastModifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | N/A | -| `version` | *string* | :heavy_check_mark: | N/A | -| `service` | [components.OrganizationAvatarFileReadService](../../models/components/organizationavatarfilereadservice.md) | :heavy_check_mark: | N/A | -| `isUploaded` | *boolean* | :heavy_check_mark: | N/A | -| `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | N/A | -| `sizeReadable` | *string* | :heavy_check_mark: | N/A | -| `publicUrl` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | +| `id` | *string* | :heavy_check_mark: | The ID of the object. | +| `organizationId` | *string* | :heavy_check_mark: | N/A | +| `name` | *string* | :heavy_check_mark: | N/A | +| `path` | *string* | :heavy_check_mark: | N/A | +| `mimeType` | *string* | :heavy_check_mark: | N/A | +| `size` | *number* | :heavy_check_mark: | N/A | +| `storageVersion` | *string* | :heavy_check_mark: | N/A | +| `checksumEtag` | *string* | :heavy_check_mark: | N/A | +| `checksumSha256Base64` | *string* | :heavy_check_mark: | N/A | +| `checksumSha256Hex` | *string* | :heavy_check_mark: | N/A | +| `lastModifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | N/A | +| `version` | *string* | :heavy_check_mark: | N/A | +| `service` | *string* | :heavy_check_mark: | N/A | +| `isUploaded` | *boolean* | :heavy_check_mark: | N/A | +| `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | N/A | +| `sizeReadable` | *string* | :heavy_check_mark: | N/A | +| `publicUrl` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/organizationavatarfilereadservice.md b/docs/models/components/organizationavatarfilereadservice.md deleted file mode 100644 index d365e684..00000000 --- a/docs/models/components/organizationavatarfilereadservice.md +++ /dev/null @@ -1,15 +0,0 @@ -# OrganizationAvatarFileReadService - -## Example Usage - -```typescript -import { OrganizationAvatarFileReadService } from "@polar-sh/sdk/models/components"; - -let value: OrganizationAvatarFileReadService = "organization_avatar"; -``` - -## Values - -```typescript -"organization_avatar" -``` \ No newline at end of file diff --git a/docs/models/components/organizationsortproperty.md b/docs/models/components/organizationsortproperty.md index 1f65f48a..528678cc 100644 --- a/docs/models/components/organizationsortproperty.md +++ b/docs/models/components/organizationsortproperty.md @@ -5,7 +5,7 @@ ```typescript import { OrganizationSortProperty } from "@polar-sh/sdk/models/components"; -let value: OrganizationSortProperty = "-created_at"; +let value: OrganizationSortProperty = "created_at"; ``` ## Values diff --git a/docs/models/components/pagination.md b/docs/models/components/pagination.md index b2291c74..318db0e8 100644 --- a/docs/models/components/pagination.md +++ b/docs/models/components/pagination.md @@ -6,8 +6,8 @@ import { Pagination } from "@polar-sh/sdk/models/components"; let value: Pagination = { - totalCount: 332831, - maxPage: 307594, + totalCount: 112081, + maxPage: 275288, }; ``` diff --git a/docs/models/components/pledge.md b/docs/models/components/pledge.md index c9e76586..18d9376b 100644 --- a/docs/models/components/pledge.md +++ b/docs/models/components/pledge.md @@ -6,8 +6,8 @@ import { Pledge } from "@polar-sh/sdk/models/components"; let value: Pledge = { - createdAt: new Date("2022-09-05T01:19:12.734Z"), - modifiedAt: new Date("2022-12-19T07:07:14.338Z"), + createdAt: new Date("2023-09-05T01:19:12.734Z"), + modifiedAt: new Date("2023-12-19T07:07:14.338Z"), id: "", amount: 2770, currency: "Swedish Krona", @@ -15,14 +15,16 @@ let value: Pledge = { type: "pay_on_completion", issue: { id: "0d204e48-64ec-4c8d-b777-3e433dc60f2d", + platform: "github", number: 938076, title: "", state: "closed", - issueCreatedAt: new Date("2022-12-30T04:23:53.970Z"), + issueCreatedAt: new Date("2023-12-30T04:23:53.970Z"), needsConfirmationSolved: false, funding: {}, repository: { id: "363bda20-9735-48a7-bf0a-e33c7f9e02a6", + platform: "github", isPrivate: false, name: "MyOrg", description: "overconfidently energetically sharply swiftly exalted gee", @@ -32,6 +34,7 @@ let value: Pledge = { profileSettings: {}, organization: { id: "5dc92be4-fc49-441d-8a92-6e2034ca009a", + platform: "github", name: "", avatarUrl: "https://exalted-fishery.info", isPersonal: false, @@ -45,8 +48,8 @@ let value: Pledge = { organizationId: "", }, internalOrganization: { - createdAt: new Date("2023-07-24T11:55:05.448Z"), - modifiedAt: new Date("2023-12-25T23:57:09.287Z"), + createdAt: new Date("2024-07-23T11:55:05.448Z"), + modifiedAt: new Date("2024-12-24T23:57:09.287Z"), id: "", name: "", slug: "", diff --git a/docs/models/components/prices.md b/docs/models/components/prices.md index 372b1a33..50594b9f 100644 --- a/docs/models/components/prices.md +++ b/docs/models/components/prices.md @@ -7,7 +7,7 @@ ```typescript const value: components.ProductPriceOneTimeFixedCreate = { - priceAmount: 448659, + priceAmount: 839958, }; ``` diff --git a/docs/models/components/product.md b/docs/models/components/product.md index fa739fb3..97dfa9ee 100644 --- a/docs/models/components/product.md +++ b/docs/models/components/product.md @@ -8,8 +8,8 @@ A product. import { Product } from "@polar-sh/sdk/models/components"; let value: Product = { - createdAt: new Date("2022-12-27T12:47:58.923Z"), - modifiedAt: new Date("2022-01-22T13:58:08.292Z"), + createdAt: new Date("2023-12-27T12:47:58.923Z"), + modifiedAt: new Date("2023-01-22T13:58:08.292Z"), id: "", name: "", description: "self-reliant yowza nor", @@ -21,8 +21,8 @@ let value: Product = { }, prices: [ { - createdAt: new Date("2024-10-04T09:52:26.411Z"), - modifiedAt: new Date("2023-03-28T03:25:20.607Z"), + createdAt: new Date("2025-10-04T09:52:26.411Z"), + modifiedAt: new Date("2024-03-27T03:25:20.607Z"), id: "", isArchived: false, productId: "", @@ -32,8 +32,8 @@ let value: Product = { ], benefits: [ { - createdAt: new Date("2024-12-21T18:06:07.641Z"), - modifiedAt: new Date("2022-08-06T23:39:39.226Z"), + createdAt: new Date("2025-12-21T18:06:07.641Z"), + modifiedAt: new Date("2023-08-06T23:39:39.226Z"), id: "", description: "despite energetically quixotic efface kissingly tensely gah supposing", @@ -66,10 +66,10 @@ let value: Product = { checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-07-02T12:43:21.651Z"), + lastModifiedAt: new Date("2023-07-02T12:43:21.651Z"), version: "", isUploaded: false, - createdAt: new Date("2024-07-21T21:55:28.560Z"), + createdAt: new Date("2025-07-21T21:55:28.560Z"), sizeReadable: "", publicUrl: "https://fluffy-gift.org", }, @@ -78,8 +78,8 @@ let value: Product = { { customFieldId: "", customField: { - createdAt: new Date("2023-11-05T07:45:54.269Z"), - modifiedAt: new Date("2022-08-31T18:04:39.587Z"), + createdAt: new Date("2024-11-04T07:45:54.269Z"), + modifiedAt: new Date("2023-08-31T18:04:39.587Z"), id: "", metadata: { "key": "", diff --git a/docs/models/components/productcreate.md b/docs/models/components/productcreate.md index 7d013e6c..c403a652 100644 --- a/docs/models/components/productcreate.md +++ b/docs/models/components/productcreate.md @@ -10,7 +10,8 @@ const value: components.ProductRecurringCreate = { name: "", prices: [ { - recurringInterval: "year", + priceAmount: 76514, + recurringInterval: "month", }, ], }; @@ -22,7 +23,9 @@ const value: components.ProductRecurringCreate = { const value: components.ProductOneTimeCreate = { name: "", prices: [ - {}, + { + priceAmount: 579414, + }, ], }; ``` diff --git a/docs/models/components/productmediafilecreate.md b/docs/models/components/productmediafilecreate.md index b4f82f8c..3716cace 100644 --- a/docs/models/components/productmediafilecreate.md +++ b/docs/models/components/productmediafilecreate.md @@ -10,13 +10,13 @@ import { ProductMediaFileCreate } from "@polar-sh/sdk/models/components"; let value: ProductMediaFileCreate = { name: "", mimeType: "", - size: 960693, + size: 808175, upload: { parts: [ { - number: 115886, - chunkStart: 989474, - chunkEnd: 200301, + number: 721978, + chunkStart: 996551, + chunkEnd: 992118, }, ], }, @@ -25,13 +25,13 @@ let value: ProductMediaFileCreate = { ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | -| `organizationId` | *string* | :heavy_minus_sign: | N/A | -| `name` | *string* | :heavy_check_mark: | N/A | -| `mimeType` | *string* | :heavy_check_mark: | MIME type of the file. Only images are supported for this type of file. | -| `size` | *number* | :heavy_check_mark: | Size of the file. A maximum of 10 MB is allowed for this type of file. | -| `checksumSha256Base64` | *string* | :heavy_minus_sign: | N/A | -| `upload` | [components.S3FileCreateMultipart](../../models/components/s3filecreatemultipart.md) | :heavy_check_mark: | N/A | -| `service` | [components.ProductMediaFileCreateService](../../models/components/productmediafilecreateservice.md) | :heavy_check_mark: | N/A | -| `version` | *string* | :heavy_minus_sign: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------ | +| `organizationId` | *string* | :heavy_minus_sign: | N/A | +| `name` | *string* | :heavy_check_mark: | N/A | +| `mimeType` | *string* | :heavy_check_mark: | MIME type of the file. Only images are supported for this type of file. | +| `size` | *number* | :heavy_check_mark: | Size of the file. A maximum of 10 MB is allowed for this type of file. | +| `checksumSha256Base64` | *string* | :heavy_minus_sign: | N/A | +| `upload` | [components.S3FileCreateMultipart](../../models/components/s3filecreatemultipart.md) | :heavy_check_mark: | N/A | +| `service` | *string* | :heavy_check_mark: | N/A | +| `version` | *string* | :heavy_minus_sign: | N/A | \ No newline at end of file diff --git a/docs/models/components/productmediafilecreateservice.md b/docs/models/components/productmediafilecreateservice.md deleted file mode 100644 index a36dd95d..00000000 --- a/docs/models/components/productmediafilecreateservice.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductMediaFileCreateService - -## Example Usage - -```typescript -import { ProductMediaFileCreateService } from "@polar-sh/sdk/models/components"; - -let value: ProductMediaFileCreateService = "product_media"; -``` - -## Values - -```typescript -"product_media" -``` \ No newline at end of file diff --git a/docs/models/components/productmediafileread.md b/docs/models/components/productmediafileread.md index 793f0f1c..e8d2f464 100644 --- a/docs/models/components/productmediafileread.md +++ b/docs/models/components/productmediafileread.md @@ -18,10 +18,10 @@ let value: ProductMediaFileRead = { checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-03-01T15:52:51.579Z"), + lastModifiedAt: new Date("2025-03-01T15:52:51.579Z"), version: "", isUploaded: false, - createdAt: new Date("2023-11-30T18:58:30.709Z"), + createdAt: new Date("2024-11-29T18:58:30.709Z"), sizeReadable: "", publicUrl: "https://wobbly-tackle.net", }; @@ -43,7 +43,7 @@ let value: ProductMediaFileRead = { | `checksumSha256Hex` | *string* | :heavy_check_mark: | N/A | | `lastModifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | N/A | | `version` | *string* | :heavy_check_mark: | N/A | -| `service` | [components.Service](../../models/components/service.md) | :heavy_check_mark: | N/A | +| `service` | *string* | :heavy_check_mark: | N/A | | `isUploaded` | *boolean* | :heavy_check_mark: | N/A | | `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | N/A | | `sizeReadable` | *string* | :heavy_check_mark: | N/A | diff --git a/docs/models/components/productonetimecreatemetadata.md b/docs/models/components/productonetimecreatemetadata.md index c9ccb757..c7de2b21 100644 --- a/docs/models/components/productonetimecreatemetadata.md +++ b/docs/models/components/productonetimecreatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 685537; +const value: number = 621179; ``` ### `boolean` diff --git a/docs/models/components/productprice.md b/docs/models/components/productprice.md index fe8d1bd8..9efeba02 100644 --- a/docs/models/components/productprice.md +++ b/docs/models/components/productprice.md @@ -7,8 +7,8 @@ ```typescript const value: components.ProductPriceRecurring = { - createdAt: new Date("2022-09-22T14:16:31.377Z"), - modifiedAt: new Date("2023-12-28T02:31:12.899Z"), + createdAt: new Date("2023-09-22T14:16:31.377Z"), + modifiedAt: new Date("2024-12-27T02:31:12.899Z"), id: "", isArchived: false, productId: "", @@ -22,8 +22,8 @@ const value: components.ProductPriceRecurring = { ```typescript const value: components.ProductPriceOneTime = { - createdAt: new Date("2023-04-10T19:14:12.306Z"), - modifiedAt: new Date("2023-08-31T22:30:29.229Z"), + createdAt: new Date("2024-04-09T19:14:12.306Z"), + modifiedAt: new Date("2024-08-30T22:30:29.229Z"), id: "", isArchived: false, productId: "", diff --git a/docs/models/components/productpriceonetime.md b/docs/models/components/productpriceonetime.md index 43f9d175..637050c3 100644 --- a/docs/models/components/productpriceonetime.md +++ b/docs/models/components/productpriceonetime.md @@ -7,8 +7,8 @@ ```typescript const value: components.ProductPriceOneTimeFixed = { - createdAt: new Date("2022-11-30T16:44:13.155Z"), - modifiedAt: new Date("2024-07-08T18:01:50.419Z"), + createdAt: new Date("2023-11-30T16:44:13.155Z"), + modifiedAt: new Date("2025-07-08T18:01:50.419Z"), id: "", isArchived: false, productId: "", @@ -21,8 +21,8 @@ const value: components.ProductPriceOneTimeFixed = { ```typescript const value: components.ProductPriceOneTimeCustom = { - createdAt: new Date("2023-07-05T14:51:08.243Z"), - modifiedAt: new Date("2024-10-30T01:43:08.424Z"), + createdAt: new Date("2024-07-04T14:51:08.243Z"), + modifiedAt: new Date("2025-10-30T01:43:08.424Z"), id: "", isArchived: false, productId: "", @@ -37,8 +37,8 @@ const value: components.ProductPriceOneTimeCustom = { ```typescript const value: components.ProductPriceOneTimeFree = { - createdAt: new Date("2024-04-02T20:07:08.138Z"), - modifiedAt: new Date("2024-02-06T17:37:20.583Z"), + createdAt: new Date("2025-04-02T20:07:08.138Z"), + modifiedAt: new Date("2025-02-05T17:37:20.583Z"), id: "", isArchived: false, productId: "", diff --git a/docs/models/components/productpriceonetimecustom.md b/docs/models/components/productpriceonetimecustom.md index 5359b662..134d30b8 100644 --- a/docs/models/components/productpriceonetimecustom.md +++ b/docs/models/components/productpriceonetimecustom.md @@ -8,8 +8,8 @@ A pay-what-you-want price for a one-time product. import { ProductPriceOneTimeCustom } from "@polar-sh/sdk/models/components"; let value: ProductPriceOneTimeCustom = { - createdAt: new Date("2022-03-19T16:09:31.123Z"), - modifiedAt: new Date("2022-11-17T21:39:15.131Z"), + createdAt: new Date("2023-03-19T16:09:31.123Z"), + modifiedAt: new Date("2023-11-17T21:39:15.131Z"), id: "", isArchived: false, productId: "", @@ -22,16 +22,16 @@ let value: ProductPriceOneTimeCustom = { ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------- | -| `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | -| `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | -| `id` | *string* | :heavy_check_mark: | The ID of the price. | -| `amountType` | [components.ProductPriceOneTimeCustomAmountType](../../models/components/productpriceonetimecustomamounttype.md) | :heavy_check_mark: | N/A | -| `isArchived` | *boolean* | :heavy_check_mark: | Whether the price is archived and no longer available. | -| `productId` | *string* | :heavy_check_mark: | The ID of the product owning the price. | -| `priceCurrency` | *string* | :heavy_check_mark: | The currency. | -| `minimumAmount` | *number* | :heavy_check_mark: | The minimum amount the customer can pay. | -| `maximumAmount` | *number* | :heavy_check_mark: | The maximum amount the customer can pay. | -| `presetAmount` | *number* | :heavy_check_mark: | The initial amount shown to the customer. | -| `type` | [components.ProductPriceOneTimeCustomType](../../models/components/productpriceonetimecustomtype.md) | :heavy_check_mark: | The type of the price. | \ No newline at end of file +| Field | Type | Required | Description | +| --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | +| `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | +| `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | +| `id` | *string* | :heavy_check_mark: | The ID of the price. | +| `amountType` | *string* | :heavy_check_mark: | N/A | +| `isArchived` | *boolean* | :heavy_check_mark: | Whether the price is archived and no longer available. | +| `productId` | *string* | :heavy_check_mark: | The ID of the product owning the price. | +| `priceCurrency` | *string* | :heavy_check_mark: | The currency. | +| `minimumAmount` | *number* | :heavy_check_mark: | The minimum amount the customer can pay. | +| `maximumAmount` | *number* | :heavy_check_mark: | The maximum amount the customer can pay. | +| `presetAmount` | *number* | :heavy_check_mark: | The initial amount shown to the customer. | +| `type` | *string* | :heavy_check_mark: | The type of the price. | \ No newline at end of file diff --git a/docs/models/components/productpriceonetimecustomamounttype.md b/docs/models/components/productpriceonetimecustomamounttype.md deleted file mode 100644 index 350bb1f4..00000000 --- a/docs/models/components/productpriceonetimecustomamounttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceOneTimeCustomAmountType - -## Example Usage - -```typescript -import { ProductPriceOneTimeCustomAmountType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceOneTimeCustomAmountType = "custom"; -``` - -## Values - -```typescript -"custom" -``` \ No newline at end of file diff --git a/docs/models/components/productpriceonetimecustomcreate.md b/docs/models/components/productpriceonetimecustomcreate.md index bd25ac64..9d8341be 100644 --- a/docs/models/components/productpriceonetimecustomcreate.md +++ b/docs/models/components/productpriceonetimecustomcreate.md @@ -12,11 +12,11 @@ let value: ProductPriceOneTimeCustomCreate = {}; ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------- | -| `type` | [components.ProductPriceOneTimeCustomCreateType](../../models/components/productpriceonetimecustomcreatetype.md) | :heavy_check_mark: | N/A | -| `amountType` | [components.ProductPriceOneTimeCustomCreateAmountType](../../models/components/productpriceonetimecustomcreateamounttype.md) | :heavy_check_mark: | N/A | -| `priceCurrency` | *string* | :heavy_minus_sign: | The currency. Currently, only `usd` is supported. | -| `minimumAmount` | *number* | :heavy_minus_sign: | The minimum amount the customer can pay. | -| `maximumAmount` | *number* | :heavy_minus_sign: | The maximum amount the customer can pay. | -| `presetAmount` | *number* | :heavy_minus_sign: | The initial amount shown to the customer. | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------- | ------------------------------------------------- | ------------------------------------------------- | ------------------------------------------------- | +| `type` | *string* | :heavy_check_mark: | N/A | +| `amountType` | *string* | :heavy_check_mark: | N/A | +| `priceCurrency` | *string* | :heavy_minus_sign: | The currency. Currently, only `usd` is supported. | +| `minimumAmount` | *number* | :heavy_minus_sign: | The minimum amount the customer can pay. | +| `maximumAmount` | *number* | :heavy_minus_sign: | The maximum amount the customer can pay. | +| `presetAmount` | *number* | :heavy_minus_sign: | The initial amount shown to the customer. | \ No newline at end of file diff --git a/docs/models/components/productpriceonetimecustomcreateamounttype.md b/docs/models/components/productpriceonetimecustomcreateamounttype.md deleted file mode 100644 index a1c6f51c..00000000 --- a/docs/models/components/productpriceonetimecustomcreateamounttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceOneTimeCustomCreateAmountType - -## Example Usage - -```typescript -import { ProductPriceOneTimeCustomCreateAmountType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceOneTimeCustomCreateAmountType = "custom"; -``` - -## Values - -```typescript -"custom" -``` \ No newline at end of file diff --git a/docs/models/components/productpriceonetimecustomcreatetype.md b/docs/models/components/productpriceonetimecustomcreatetype.md deleted file mode 100644 index b98297dc..00000000 --- a/docs/models/components/productpriceonetimecustomcreatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceOneTimeCustomCreateType - -## Example Usage - -```typescript -import { ProductPriceOneTimeCustomCreateType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceOneTimeCustomCreateType = "one_time"; -``` - -## Values - -```typescript -"one_time" -``` \ No newline at end of file diff --git a/docs/models/components/productpriceonetimecustomtype.md b/docs/models/components/productpriceonetimecustomtype.md deleted file mode 100644 index 43133526..00000000 --- a/docs/models/components/productpriceonetimecustomtype.md +++ /dev/null @@ -1,17 +0,0 @@ -# ProductPriceOneTimeCustomType - -The type of the price. - -## Example Usage - -```typescript -import { ProductPriceOneTimeCustomType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceOneTimeCustomType = "one_time"; -``` - -## Values - -```typescript -"one_time" -``` \ No newline at end of file diff --git a/docs/models/components/productpriceonetimefixed.md b/docs/models/components/productpriceonetimefixed.md index e58d524f..162db24b 100644 --- a/docs/models/components/productpriceonetimefixed.md +++ b/docs/models/components/productpriceonetimefixed.md @@ -8,8 +8,8 @@ A one-time price for a product. import { ProductPriceOneTimeFixed } from "@polar-sh/sdk/models/components"; let value: ProductPriceOneTimeFixed = { - createdAt: new Date("2024-11-26T21:21:58.551Z"), - modifiedAt: new Date("2024-12-25T20:43:06.136Z"), + createdAt: new Date("2025-11-26T21:21:58.551Z"), + modifiedAt: new Date("2025-12-25T20:43:06.136Z"), id: "", isArchived: false, productId: "", @@ -20,14 +20,14 @@ let value: ProductPriceOneTimeFixed = { ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------- | -| `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | -| `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | -| `id` | *string* | :heavy_check_mark: | The ID of the price. | -| `amountType` | [components.ProductPriceOneTimeFixedAmountType](../../models/components/productpriceonetimefixedamounttype.md) | :heavy_check_mark: | N/A | -| `isArchived` | *boolean* | :heavy_check_mark: | Whether the price is archived and no longer available. | -| `productId` | *string* | :heavy_check_mark: | The ID of the product owning the price. | -| `priceCurrency` | *string* | :heavy_check_mark: | The currency. | -| `priceAmount` | *number* | :heavy_check_mark: | The price in cents. | -| `type` | [components.ProductPriceOneTimeFixedType](../../models/components/productpriceonetimefixedtype.md) | :heavy_check_mark: | The type of the price. | \ No newline at end of file +| Field | Type | Required | Description | +| --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | +| `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | +| `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | +| `id` | *string* | :heavy_check_mark: | The ID of the price. | +| `amountType` | *string* | :heavy_check_mark: | N/A | +| `isArchived` | *boolean* | :heavy_check_mark: | Whether the price is archived and no longer available. | +| `productId` | *string* | :heavy_check_mark: | The ID of the product owning the price. | +| `priceCurrency` | *string* | :heavy_check_mark: | The currency. | +| `priceAmount` | *number* | :heavy_check_mark: | The price in cents. | +| `type` | *string* | :heavy_check_mark: | The type of the price. | \ No newline at end of file diff --git a/docs/models/components/productpriceonetimefixedamounttype.md b/docs/models/components/productpriceonetimefixedamounttype.md deleted file mode 100644 index dec1a4c3..00000000 --- a/docs/models/components/productpriceonetimefixedamounttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceOneTimeFixedAmountType - -## Example Usage - -```typescript -import { ProductPriceOneTimeFixedAmountType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceOneTimeFixedAmountType = "fixed"; -``` - -## Values - -```typescript -"fixed" -``` \ No newline at end of file diff --git a/docs/models/components/productpriceonetimefixedcreate.md b/docs/models/components/productpriceonetimefixedcreate.md index 761abe44..a1b8b7ff 100644 --- a/docs/models/components/productpriceonetimefixedcreate.md +++ b/docs/models/components/productpriceonetimefixedcreate.md @@ -8,15 +8,15 @@ Schema to create a one-time product price. import { ProductPriceOneTimeFixedCreate } from "@polar-sh/sdk/models/components"; let value: ProductPriceOneTimeFixedCreate = { - priceAmount: 56284, + priceAmount: 217682, }; ``` ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------------- | -| `type` | [components.ProductPriceOneTimeFixedCreateType](../../models/components/productpriceonetimefixedcreatetype.md) | :heavy_check_mark: | N/A | -| `amountType` | [components.ProductPriceOneTimeFixedCreateAmountType](../../models/components/productpriceonetimefixedcreateamounttype.md) | :heavy_check_mark: | N/A | -| `priceAmount` | *number* | :heavy_check_mark: | The price in cents. | -| `priceCurrency` | *string* | :heavy_minus_sign: | The currency. Currently, only `usd` is supported. | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------- | ------------------------------------------------- | ------------------------------------------------- | ------------------------------------------------- | +| `type` | *string* | :heavy_check_mark: | N/A | +| `amountType` | *string* | :heavy_check_mark: | N/A | +| `priceAmount` | *number* | :heavy_check_mark: | The price in cents. | +| `priceCurrency` | *string* | :heavy_minus_sign: | The currency. Currently, only `usd` is supported. | \ No newline at end of file diff --git a/docs/models/components/productpriceonetimefixedcreateamounttype.md b/docs/models/components/productpriceonetimefixedcreateamounttype.md deleted file mode 100644 index 6a9f80d8..00000000 --- a/docs/models/components/productpriceonetimefixedcreateamounttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceOneTimeFixedCreateAmountType - -## Example Usage - -```typescript -import { ProductPriceOneTimeFixedCreateAmountType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceOneTimeFixedCreateAmountType = "fixed"; -``` - -## Values - -```typescript -"fixed" -``` \ No newline at end of file diff --git a/docs/models/components/productpriceonetimefixedcreatetype.md b/docs/models/components/productpriceonetimefixedcreatetype.md deleted file mode 100644 index e4156079..00000000 --- a/docs/models/components/productpriceonetimefixedcreatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceOneTimeFixedCreateType - -## Example Usage - -```typescript -import { ProductPriceOneTimeFixedCreateType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceOneTimeFixedCreateType = "one_time"; -``` - -## Values - -```typescript -"one_time" -``` \ No newline at end of file diff --git a/docs/models/components/productpriceonetimefixedtype.md b/docs/models/components/productpriceonetimefixedtype.md deleted file mode 100644 index 1a1496dc..00000000 --- a/docs/models/components/productpriceonetimefixedtype.md +++ /dev/null @@ -1,17 +0,0 @@ -# ProductPriceOneTimeFixedType - -The type of the price. - -## Example Usage - -```typescript -import { ProductPriceOneTimeFixedType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceOneTimeFixedType = "one_time"; -``` - -## Values - -```typescript -"one_time" -``` \ No newline at end of file diff --git a/docs/models/components/productpriceonetimefree.md b/docs/models/components/productpriceonetimefree.md index 21622d64..bb12832d 100644 --- a/docs/models/components/productpriceonetimefree.md +++ b/docs/models/components/productpriceonetimefree.md @@ -8,8 +8,8 @@ A free one-time price for a product. import { ProductPriceOneTimeFree } from "@polar-sh/sdk/models/components"; let value: ProductPriceOneTimeFree = { - createdAt: new Date("2023-10-25T02:42:52.981Z"), - modifiedAt: new Date("2023-02-24T13:22:59.477Z"), + createdAt: new Date("2024-10-24T02:42:52.981Z"), + modifiedAt: new Date("2024-02-24T13:22:59.477Z"), id: "", isArchived: false, productId: "", @@ -18,12 +18,12 @@ let value: ProductPriceOneTimeFree = { ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------ | -| `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | -| `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | -| `id` | *string* | :heavy_check_mark: | The ID of the price. | -| `amountType` | [components.ProductPriceOneTimeFreeAmountType](../../models/components/productpriceonetimefreeamounttype.md) | :heavy_check_mark: | N/A | -| `isArchived` | *boolean* | :heavy_check_mark: | Whether the price is archived and no longer available. | -| `productId` | *string* | :heavy_check_mark: | The ID of the product owning the price. | -| `type` | [components.ProductPriceOneTimeFreeType](../../models/components/productpriceonetimefreetype.md) | :heavy_check_mark: | The type of the price. | \ No newline at end of file +| Field | Type | Required | Description | +| --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | --------------------------------------------------------------------------------------------- | +| `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | +| `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | +| `id` | *string* | :heavy_check_mark: | The ID of the price. | +| `amountType` | *string* | :heavy_check_mark: | N/A | +| `isArchived` | *boolean* | :heavy_check_mark: | Whether the price is archived and no longer available. | +| `productId` | *string* | :heavy_check_mark: | The ID of the product owning the price. | +| `type` | *string* | :heavy_check_mark: | The type of the price. | \ No newline at end of file diff --git a/docs/models/components/productpriceonetimefreeamounttype.md b/docs/models/components/productpriceonetimefreeamounttype.md deleted file mode 100644 index 06ae5bf7..00000000 --- a/docs/models/components/productpriceonetimefreeamounttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceOneTimeFreeAmountType - -## Example Usage - -```typescript -import { ProductPriceOneTimeFreeAmountType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceOneTimeFreeAmountType = "free"; -``` - -## Values - -```typescript -"free" -``` \ No newline at end of file diff --git a/docs/models/components/productpriceonetimefreecreate.md b/docs/models/components/productpriceonetimefreecreate.md index 83adbcab..01a9ebcb 100644 --- a/docs/models/components/productpriceonetimefreecreate.md +++ b/docs/models/components/productpriceonetimefreecreate.md @@ -12,7 +12,7 @@ let value: ProductPriceOneTimeFreeCreate = {}; ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------ | -| `type` | [components.ProductPriceOneTimeFreeCreateType](../../models/components/productpriceonetimefreecreatetype.md) | :heavy_check_mark: | N/A | -| `amountType` | [components.ProductPriceOneTimeFreeCreateAmountType](../../models/components/productpriceonetimefreecreateamounttype.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------ | ------------------ | ------------------ | ------------------ | +| `type` | *string* | :heavy_check_mark: | N/A | +| `amountType` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/productpriceonetimefreecreateamounttype.md b/docs/models/components/productpriceonetimefreecreateamounttype.md deleted file mode 100644 index 8f5c61c1..00000000 --- a/docs/models/components/productpriceonetimefreecreateamounttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceOneTimeFreeCreateAmountType - -## Example Usage - -```typescript -import { ProductPriceOneTimeFreeCreateAmountType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceOneTimeFreeCreateAmountType = "free"; -``` - -## Values - -```typescript -"free" -``` \ No newline at end of file diff --git a/docs/models/components/productpriceonetimefreecreatetype.md b/docs/models/components/productpriceonetimefreecreatetype.md deleted file mode 100644 index 8ee95df0..00000000 --- a/docs/models/components/productpriceonetimefreecreatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceOneTimeFreeCreateType - -## Example Usage - -```typescript -import { ProductPriceOneTimeFreeCreateType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceOneTimeFreeCreateType = "one_time"; -``` - -## Values - -```typescript -"one_time" -``` \ No newline at end of file diff --git a/docs/models/components/productpriceonetimefreetype.md b/docs/models/components/productpriceonetimefreetype.md deleted file mode 100644 index 0312f2d4..00000000 --- a/docs/models/components/productpriceonetimefreetype.md +++ /dev/null @@ -1,17 +0,0 @@ -# ProductPriceOneTimeFreeType - -The type of the price. - -## Example Usage - -```typescript -import { ProductPriceOneTimeFreeType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceOneTimeFreeType = "one_time"; -``` - -## Values - -```typescript -"one_time" -``` \ No newline at end of file diff --git a/docs/models/components/productpricerecurring.md b/docs/models/components/productpricerecurring.md index e69ac090..06f88fa5 100644 --- a/docs/models/components/productpricerecurring.md +++ b/docs/models/components/productpricerecurring.md @@ -7,8 +7,8 @@ ```typescript const value: components.ProductPriceRecurringFixed = { - createdAt: new Date("2023-01-31T03:47:25.523Z"), - modifiedAt: new Date("2024-06-27T04:59:29.330Z"), + createdAt: new Date("2024-01-31T03:47:25.523Z"), + modifiedAt: new Date("2025-06-27T04:59:29.330Z"), id: "", isArchived: false, productId: "", @@ -22,8 +22,8 @@ const value: components.ProductPriceRecurringFixed = { ```typescript const value: components.ProductPriceRecurringCustom = { - createdAt: new Date("2022-09-12T23:01:13.510Z"), - modifiedAt: new Date("2023-01-17T23:27:12.582Z"), + createdAt: new Date("2023-09-12T23:01:13.510Z"), + modifiedAt: new Date("2024-01-17T23:27:12.582Z"), id: "", isArchived: false, productId: "", @@ -39,8 +39,8 @@ const value: components.ProductPriceRecurringCustom = { ```typescript const value: components.ProductPriceRecurringFree = { - createdAt: new Date("2022-11-22T00:36:57.586Z"), - modifiedAt: new Date("2024-12-23T05:51:49.489Z"), + createdAt: new Date("2023-11-22T00:36:57.586Z"), + modifiedAt: new Date("2025-12-23T05:51:49.489Z"), id: "", isArchived: false, productId: "", diff --git a/docs/models/components/productpricerecurringcustom.md b/docs/models/components/productpricerecurringcustom.md index cfa666cd..fdcc9321 100644 --- a/docs/models/components/productpricerecurringcustom.md +++ b/docs/models/components/productpricerecurringcustom.md @@ -8,8 +8,8 @@ A pay-what-you-want recurring price for a product, i.e. a subscription. import { ProductPriceRecurringCustom } from "@polar-sh/sdk/models/components"; let value: ProductPriceRecurringCustom = { - createdAt: new Date("2024-03-11T20:34:19.717Z"), - modifiedAt: new Date("2024-08-24T08:46:06.475Z"), + createdAt: new Date("2025-03-11T20:34:19.717Z"), + modifiedAt: new Date("2025-08-24T08:46:06.475Z"), id: "", isArchived: false, productId: "", @@ -23,17 +23,17 @@ let value: ProductPriceRecurringCustom = { ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -| `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | -| `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | -| `id` | *string* | :heavy_check_mark: | The ID of the price. | -| `amountType` | [components.ProductPriceRecurringCustomAmountType](../../models/components/productpricerecurringcustomamounttype.md) | :heavy_check_mark: | N/A | -| `isArchived` | *boolean* | :heavy_check_mark: | Whether the price is archived and no longer available. | -| `productId` | *string* | :heavy_check_mark: | The ID of the product owning the price. | -| `priceCurrency` | *string* | :heavy_check_mark: | The currency. | -| `minimumAmount` | *number* | :heavy_check_mark: | The minimum amount the customer can pay. | -| `maximumAmount` | *number* | :heavy_check_mark: | The maximum amount the customer can pay. | -| `presetAmount` | *number* | :heavy_check_mark: | The initial amount shown to the customer. | -| `type` | [components.ProductPriceRecurringCustomType](../../models/components/productpricerecurringcustomtype.md) | :heavy_check_mark: | The type of the price. | -| `recurringInterval` | [components.SubscriptionRecurringInterval](../../models/components/subscriptionrecurringinterval.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | +| `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | +| `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | +| `id` | *string* | :heavy_check_mark: | The ID of the price. | +| `amountType` | *string* | :heavy_check_mark: | N/A | +| `isArchived` | *boolean* | :heavy_check_mark: | Whether the price is archived and no longer available. | +| `productId` | *string* | :heavy_check_mark: | The ID of the product owning the price. | +| `priceCurrency` | *string* | :heavy_check_mark: | The currency. | +| `minimumAmount` | *number* | :heavy_check_mark: | The minimum amount the customer can pay. | +| `maximumAmount` | *number* | :heavy_check_mark: | The maximum amount the customer can pay. | +| `presetAmount` | *number* | :heavy_check_mark: | The initial amount shown to the customer. | +| `type` | *string* | :heavy_check_mark: | The type of the price. | +| `recurringInterval` | [components.SubscriptionRecurringInterval](../../models/components/subscriptionrecurringinterval.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/productpricerecurringcustomamounttype.md b/docs/models/components/productpricerecurringcustomamounttype.md deleted file mode 100644 index 817c4ec1..00000000 --- a/docs/models/components/productpricerecurringcustomamounttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceRecurringCustomAmountType - -## Example Usage - -```typescript -import { ProductPriceRecurringCustomAmountType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceRecurringCustomAmountType = "custom"; -``` - -## Values - -```typescript -"custom" -``` \ No newline at end of file diff --git a/docs/models/components/productpricerecurringcustomtype.md b/docs/models/components/productpricerecurringcustomtype.md deleted file mode 100644 index 9ee2440c..00000000 --- a/docs/models/components/productpricerecurringcustomtype.md +++ /dev/null @@ -1,17 +0,0 @@ -# ProductPriceRecurringCustomType - -The type of the price. - -## Example Usage - -```typescript -import { ProductPriceRecurringCustomType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceRecurringCustomType = "recurring"; -``` - -## Values - -```typescript -"recurring" -``` \ No newline at end of file diff --git a/docs/models/components/productpricerecurringfixed.md b/docs/models/components/productpricerecurringfixed.md index 4eec2bcd..d6a74649 100644 --- a/docs/models/components/productpricerecurringfixed.md +++ b/docs/models/components/productpricerecurringfixed.md @@ -8,8 +8,8 @@ A recurring price for a product, i.e. a subscription. import { ProductPriceRecurringFixed } from "@polar-sh/sdk/models/components"; let value: ProductPriceRecurringFixed = { - createdAt: new Date("2022-04-27T01:45:19.792Z"), - modifiedAt: new Date("2024-11-08T05:51:26.933Z"), + createdAt: new Date("2023-04-27T01:45:19.792Z"), + modifiedAt: new Date("2025-11-08T05:51:26.933Z"), id: "", isArchived: false, productId: "", @@ -26,10 +26,10 @@ let value: ProductPriceRecurringFixed = { | `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | | `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | | `id` | *string* | :heavy_check_mark: | The ID of the price. | -| `amountType` | [components.AmountType](../../models/components/amounttype.md) | :heavy_check_mark: | N/A | +| `amountType` | *string* | :heavy_check_mark: | N/A | | `isArchived` | *boolean* | :heavy_check_mark: | Whether the price is archived and no longer available. | | `productId` | *string* | :heavy_check_mark: | The ID of the product owning the price. | | `priceCurrency` | *string* | :heavy_check_mark: | The currency. | | `priceAmount` | *number* | :heavy_check_mark: | The price in cents. | -| `type` | [components.Type](../../models/components/type.md) | :heavy_check_mark: | The type of the price. | +| `type` | *string* | :heavy_check_mark: | The type of the price. | | `recurringInterval` | [components.SubscriptionRecurringInterval](../../models/components/subscriptionrecurringinterval.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/productpricerecurringfixedcreate.md b/docs/models/components/productpricerecurringfixedcreate.md index 2f3557ac..2a0779f9 100644 --- a/docs/models/components/productpricerecurringfixedcreate.md +++ b/docs/models/components/productpricerecurringfixedcreate.md @@ -8,17 +8,17 @@ Schema to create a recurring product price, i.e. a subscription. import { ProductPriceRecurringFixedCreate } from "@polar-sh/sdk/models/components"; let value: ProductPriceRecurringFixedCreate = { - priceAmount: 591191, - recurringInterval: "month", + priceAmount: 9751, + recurringInterval: "year", }; ``` ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------------------ | -| `type` | [components.ProductPriceRecurringFixedCreateType](../../models/components/productpricerecurringfixedcreatetype.md) | :heavy_check_mark: | N/A | -| `amountType` | [components.ProductPriceRecurringFixedCreateAmountType](../../models/components/productpricerecurringfixedcreateamounttype.md) | :heavy_check_mark: | N/A | -| `priceAmount` | *number* | :heavy_check_mark: | The price in cents. | -| `priceCurrency` | *string* | :heavy_minus_sign: | The currency. Currently, only `usd` is supported. | -| `recurringInterval` | [components.SubscriptionRecurringInterval](../../models/components/subscriptionrecurringinterval.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | +| `type` | *string* | :heavy_check_mark: | N/A | +| `amountType` | *string* | :heavy_check_mark: | N/A | +| `priceAmount` | *number* | :heavy_check_mark: | The price in cents. | +| `priceCurrency` | *string* | :heavy_minus_sign: | The currency. Currently, only `usd` is supported. | +| `recurringInterval` | [components.SubscriptionRecurringInterval](../../models/components/subscriptionrecurringinterval.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/productpricerecurringfixedcreateamounttype.md b/docs/models/components/productpricerecurringfixedcreateamounttype.md deleted file mode 100644 index c52fa350..00000000 --- a/docs/models/components/productpricerecurringfixedcreateamounttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceRecurringFixedCreateAmountType - -## Example Usage - -```typescript -import { ProductPriceRecurringFixedCreateAmountType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceRecurringFixedCreateAmountType = "fixed"; -``` - -## Values - -```typescript -"fixed" -``` \ No newline at end of file diff --git a/docs/models/components/productpricerecurringfixedcreatetype.md b/docs/models/components/productpricerecurringfixedcreatetype.md deleted file mode 100644 index 1941da22..00000000 --- a/docs/models/components/productpricerecurringfixedcreatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceRecurringFixedCreateType - -## Example Usage - -```typescript -import { ProductPriceRecurringFixedCreateType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceRecurringFixedCreateType = "recurring"; -``` - -## Values - -```typescript -"recurring" -``` \ No newline at end of file diff --git a/docs/models/components/productpricerecurringfree.md b/docs/models/components/productpricerecurringfree.md index b69f5079..4b37bf5f 100644 --- a/docs/models/components/productpricerecurringfree.md +++ b/docs/models/components/productpricerecurringfree.md @@ -8,8 +8,8 @@ A free recurring price for a product, i.e. a subscription. import { ProductPriceRecurringFree } from "@polar-sh/sdk/models/components"; let value: ProductPriceRecurringFree = { - createdAt: new Date("2022-09-18T15:16:54.148Z"), - modifiedAt: new Date("2022-07-08T08:25:26.102Z"), + createdAt: new Date("2023-09-18T15:16:54.148Z"), + modifiedAt: new Date("2023-07-08T08:25:26.102Z"), id: "", isArchived: false, productId: "", @@ -19,13 +19,13 @@ let value: ProductPriceRecurringFree = { ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------- | -| `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | -| `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | -| `id` | *string* | :heavy_check_mark: | The ID of the price. | -| `amountType` | [components.ProductPriceRecurringFreeAmountType](../../models/components/productpricerecurringfreeamounttype.md) | :heavy_check_mark: | N/A | -| `isArchived` | *boolean* | :heavy_check_mark: | Whether the price is archived and no longer available. | -| `productId` | *string* | :heavy_check_mark: | The ID of the product owning the price. | -| `type` | [components.ProductPriceRecurringFreeType](../../models/components/productpricerecurringfreetype.md) | :heavy_check_mark: | The type of the price. | -| `recurringInterval` | [components.SubscriptionRecurringInterval](../../models/components/subscriptionrecurringinterval.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | +| `createdAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Creation timestamp of the object. | +| `modifiedAt` | [Date](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Date) | :heavy_check_mark: | Last modification timestamp of the object. | +| `id` | *string* | :heavy_check_mark: | The ID of the price. | +| `amountType` | *string* | :heavy_check_mark: | N/A | +| `isArchived` | *boolean* | :heavy_check_mark: | Whether the price is archived and no longer available. | +| `productId` | *string* | :heavy_check_mark: | The ID of the product owning the price. | +| `type` | *string* | :heavy_check_mark: | The type of the price. | +| `recurringInterval` | [components.SubscriptionRecurringInterval](../../models/components/subscriptionrecurringinterval.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/productpricerecurringfreeamounttype.md b/docs/models/components/productpricerecurringfreeamounttype.md deleted file mode 100644 index 8840a062..00000000 --- a/docs/models/components/productpricerecurringfreeamounttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceRecurringFreeAmountType - -## Example Usage - -```typescript -import { ProductPriceRecurringFreeAmountType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceRecurringFreeAmountType = "free"; -``` - -## Values - -```typescript -"free" -``` \ No newline at end of file diff --git a/docs/models/components/productpricerecurringfreecreate.md b/docs/models/components/productpricerecurringfreecreate.md index 64711f7a..042142e1 100644 --- a/docs/models/components/productpricerecurringfreecreate.md +++ b/docs/models/components/productpricerecurringfreecreate.md @@ -14,8 +14,8 @@ let value: ProductPriceRecurringFreeCreate = { ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------------- | -| `type` | [components.ProductPriceRecurringFreeCreateType](../../models/components/productpricerecurringfreecreatetype.md) | :heavy_check_mark: | N/A | -| `amountType` | [components.ProductPriceRecurringFreeCreateAmountType](../../models/components/productpricerecurringfreecreateamounttype.md) | :heavy_check_mark: | N/A | -| `recurringInterval` | [components.SubscriptionRecurringInterval](../../models/components/subscriptionrecurringinterval.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------- | +| `type` | *string* | :heavy_check_mark: | N/A | +| `amountType` | *string* | :heavy_check_mark: | N/A | +| `recurringInterval` | [components.SubscriptionRecurringInterval](../../models/components/subscriptionrecurringinterval.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/productpricerecurringfreecreateamounttype.md b/docs/models/components/productpricerecurringfreecreateamounttype.md deleted file mode 100644 index aabf6e51..00000000 --- a/docs/models/components/productpricerecurringfreecreateamounttype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceRecurringFreeCreateAmountType - -## Example Usage - -```typescript -import { ProductPriceRecurringFreeCreateAmountType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceRecurringFreeCreateAmountType = "free"; -``` - -## Values - -```typescript -"free" -``` \ No newline at end of file diff --git a/docs/models/components/productpricerecurringfreecreatetype.md b/docs/models/components/productpricerecurringfreecreatetype.md deleted file mode 100644 index d1e86960..00000000 --- a/docs/models/components/productpricerecurringfreecreatetype.md +++ /dev/null @@ -1,15 +0,0 @@ -# ProductPriceRecurringFreeCreateType - -## Example Usage - -```typescript -import { ProductPriceRecurringFreeCreateType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceRecurringFreeCreateType = "recurring"; -``` - -## Values - -```typescript -"recurring" -``` \ No newline at end of file diff --git a/docs/models/components/productpricerecurringfreetype.md b/docs/models/components/productpricerecurringfreetype.md deleted file mode 100644 index cf592c9d..00000000 --- a/docs/models/components/productpricerecurringfreetype.md +++ /dev/null @@ -1,17 +0,0 @@ -# ProductPriceRecurringFreeType - -The type of the price. - -## Example Usage - -```typescript -import { ProductPriceRecurringFreeType } from "@polar-sh/sdk/models/components"; - -let value: ProductPriceRecurringFreeType = "recurring"; -``` - -## Values - -```typescript -"recurring" -``` \ No newline at end of file diff --git a/docs/models/components/productrecurringcreate.md b/docs/models/components/productrecurringcreate.md index ffcd7202..bc9226ec 100644 --- a/docs/models/components/productrecurringcreate.md +++ b/docs/models/components/productrecurringcreate.md @@ -11,8 +11,8 @@ let value: ProductRecurringCreate = { name: "", prices: [ { - priceAmount: 674080, - recurringInterval: "month", + priceAmount: 508157, + recurringInterval: "year", }, ], }; diff --git a/docs/models/components/productrecurringcreatemetadata.md b/docs/models/components/productrecurringcreatemetadata.md index af79ea92..8ecc58cf 100644 --- a/docs/models/components/productrecurringcreatemetadata.md +++ b/docs/models/components/productrecurringcreatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 180463; +const value: number = 999479; ``` ### `boolean` diff --git a/docs/models/components/productrecurringcreateprices.md b/docs/models/components/productrecurringcreateprices.md index 02361948..5f4ca7a3 100644 --- a/docs/models/components/productrecurringcreateprices.md +++ b/docs/models/components/productrecurringcreateprices.md @@ -10,8 +10,8 @@ List of available prices for this product. ```typescript const value: components.ProductPriceRecurringFixedCreate[] = [ { - priceAmount: 624730, - recurringInterval: "month", + priceAmount: 590100, + recurringInterval: "year", }, ]; ``` @@ -21,7 +21,7 @@ const value: components.ProductPriceRecurringFixedCreate[] = [ ```typescript const value: components.ProductPriceRecurringFreeCreate[] = [ { - recurringInterval: "year", + recurringInterval: "month", }, ]; ``` diff --git a/docs/models/components/productsortproperty.md b/docs/models/components/productsortproperty.md index 50e6014c..af956afe 100644 --- a/docs/models/components/productsortproperty.md +++ b/docs/models/components/productsortproperty.md @@ -5,7 +5,7 @@ ```typescript import { ProductSortProperty } from "@polar-sh/sdk/models/components"; -let value: ProductSortProperty = "-name"; +let value: ProductSortProperty = "-price_amount"; ``` ## Values diff --git a/docs/models/components/productupdatemetadata.md b/docs/models/components/productupdatemetadata.md index fbb9630c..0b5c49e5 100644 --- a/docs/models/components/productupdatemetadata.md +++ b/docs/models/components/productupdatemetadata.md @@ -12,7 +12,7 @@ const value: string = ""; ### `number` ```typescript -const value: number = 530203; +const value: number = 376607; ``` ### `boolean` diff --git a/docs/models/components/productupdateprices.md b/docs/models/components/productupdateprices.md index 7df3acc2..6051f443 100644 --- a/docs/models/components/productupdateprices.md +++ b/docs/models/components/productupdateprices.md @@ -15,7 +15,7 @@ const value: components.ExistingProductPrice = { ```typescript const value: components.ProductPriceRecurringFixedCreate = { - priceAmount: 54266, + priceAmount: 150551, recurringInterval: "month", }; ``` @@ -24,7 +24,7 @@ const value: components.ProductPriceRecurringFixedCreate = { ```typescript const value: components.ProductPriceRecurringFreeCreate = { - recurringInterval: "year", + recurringInterval: "month", }; ``` @@ -32,7 +32,7 @@ const value: components.ProductPriceRecurringFreeCreate = { ```typescript const value: components.ProductPriceOneTimeFixedCreate = { - priceAmount: 228672, + priceAmount: 625699, }; ``` diff --git a/docs/models/components/repository.md b/docs/models/components/repository.md index 85758375..4a659a61 100644 --- a/docs/models/components/repository.md +++ b/docs/models/components/repository.md @@ -7,6 +7,7 @@ import { Repository } from "@polar-sh/sdk/models/components"; let value: Repository = { id: "f52c0140-fb8c-4a23-ad57-60b8a4636afa", + platform: "github", isPrivate: false, name: "MyOrg", description: "entry mid custom kinase mainstream smoothly", @@ -16,6 +17,7 @@ let value: Repository = { profileSettings: {}, organization: { id: "c35a697c-dd99-4704-917d-9a342d482155", + platform: "github", name: "", avatarUrl: "https://gigantic-rule.com", isPersonal: false, @@ -29,8 +31,8 @@ let value: Repository = { organizationId: "", }, internalOrganization: { - createdAt: new Date("2022-10-29T06:42:22.472Z"), - modifiedAt: new Date("2024-03-30T04:46:00.514Z"), + createdAt: new Date("2023-10-29T06:42:22.472Z"), + modifiedAt: new Date("2025-03-30T04:46:00.514Z"), id: "", name: "", slug: "", diff --git a/docs/models/components/repositorysortproperty.md b/docs/models/components/repositorysortproperty.md index f8a144bb..93fa5dc1 100644 --- a/docs/models/components/repositorysortproperty.md +++ b/docs/models/components/repositorysortproperty.md @@ -5,7 +5,7 @@ ```typescript import { RepositorySortProperty } from "@polar-sh/sdk/models/components"; -let value: RepositorySortProperty = "name"; +let value: RepositorySortProperty = "created_at"; ``` ## Values diff --git a/docs/models/components/responsetypes.md b/docs/models/components/responsetypes.md deleted file mode 100644 index ff200311..00000000 --- a/docs/models/components/responsetypes.md +++ /dev/null @@ -1,15 +0,0 @@ -# ResponseTypes - -## Example Usage - -```typescript -import { ResponseTypes } from "@polar-sh/sdk/models/components"; - -let value: ResponseTypes = "code"; -``` - -## Values - -```typescript -"code" -``` \ No newline at end of file diff --git a/docs/models/components/s3downloadurl.md b/docs/models/components/s3downloadurl.md index ebdb6827..ecf5d759 100644 --- a/docs/models/components/s3downloadurl.md +++ b/docs/models/components/s3downloadurl.md @@ -6,8 +6,8 @@ import { S3DownloadURL } from "@polar-sh/sdk/models/components"; let value: S3DownloadURL = { - url: "https://improbable-t-shirt.name", - expiresAt: new Date("2024-09-16T03:39:02.618Z"), + url: "https://tired-countess.info/", + expiresAt: new Date("2025-09-20T00:35:40.151Z"), }; ``` diff --git a/docs/models/components/s3filecreatemultipart.md b/docs/models/components/s3filecreatemultipart.md index c9703b06..5cb8708c 100644 --- a/docs/models/components/s3filecreatemultipart.md +++ b/docs/models/components/s3filecreatemultipart.md @@ -8,9 +8,9 @@ import { S3FileCreateMultipart } from "@polar-sh/sdk/models/components"; let value: S3FileCreateMultipart = { parts: [ { - number: 437793, - chunkStart: 396806, - chunkEnd: 627838, + number: 905613, + chunkStart: 215461, + chunkEnd: 754658, }, ], }; diff --git a/docs/models/components/s3filecreatepart.md b/docs/models/components/s3filecreatepart.md index 55f20823..b82e55ae 100644 --- a/docs/models/components/s3filecreatepart.md +++ b/docs/models/components/s3filecreatepart.md @@ -6,9 +6,9 @@ import { S3FileCreatePart } from "@polar-sh/sdk/models/components"; let value: S3FileCreatePart = { - number: 737008, - chunkStart: 937461, - chunkEnd: 836546, + number: 456468, + chunkStart: 70943, + chunkEnd: 794986, }; ``` diff --git a/docs/models/components/s3fileuploadcompletedpart.md b/docs/models/components/s3fileuploadcompletedpart.md index 51413b84..c85a3b8a 100644 --- a/docs/models/components/s3fileuploadcompletedpart.md +++ b/docs/models/components/s3fileuploadcompletedpart.md @@ -6,7 +6,7 @@ import { S3FileUploadCompletedPart } from "@polar-sh/sdk/models/components"; let value: S3FileUploadCompletedPart = { - number: 600106, + number: 391517, checksumEtag: "", checksumSha256Base64: "", }; diff --git a/docs/models/components/s3fileuploadmultipart.md b/docs/models/components/s3fileuploadmultipart.md index 80c24674..56bd3ddf 100644 --- a/docs/models/components/s3fileuploadmultipart.md +++ b/docs/models/components/s3fileuploadmultipart.md @@ -7,14 +7,14 @@ import { S3FileUploadMultipart } from "@polar-sh/sdk/models/components"; let value: S3FileUploadMultipart = { id: "", - path: "/lost+found", + path: "/Applications", parts: [ { - number: 435439, - chunkStart: 923738, - chunkEnd: 123286, - url: "https://determined-decongestant.biz/", - expiresAt: new Date("2022-02-04T18:09:15.157Z"), + number: 474164, + chunkStart: 836804, + chunkEnd: 419707, + url: "https://familiar-tinderbox.name/", + expiresAt: new Date("2023-06-26T19:08:50.389Z"), }, ], }; diff --git a/docs/models/components/s3fileuploadpart.md b/docs/models/components/s3fileuploadpart.md index 22976219..b6de5a8b 100644 --- a/docs/models/components/s3fileuploadpart.md +++ b/docs/models/components/s3fileuploadpart.md @@ -6,11 +6,11 @@ import { S3FileUploadPart } from "@polar-sh/sdk/models/components"; let value: S3FileUploadPart = { - number: 717659, - chunkStart: 161952, - chunkEnd: 455389, - url: "https://helpful-grouper.org/", - expiresAt: new Date("2024-02-13T00:39:06.977Z"), + number: 463193, + chunkStart: 614594, + chunkEnd: 505140, + url: "https://aching-earth.name", + expiresAt: new Date("2024-08-13T15:13:08.843Z"), }; ``` diff --git a/docs/models/components/scope.md b/docs/models/components/scope.md index 9e240e5e..747b1ebf 100644 --- a/docs/models/components/scope.md +++ b/docs/models/components/scope.md @@ -5,7 +5,7 @@ ```typescript import { Scope } from "@polar-sh/sdk/models/components"; -let value: Scope = "organizations:write"; +let value: Scope = "subscriptions:read"; ``` ## Values diff --git a/docs/models/components/service.md b/docs/models/components/service.md deleted file mode 100644 index d7fee5ec..00000000 --- a/docs/models/components/service.md +++ /dev/null @@ -1,15 +0,0 @@ -# Service - -## Example Usage - -```typescript -import { Service } from "@polar-sh/sdk/models/components"; - -let value: Service = "product_media"; -``` - -## Values - -```typescript -"product_media" -``` \ No newline at end of file diff --git a/docs/models/components/status.md b/docs/models/components/status.md deleted file mode 100644 index c149307c..00000000 --- a/docs/models/components/status.md +++ /dev/null @@ -1,15 +0,0 @@ -# Status - -## Example Usage - -```typescript -import { Status } from "@polar-sh/sdk/models/components"; - -let value: Status = "confirmed"; -``` - -## Values - -```typescript -"confirmed" -``` \ No newline at end of file diff --git a/docs/models/components/subscription.md b/docs/models/components/subscription.md index 5c1972f8..e57e956a 100644 --- a/docs/models/components/subscription.md +++ b/docs/models/components/subscription.md @@ -6,18 +6,18 @@ import { Subscription } from "@polar-sh/sdk/models/components"; let value: Subscription = { - createdAt: new Date("2022-12-15T22:38:22.380Z"), - modifiedAt: new Date("2022-07-04T06:48:36.981Z"), + createdAt: new Date("2023-12-15T22:38:22.380Z"), + modifiedAt: new Date("2023-07-04T06:48:36.981Z"), id: "", amount: 556133, currency: "Dalasi", recurringInterval: "year", status: "unpaid", - currentPeriodStart: new Date("2023-11-11T15:47:28.185Z"), - currentPeriodEnd: new Date("2023-11-08T18:38:53.264Z"), + currentPeriodStart: new Date("2024-11-10T15:47:28.185Z"), + currentPeriodEnd: new Date("2024-11-07T18:38:53.264Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2024-12-15T23:23:51.945Z"), - endedAt: new Date("2024-08-30T11:05:45.637Z"), + startedAt: new Date("2025-12-15T23:23:51.945Z"), + endedAt: new Date("2025-08-30T11:05:45.637Z"), customerId: "", productId: "", priceId: "", @@ -27,8 +27,8 @@ let value: Subscription = { "key": false, }, customer: { - createdAt: new Date("2022-12-10T16:41:14.824Z"), - modifiedAt: new Date("2023-02-05T15:08:18.944Z"), + createdAt: new Date("2023-12-10T16:41:14.824Z"), + modifiedAt: new Date("2024-02-05T15:08:18.944Z"), id: "", metadata: { "key": "", @@ -52,8 +52,8 @@ let value: Subscription = { publicName: "", }, product: { - createdAt: new Date("2022-11-24T10:19:41.436Z"), - modifiedAt: new Date("2022-10-07T13:11:52.112Z"), + createdAt: new Date("2023-11-24T10:19:41.436Z"), + modifiedAt: new Date("2023-10-07T13:11:52.112Z"), id: "", name: "", description: @@ -66,8 +66,8 @@ let value: Subscription = { }, prices: [ { - createdAt: new Date("2024-12-13T16:03:43.381Z"), - modifiedAt: new Date("2022-02-03T08:20:20.613Z"), + createdAt: new Date("2025-12-13T16:03:43.381Z"), + modifiedAt: new Date("2023-02-03T08:20:20.613Z"), id: "", isArchived: false, productId: "", @@ -76,8 +76,8 @@ let value: Subscription = { ], benefits: [ { - createdAt: new Date("2022-02-16T10:20:38.020Z"), - modifiedAt: new Date("2022-09-07T14:29:56.720Z"), + createdAt: new Date("2023-02-16T10:20:38.020Z"), + modifiedAt: new Date("2023-09-07T14:29:56.720Z"), id: "", description: "nervous save uncommon likewise separately content", selectable: false, @@ -98,10 +98,10 @@ let value: Subscription = { checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-11-23T21:03:26.961Z"), + lastModifiedAt: new Date("2023-11-23T21:03:26.961Z"), version: "", isUploaded: false, - createdAt: new Date("2024-08-03T08:45:30.623Z"), + createdAt: new Date("2025-08-03T08:45:30.623Z"), sizeReadable: "", publicUrl: "https://guilty-steak.net", }, @@ -110,8 +110,8 @@ let value: Subscription = { { customFieldId: "", customField: { - createdAt: new Date("2024-07-17T15:34:53.162Z"), - modifiedAt: new Date("2023-03-31T05:51:52.889Z"), + createdAt: new Date("2025-07-17T15:34:53.162Z"), + modifiedAt: new Date("2024-03-30T05:51:52.889Z"), id: "", metadata: { "key": "", @@ -127,8 +127,8 @@ let value: Subscription = { ], }, price: { - createdAt: new Date("2023-01-19T21:32:01.817Z"), - modifiedAt: new Date("2024-10-05T00:47:16.247Z"), + createdAt: new Date("2024-01-19T21:32:01.817Z"), + modifiedAt: new Date("2025-10-05T00:47:16.247Z"), id: "", isArchived: false, productId: "", @@ -140,16 +140,16 @@ let value: Subscription = { duration: "once", type: "percentage", basisPoints: 546868, - createdAt: new Date("2023-01-08T18:00:36.094Z"), - modifiedAt: new Date("2022-03-17T04:22:16.108Z"), + createdAt: new Date("2024-01-08T18:00:36.094Z"), + modifiedAt: new Date("2023-03-17T04:22:16.108Z"), id: "", metadata: { "key": "", }, name: "", code: "", - startsAt: new Date("2023-01-28T08:24:34.111Z"), - endsAt: new Date("2023-04-22T21:58:29.328Z"), + startsAt: new Date("2024-01-28T08:24:34.111Z"), + endsAt: new Date("2024-04-21T21:58:29.328Z"), maxRedemptions: 590927, redemptionsCount: 722392, organizationId: "", diff --git a/docs/models/components/subscriptioncustomer.md b/docs/models/components/subscriptioncustomer.md index c797ffe8..2661b907 100644 --- a/docs/models/components/subscriptioncustomer.md +++ b/docs/models/components/subscriptioncustomer.md @@ -6,8 +6,8 @@ import { SubscriptionCustomer } from "@polar-sh/sdk/models/components"; let value: SubscriptionCustomer = { - createdAt: new Date("2022-04-03T13:03:56.657Z"), - modifiedAt: new Date("2022-07-01T08:52:15.017Z"), + createdAt: new Date("2023-04-03T13:03:56.657Z"), + modifiedAt: new Date("2023-07-01T08:52:15.017Z"), id: "", metadata: { "key": 622789, diff --git a/docs/models/components/subscriptiondiscount.md b/docs/models/components/subscriptiondiscount.md index e97afb05..9c126dfa 100644 --- a/docs/models/components/subscriptiondiscount.md +++ b/docs/models/components/subscriptiondiscount.md @@ -11,16 +11,16 @@ const value: components.DiscountFixedOnceForeverDurationBase = { type: "percentage", amount: 168926, currency: "New Israeli Sheqel", - createdAt: new Date("2023-03-30T12:04:29.651Z"), - modifiedAt: new Date("2024-01-23T06:32:44.052Z"), + createdAt: new Date("2024-03-29T12:04:29.651Z"), + modifiedAt: new Date("2025-01-22T06:32:44.052Z"), id: "", metadata: { "key": "", }, name: "", code: "", - startsAt: new Date("2022-11-29T09:47:26.523Z"), - endsAt: new Date("2023-01-26T01:18:29.965Z"), + startsAt: new Date("2023-11-29T09:47:26.523Z"), + endsAt: new Date("2024-01-26T01:18:29.965Z"), maxRedemptions: 810302, redemptionsCount: 577590, organizationId: "", @@ -36,16 +36,16 @@ const value: components.DiscountFixedRepeatDurationBase = { type: "fixed", amount: 766591, currency: "Guarani", - createdAt: new Date("2024-02-15T22:46:04.284Z"), - modifiedAt: new Date("2024-04-20T20:41:36.879Z"), + createdAt: new Date("2025-02-14T22:46:04.284Z"), + modifiedAt: new Date("2025-04-20T20:41:36.879Z"), id: "", metadata: { "key": "", }, name: "", code: "", - startsAt: new Date("2023-08-24T21:19:59.665Z"), - endsAt: new Date("2023-08-19T12:20:52.263Z"), + startsAt: new Date("2024-08-23T21:19:59.665Z"), + endsAt: new Date("2024-08-18T12:20:52.263Z"), maxRedemptions: 739633, redemptionsCount: 956871, organizationId: "", @@ -59,16 +59,16 @@ const value: components.DiscountPercentageOnceForeverDurationBase = { duration: "once", type: "percentage", basisPoints: 659971, - createdAt: new Date("2023-09-28T22:34:37.039Z"), - modifiedAt: new Date("2024-04-29T06:26:15.778Z"), + createdAt: new Date("2024-09-27T22:34:37.039Z"), + modifiedAt: new Date("2025-04-29T06:26:15.778Z"), id: "", metadata: { "key": false, }, name: "", code: "", - startsAt: new Date("2022-02-10T05:07:51.800Z"), - endsAt: new Date("2022-06-11T13:12:44.267Z"), + startsAt: new Date("2023-02-10T05:07:51.800Z"), + endsAt: new Date("2023-06-11T13:12:44.267Z"), maxRedemptions: 756287, redemptionsCount: 83791, organizationId: "", @@ -83,16 +83,16 @@ const value: components.DiscountPercentageRepeatDurationBase = { durationInMonths: 219860, type: "fixed", basisPoints: 701841, - createdAt: new Date("2022-02-03T02:11:26.549Z"), - modifiedAt: new Date("2024-08-15T03:47:39.234Z"), + createdAt: new Date("2023-02-03T02:11:26.549Z"), + modifiedAt: new Date("2025-08-15T03:47:39.234Z"), id: "", metadata: { "key": 502393, }, name: "", code: "", - startsAt: new Date("2023-08-15T21:25:17.893Z"), - endsAt: new Date("2023-12-09T12:23:49.649Z"), + startsAt: new Date("2024-08-14T21:25:17.893Z"), + endsAt: new Date("2024-12-08T12:23:49.649Z"), maxRedemptions: 344856, redemptionsCount: 101107, organizationId: "", diff --git a/docs/models/components/subscriptionsortproperty.md b/docs/models/components/subscriptionsortproperty.md index 9b1b32ad..72a12132 100644 --- a/docs/models/components/subscriptionsortproperty.md +++ b/docs/models/components/subscriptionsortproperty.md @@ -5,7 +5,7 @@ ```typescript import { SubscriptionSortProperty } from "@polar-sh/sdk/models/components"; -let value: SubscriptionSortProperty = "-started_at"; +let value: SubscriptionSortProperty = "discount"; ``` ## Values diff --git a/docs/models/components/subtype.md b/docs/models/components/subtype.md index 632a1f4d..bfd1f7a6 100644 --- a/docs/models/components/subtype.md +++ b/docs/models/components/subtype.md @@ -5,7 +5,7 @@ ```typescript import { SubType } from "@polar-sh/sdk/models/components"; -let value: SubType = "user"; +let value: SubType = "organization"; ``` ## Values diff --git a/docs/models/components/tokenendpointauthmethod.md b/docs/models/components/tokenendpointauthmethod.md index 396ac84c..c0fbed1c 100644 --- a/docs/models/components/tokenendpointauthmethod.md +++ b/docs/models/components/tokenendpointauthmethod.md @@ -5,7 +5,7 @@ ```typescript import { TokenEndpointAuthMethod } from "@polar-sh/sdk/models/components"; -let value: TokenEndpointAuthMethod = "client_secret_basic"; +let value: TokenEndpointAuthMethod = "client_secret_post"; ``` ## Values diff --git a/docs/models/components/tokenresponse.md b/docs/models/components/tokenresponse.md index 431f4080..595433d1 100644 --- a/docs/models/components/tokenresponse.md +++ b/docs/models/components/tokenresponse.md @@ -7,7 +7,7 @@ import { TokenResponse } from "@polar-sh/sdk/models/components"; let value: TokenResponse = { accessToken: "", - expiresIn: 778403, + expiresIn: 770376, refreshToken: "", scope: "", idToken: "", @@ -16,11 +16,11 @@ let value: TokenResponse = { ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------ | ------------------------------------------------------------ | ------------------------------------------------------------ | ------------------------------------------------------------ | -| `accessToken` | *string* | :heavy_check_mark: | N/A | -| `tokenType` | [components.TokenType](../../models/components/tokentype.md) | :heavy_check_mark: | N/A | -| `expiresIn` | *number* | :heavy_check_mark: | N/A | -| `refreshToken` | *string* | :heavy_check_mark: | N/A | -| `scope` | *string* | :heavy_check_mark: | N/A | -| `idToken` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------ | ------------------ | ------------------ | ------------------ | +| `accessToken` | *string* | :heavy_check_mark: | N/A | +| `tokenType` | *string* | :heavy_check_mark: | N/A | +| `expiresIn` | *number* | :heavy_check_mark: | N/A | +| `refreshToken` | *string* | :heavy_check_mark: | N/A | +| `scope` | *string* | :heavy_check_mark: | N/A | +| `idToken` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/tokentype.md b/docs/models/components/tokentype.md index cdae631f..d1548693 100644 --- a/docs/models/components/tokentype.md +++ b/docs/models/components/tokentype.md @@ -5,11 +5,11 @@ ```typescript import { TokenType } from "@polar-sh/sdk/models/components"; -let value: TokenType = "Bearer"; +let value: TokenType = "access_token"; ``` ## Values ```typescript -"Bearer" +"access_token" | "refresh_token" ``` \ No newline at end of file diff --git a/docs/models/components/type.md b/docs/models/components/type.md deleted file mode 100644 index a7dd8984..00000000 --- a/docs/models/components/type.md +++ /dev/null @@ -1,17 +0,0 @@ -# Type - -The type of the price. - -## Example Usage - -```typescript -import { Type } from "@polar-sh/sdk/models/components"; - -let value: Type = "recurring"; -``` - -## Values - -```typescript -"recurring" -``` \ No newline at end of file diff --git a/docs/models/components/validatedlicensekey.md b/docs/models/components/validatedlicensekey.md index 1dd60c8f..4db524ea 100644 --- a/docs/models/components/validatedlicensekey.md +++ b/docs/models/components/validatedlicensekey.md @@ -12,38 +12,38 @@ let value: ValidatedLicenseKey = { customerId: "", user: { id: "", - email: "Nina91@hotmail.com", + email: "Alicia_Leffler59@hotmail.com", publicName: "", }, customer: { - createdAt: new Date("2024-05-12T17:01:01.281Z"), - modifiedAt: new Date("2022-01-28T22:15:10.176Z"), + createdAt: new Date("2024-04-05T00:36:00.465Z"), + modifiedAt: new Date("2024-12-24T13:54:38.176Z"), id: "", metadata: { - "key": "", + "key": false, }, - email: "Raina.Jakubowski@hotmail.com", + email: "Winfield.Kohler@yahoo.com", emailVerified: false, name: "", billingAddress: { - country: "Fiji", + country: "Guyana", }, taxId: [ - "", + "in_gst", ], organizationId: "", - avatarUrl: "https://deficient-sonnet.info", + avatarUrl: "https://meaty-density.org", }, benefitId: "", key: "", displayKey: "", - status: "granted", - limitActivations: 584231, - usage: 278991, - limitUsage: 514889, - validations: 613676, - lastValidatedAt: new Date("2023-10-01T23:51:31.367Z"), - expiresAt: new Date("2024-06-13T14:18:18.458Z"), + status: "disabled", + limitActivations: 141933, + usage: 884983, + limitUsage: 197014, + validations: 568613, + lastValidatedAt: new Date("2025-10-17T09:25:29.798Z"), + expiresAt: new Date("2024-09-10T16:25:42.110Z"), }; ``` diff --git a/docs/models/components/webhookbenefitcreatedpayload.md b/docs/models/components/webhookbenefitcreatedpayload.md index 85054d73..da4aae17 100644 --- a/docs/models/components/webhookbenefitcreatedpayload.md +++ b/docs/models/components/webhookbenefitcreatedpayload.md @@ -11,8 +11,8 @@ import { WebhookBenefitCreatedPayload } from "@polar-sh/sdk/models/components"; let value: WebhookBenefitCreatedPayload = { data: { - createdAt: new Date("2022-01-31T17:24:00.756Z"), - modifiedAt: new Date("2023-06-29T02:21:22.949Z"), + createdAt: new Date("2023-01-31T17:24:00.756Z"), + modifiedAt: new Date("2024-06-28T02:21:22.949Z"), id: "", description: "strident good-natured as likewise inspection populist circumnavigate", @@ -30,7 +30,7 @@ let value: WebhookBenefitCreatedPayload = { ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | -| `type` | [components.WebhookBenefitCreatedPayloadType](../../models/components/webhookbenefitcreatedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | *components.Benefit* | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| -------------------- | -------------------- | -------------------- | -------------------- | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | *components.Benefit* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/webhookbenefitcreatedpayloadtype.md b/docs/models/components/webhookbenefitcreatedpayloadtype.md deleted file mode 100644 index 7488a292..00000000 --- a/docs/models/components/webhookbenefitcreatedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookBenefitCreatedPayloadType - -## Example Usage - -```typescript -import { WebhookBenefitCreatedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookBenefitCreatedPayloadType = "benefit.created"; -``` - -## Values - -```typescript -"benefit.created" -``` \ No newline at end of file diff --git a/docs/models/components/webhookbenefitgrantcreatedpayload.md b/docs/models/components/webhookbenefitgrantcreatedpayload.md index f34cef77..f2c9965c 100644 --- a/docs/models/components/webhookbenefitgrantcreatedpayload.md +++ b/docs/models/components/webhookbenefitgrantcreatedpayload.md @@ -11,8 +11,8 @@ import { WebhookBenefitGrantCreatedPayload } from "@polar-sh/sdk/models/componen let value: WebhookBenefitGrantCreatedPayload = { data: { - createdAt: new Date("2024-10-16T21:05:49.513Z"), - modifiedAt: new Date("2023-10-13T05:48:42.839Z"), + createdAt: new Date("2025-10-16T21:05:49.513Z"), + modifiedAt: new Date("2024-10-12T05:48:42.839Z"), id: "", isGranted: false, isRevoked: false, @@ -21,19 +21,40 @@ let value: WebhookBenefitGrantCreatedPayload = { customerId: "", userId: "", benefitId: "", - properties: {}, + customer: { + createdAt: new Date("2023-05-12T18:50:06.377Z"), + modifiedAt: new Date("2024-07-04T08:33:29.105Z"), + id: "", + metadata: { + "key": "", + }, + email: "Maci40@hotmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Bosnia and Herzegovina", + }, + taxId: [ + "is_vat", + ], + organizationId: "", + avatarUrl: "https://mysterious-runway.org", + }, + properties: { + advertisementCampaignId: "", + }, benefit: { - createdAt: new Date("2022-10-21T15:19:12.004Z"), - modifiedAt: new Date("2024-03-31T22:39:21.658Z"), + createdAt: new Date("2024-02-06T21:53:27.255Z"), + modifiedAt: new Date("2023-02-16T14:34:47.648Z"), id: "", - description: "hmph orderly ouch monster ascribe into accompany ack", + description: "gadzooks testing adult under curse meager", selectable: false, deletable: false, organizationId: "", properties: { repositoryOwner: "polarsource", repositoryName: "private_repo", - permission: "maintain", + permission: "pull", }, }, }, @@ -42,7 +63,7 @@ let value: WebhookBenefitGrantCreatedPayload = { ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -| `type` | [components.WebhookBenefitGrantCreatedPayloadType](../../models/components/webhookbenefitgrantcreatedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.BenefitGrantWebhook](../../models/components/benefitgrantwebhook.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| -------------------------------------------------------------------------------- | -------------------------------------------------------------------------------- | -------------------------------------------------------------------------------- | -------------------------------------------------------------------------------- | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.BenefitGrantWebhook](../../models/components/benefitgrantwebhook.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/webhookbenefitgrantcreatedpayloadtype.md b/docs/models/components/webhookbenefitgrantcreatedpayloadtype.md deleted file mode 100644 index 7cd50d46..00000000 --- a/docs/models/components/webhookbenefitgrantcreatedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookBenefitGrantCreatedPayloadType - -## Example Usage - -```typescript -import { WebhookBenefitGrantCreatedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookBenefitGrantCreatedPayloadType = "benefit_grant.created"; -``` - -## Values - -```typescript -"benefit_grant.created" -``` \ No newline at end of file diff --git a/docs/models/components/webhookbenefitgrantrevokedpayload.md b/docs/models/components/webhookbenefitgrantrevokedpayload.md index 635ecabc..d3088071 100644 --- a/docs/models/components/webhookbenefitgrantrevokedpayload.md +++ b/docs/models/components/webhookbenefitgrantrevokedpayload.md @@ -11,8 +11,8 @@ import { WebhookBenefitGrantRevokedPayload } from "@polar-sh/sdk/models/componen let value: WebhookBenefitGrantRevokedPayload = { data: { - createdAt: new Date("2023-12-24T04:08:16.291Z"), - modifiedAt: new Date("2023-07-27T18:43:26.946Z"), + createdAt: new Date("2024-07-23T11:07:08.116Z"), + modifiedAt: new Date("2025-11-01T00:31:03.453Z"), id: "", isGranted: false, isRevoked: false, @@ -21,20 +21,38 @@ let value: WebhookBenefitGrantRevokedPayload = { customerId: "", userId: "", benefitId: "", + customer: { + createdAt: new Date("2024-04-24T08:05:27.539Z"), + modifiedAt: new Date("2025-08-26T11:17:42.321Z"), + id: "", + metadata: { + "key": 405335, + }, + email: "Stewart_Fritsch24@yahoo.com", + emailVerified: false, + name: "", + billingAddress: { + country: "British Indian Ocean Territory (Chagos Archipelago)", + }, + taxId: [ + "rs_pib", + ], + organizationId: "", + avatarUrl: "https://incomparable-seagull.com/", + }, properties: {}, benefit: { - createdAt: new Date("2024-03-18T03:12:28.184Z"), - modifiedAt: new Date("2024-05-25T13:47:58.818Z"), + createdAt: new Date("2024-08-18T14:57:12.197Z"), + modifiedAt: new Date("2025-09-07T18:38:25.731Z"), id: "", - description: "powerfully squeaky rim", + description: "faithfully individual gadzooks", selectable: false, deletable: false, organizationId: "", properties: { - repositoryOwner: "polarsource", - repositoryName: "private_repo", - permission: "pull", + note: "", }, + isTaxApplicable: false, }, }, }; @@ -42,7 +60,7 @@ let value: WebhookBenefitGrantRevokedPayload = { ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -| `type` | [components.WebhookBenefitGrantRevokedPayloadType](../../models/components/webhookbenefitgrantrevokedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.BenefitGrantWebhook](../../models/components/benefitgrantwebhook.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| -------------------------------------------------------------------------------- | -------------------------------------------------------------------------------- | -------------------------------------------------------------------------------- | -------------------------------------------------------------------------------- | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.BenefitGrantWebhook](../../models/components/benefitgrantwebhook.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/webhookbenefitgrantrevokedpayloadtype.md b/docs/models/components/webhookbenefitgrantrevokedpayloadtype.md deleted file mode 100644 index a3c64897..00000000 --- a/docs/models/components/webhookbenefitgrantrevokedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookBenefitGrantRevokedPayloadType - -## Example Usage - -```typescript -import { WebhookBenefitGrantRevokedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookBenefitGrantRevokedPayloadType = "benefit_grant.revoked"; -``` - -## Values - -```typescript -"benefit_grant.revoked" -``` \ No newline at end of file diff --git a/docs/models/components/webhookbenefitgrantupdatedpayload.md b/docs/models/components/webhookbenefitgrantupdatedpayload.md index 2fa522ec..d135c6cb 100644 --- a/docs/models/components/webhookbenefitgrantupdatedpayload.md +++ b/docs/models/components/webhookbenefitgrantupdatedpayload.md @@ -11,8 +11,8 @@ import { WebhookBenefitGrantUpdatedPayload } from "@polar-sh/sdk/models/componen let value: WebhookBenefitGrantUpdatedPayload = { data: { - createdAt: new Date("2022-06-07T00:46:55.861Z"), - modifiedAt: new Date("2024-04-14T16:09:06.266Z"), + createdAt: new Date("2023-02-14T12:50:16.034Z"), + modifiedAt: new Date("2025-01-12T05:08:56.049Z"), id: "", isGranted: false, isRevoked: false, @@ -21,17 +21,41 @@ let value: WebhookBenefitGrantUpdatedPayload = { customerId: "", userId: "", benefitId: "", - properties: {}, + customer: { + createdAt: new Date("2023-06-06T06:43:30.345Z"), + modifiedAt: new Date("2024-05-18T10:41:19.543Z"), + id: "", + metadata: { + "key": false, + }, + email: "Leonardo19@hotmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Saint Pierre and Miquelon", + }, + taxId: [ + "si_tin", + ], + organizationId: "", + avatarUrl: "https://mysterious-taxicab.net/", + }, + properties: { + advertisementCampaignId: "", + }, benefit: { - createdAt: new Date("2023-05-05T22:17:51.096Z"), - modifiedAt: new Date("2022-06-03T12:45:41.057Z"), + createdAt: new Date("2024-09-19T18:25:13.476Z"), + modifiedAt: new Date("2023-12-22T03:37:10.516Z"), id: "", description: - "inasmuch ectoderm where oof planula forenenst eminent inasmuch", + "wearily empty idolized after phooey preside because midwife", selectable: false, deletable: false, organizationId: "", - properties: {}, + properties: { + note: "", + }, + isTaxApplicable: false, }, }, }; @@ -39,7 +63,7 @@ let value: WebhookBenefitGrantUpdatedPayload = { ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -| `type` | [components.WebhookBenefitGrantUpdatedPayloadType](../../models/components/webhookbenefitgrantupdatedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.BenefitGrantWebhook](../../models/components/benefitgrantwebhook.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| -------------------------------------------------------------------------------- | -------------------------------------------------------------------------------- | -------------------------------------------------------------------------------- | -------------------------------------------------------------------------------- | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.BenefitGrantWebhook](../../models/components/benefitgrantwebhook.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/webhookbenefitgrantupdatedpayloadtype.md b/docs/models/components/webhookbenefitgrantupdatedpayloadtype.md deleted file mode 100644 index 358cd67e..00000000 --- a/docs/models/components/webhookbenefitgrantupdatedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookBenefitGrantUpdatedPayloadType - -## Example Usage - -```typescript -import { WebhookBenefitGrantUpdatedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookBenefitGrantUpdatedPayloadType = "benefit_grant.updated"; -``` - -## Values - -```typescript -"benefit_grant.updated" -``` \ No newline at end of file diff --git a/docs/models/components/webhookbenefitupdatedpayload.md b/docs/models/components/webhookbenefitupdatedpayload.md index 94905355..5754ee7d 100644 --- a/docs/models/components/webhookbenefitupdatedpayload.md +++ b/docs/models/components/webhookbenefitupdatedpayload.md @@ -11,8 +11,8 @@ import { WebhookBenefitUpdatedPayload } from "@polar-sh/sdk/models/components"; let value: WebhookBenefitUpdatedPayload = { data: { - createdAt: new Date("2024-12-13T15:58:07.576Z"), - modifiedAt: new Date("2023-10-15T13:29:16.655Z"), + createdAt: new Date("2025-12-13T15:58:07.576Z"), + modifiedAt: new Date("2024-10-14T13:29:16.655Z"), id: "", description: "yeast mallard croon", selectable: false, @@ -32,7 +32,7 @@ let value: WebhookBenefitUpdatedPayload = { ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | -| `type` | [components.WebhookBenefitUpdatedPayloadType](../../models/components/webhookbenefitupdatedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | *components.Benefit* | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| -------------------- | -------------------- | -------------------- | -------------------- | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | *components.Benefit* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/webhookbenefitupdatedpayloadtype.md b/docs/models/components/webhookbenefitupdatedpayloadtype.md deleted file mode 100644 index 1346ad25..00000000 --- a/docs/models/components/webhookbenefitupdatedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookBenefitUpdatedPayloadType - -## Example Usage - -```typescript -import { WebhookBenefitUpdatedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookBenefitUpdatedPayloadType = "benefit.updated"; -``` - -## Values - -```typescript -"benefit.updated" -``` \ No newline at end of file diff --git a/docs/models/components/webhookcheckoutcreatedpayload.md b/docs/models/components/webhookcheckoutcreatedpayload.md index b28cefff..db879c1d 100644 --- a/docs/models/components/webhookcheckoutcreatedpayload.md +++ b/docs/models/components/webhookcheckoutcreatedpayload.md @@ -11,13 +11,14 @@ import { WebhookCheckoutCreatedPayload } from "@polar-sh/sdk/models/components"; let value: WebhookCheckoutCreatedPayload = { data: { - createdAt: new Date("2023-08-21T04:36:26.084Z"), - modifiedAt: new Date("2023-04-10T07:48:57.030Z"), + createdAt: new Date("2024-08-20T04:36:26.084Z"), + modifiedAt: new Date("2024-04-09T07:48:57.030Z"), id: "", + paymentProcessor: "stripe", status: "succeeded", clientSecret: "", url: "https://unique-veto.info/", - expiresAt: new Date("2024-05-17T17:32:07.447Z"), + expiresAt: new Date("2025-05-17T17:32:07.447Z"), successUrl: "https://oddball-translation.com", embedOrigin: "", amount: 87129, @@ -47,8 +48,8 @@ let value: WebhookCheckoutCreatedPayload = { "key": 414662, }, product: { - createdAt: new Date("2022-10-17T22:52:14.955Z"), - modifiedAt: new Date("2024-04-28T13:26:34.681Z"), + createdAt: new Date("2023-10-17T22:52:14.955Z"), + modifiedAt: new Date("2025-04-28T13:26:34.681Z"), id: "", name: "", description: "over cuckoo canter even along rim", @@ -57,8 +58,8 @@ let value: WebhookCheckoutCreatedPayload = { organizationId: "", prices: [ { - createdAt: new Date("2022-05-12T17:39:01.246Z"), - modifiedAt: new Date("2022-11-21T13:40:18.320Z"), + createdAt: new Date("2023-05-12T17:39:01.246Z"), + modifiedAt: new Date("2023-11-21T13:40:18.320Z"), id: "", isArchived: false, productId: "", @@ -69,8 +70,8 @@ let value: WebhookCheckoutCreatedPayload = { ], benefits: [ { - createdAt: new Date("2023-03-31T00:46:25.708Z"), - modifiedAt: new Date("2022-03-12T07:20:08.678Z"), + createdAt: new Date("2024-03-30T00:46:25.708Z"), + modifiedAt: new Date("2023-03-12T07:20:08.678Z"), id: "", type: "downloadables", description: "rally wherever minus runny rough agreeable beneath", @@ -91,18 +92,18 @@ let value: WebhookCheckoutCreatedPayload = { checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2023-09-22T11:03:04.845Z"), + lastModifiedAt: new Date("2024-09-21T11:03:04.845Z"), version: "", isUploaded: false, - createdAt: new Date("2023-12-17T21:47:39.716Z"), + createdAt: new Date("2024-12-16T21:47:39.716Z"), sizeReadable: "", publicUrl: "https://intrepid-technician.info", }, ], }, productPrice: { - createdAt: new Date("2024-06-02T14:07:36.077Z"), - modifiedAt: new Date("2024-02-11T11:05:07.085Z"), + createdAt: new Date("2025-06-02T14:07:36.077Z"), + modifiedAt: new Date("2025-02-10T11:05:07.085Z"), id: "", isArchived: false, productId: "", @@ -122,8 +123,8 @@ let value: WebhookCheckoutCreatedPayload = { { customFieldId: "", customField: { - createdAt: new Date("2023-11-06T15:40:43.604Z"), - modifiedAt: new Date("2022-05-16T16:57:38.984Z"), + createdAt: new Date("2024-11-05T15:40:43.604Z"), + modifiedAt: new Date("2023-05-16T16:57:38.984Z"), id: "", metadata: { "key": false, @@ -146,7 +147,7 @@ let value: WebhookCheckoutCreatedPayload = { ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------ | -| `type` | [components.WebhookCheckoutCreatedPayloadType](../../models/components/webhookcheckoutcreatedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.Checkout](../../models/components/checkout.md) | :heavy_check_mark: | Checkout session data retrieved using an access token. | \ No newline at end of file +| Field | Type | Required | Description | +| ---------------------------------------------------------- | ---------------------------------------------------------- | ---------------------------------------------------------- | ---------------------------------------------------------- | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.Checkout](../../models/components/checkout.md) | :heavy_check_mark: | Checkout session data retrieved using an access token. | \ No newline at end of file diff --git a/docs/models/components/webhookcheckoutcreatedpayloadtype.md b/docs/models/components/webhookcheckoutcreatedpayloadtype.md deleted file mode 100644 index a9ce4979..00000000 --- a/docs/models/components/webhookcheckoutcreatedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookCheckoutCreatedPayloadType - -## Example Usage - -```typescript -import { WebhookCheckoutCreatedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookCheckoutCreatedPayloadType = "checkout.created"; -``` - -## Values - -```typescript -"checkout.created" -``` \ No newline at end of file diff --git a/docs/models/components/webhookcheckoutupdatedpayload.md b/docs/models/components/webhookcheckoutupdatedpayload.md index 65e4bfd9..dd6789fc 100644 --- a/docs/models/components/webhookcheckoutupdatedpayload.md +++ b/docs/models/components/webhookcheckoutupdatedpayload.md @@ -11,13 +11,14 @@ import { WebhookCheckoutUpdatedPayload } from "@polar-sh/sdk/models/components"; let value: WebhookCheckoutUpdatedPayload = { data: { - createdAt: new Date("2022-03-06T03:42:09.340Z"), - modifiedAt: new Date("2023-05-31T19:12:44.124Z"), + createdAt: new Date("2023-03-06T03:42:09.340Z"), + modifiedAt: new Date("2024-05-30T19:12:44.124Z"), id: "", + paymentProcessor: "stripe", status: "open", clientSecret: "", url: "https://wordy-hierarchy.org/", - expiresAt: new Date("2022-05-09T13:52:06.961Z"), + expiresAt: new Date("2023-05-09T13:52:06.961Z"), successUrl: "https://impractical-guard.net/", embedOrigin: "", amount: 344718, @@ -47,8 +48,8 @@ let value: WebhookCheckoutUpdatedPayload = { "key": 321043, }, product: { - createdAt: new Date("2022-02-02T19:48:48.046Z"), - modifiedAt: new Date("2024-03-19T00:44:08.150Z"), + createdAt: new Date("2023-02-02T19:48:48.046Z"), + modifiedAt: new Date("2025-03-19T00:44:08.150Z"), id: "", name: "", description: "although misfire breastplate", @@ -57,8 +58,8 @@ let value: WebhookCheckoutUpdatedPayload = { organizationId: "", prices: [ { - createdAt: new Date("2022-03-13T21:40:13.537Z"), - modifiedAt: new Date("2024-07-27T11:29:19.064Z"), + createdAt: new Date("2023-03-13T21:40:13.537Z"), + modifiedAt: new Date("2025-07-27T11:29:19.064Z"), id: "", isArchived: false, productId: "", @@ -69,8 +70,8 @@ let value: WebhookCheckoutUpdatedPayload = { ], benefits: [ { - createdAt: new Date("2024-04-27T16:58:28.709Z"), - modifiedAt: new Date("2023-05-16T05:23:49.944Z"), + createdAt: new Date("2025-04-27T16:58:28.709Z"), + modifiedAt: new Date("2024-05-15T05:23:49.944Z"), id: "", type: "custom", description: "ambitious hefty flawless doubtfully", @@ -91,18 +92,18 @@ let value: WebhookCheckoutUpdatedPayload = { checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-08-24T13:24:20.223Z"), + lastModifiedAt: new Date("2025-08-24T13:24:20.223Z"), version: "", isUploaded: false, - createdAt: new Date("2024-02-28T16:53:19.075Z"), + createdAt: new Date("2025-02-27T16:53:19.075Z"), sizeReadable: "", publicUrl: "https://mediocre-eternity.name", }, ], }, productPrice: { - createdAt: new Date("2022-10-20T20:36:49.558Z"), - modifiedAt: new Date("2024-08-19T15:05:51.902Z"), + createdAt: new Date("2023-10-20T20:36:49.558Z"), + modifiedAt: new Date("2025-08-19T15:05:51.902Z"), id: "", isArchived: false, productId: "", @@ -126,8 +127,8 @@ let value: WebhookCheckoutUpdatedPayload = { { customFieldId: "", customField: { - createdAt: new Date("2024-12-23T02:40:59.586Z"), - modifiedAt: new Date("2023-02-17T21:48:08.230Z"), + createdAt: new Date("2025-12-23T02:40:59.586Z"), + modifiedAt: new Date("2024-02-17T21:48:08.230Z"), id: "", metadata: { "key": false, @@ -150,7 +151,7 @@ let value: WebhookCheckoutUpdatedPayload = { ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------ | -| `type` | [components.WebhookCheckoutUpdatedPayloadType](../../models/components/webhookcheckoutupdatedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.Checkout](../../models/components/checkout.md) | :heavy_check_mark: | Checkout session data retrieved using an access token. | \ No newline at end of file +| Field | Type | Required | Description | +| ---------------------------------------------------------- | ---------------------------------------------------------- | ---------------------------------------------------------- | ---------------------------------------------------------- | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.Checkout](../../models/components/checkout.md) | :heavy_check_mark: | Checkout session data retrieved using an access token. | \ No newline at end of file diff --git a/docs/models/components/webhookcheckoutupdatedpayloadtype.md b/docs/models/components/webhookcheckoutupdatedpayloadtype.md deleted file mode 100644 index 3497c2c0..00000000 --- a/docs/models/components/webhookcheckoutupdatedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookCheckoutUpdatedPayloadType - -## Example Usage - -```typescript -import { WebhookCheckoutUpdatedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookCheckoutUpdatedPayloadType = "checkout.updated"; -``` - -## Values - -```typescript -"checkout.updated" -``` \ No newline at end of file diff --git a/docs/models/components/webhookordercreatedpayload.md b/docs/models/components/webhookordercreatedpayload.md index 090b5fc6..e4c9c24a 100644 --- a/docs/models/components/webhookordercreatedpayload.md +++ b/docs/models/components/webhookordercreatedpayload.md @@ -11,8 +11,8 @@ import { WebhookOrderCreatedPayload } from "@polar-sh/sdk/models/components"; let value: WebhookOrderCreatedPayload = { data: { - createdAt: new Date("2022-09-26T09:34:22.320Z"), - modifiedAt: new Date("2022-08-26T05:41:30.450Z"), + createdAt: new Date("2023-09-26T09:34:22.320Z"), + modifiedAt: new Date("2023-08-26T05:41:30.450Z"), id: "", metadata: { "key": "", @@ -31,8 +31,8 @@ let value: WebhookOrderCreatedPayload = { subscriptionId: "", checkoutId: "", customer: { - createdAt: new Date("2024-07-14T06:45:23.144Z"), - modifiedAt: new Date("2022-06-02T10:10:05.991Z"), + createdAt: new Date("2025-07-14T06:45:23.144Z"), + modifiedAt: new Date("2023-06-02T10:10:05.991Z"), id: "", metadata: { "key": 842855, @@ -56,8 +56,8 @@ let value: WebhookOrderCreatedPayload = { publicName: "", }, product: { - createdAt: new Date("2023-02-18T15:18:08.947Z"), - modifiedAt: new Date("2024-06-06T01:32:10.356Z"), + createdAt: new Date("2024-02-18T15:18:08.947Z"), + modifiedAt: new Date("2025-06-06T01:32:10.356Z"), id: "", name: "", description: "formal aw cutover bah hunt during up er", @@ -66,8 +66,8 @@ let value: WebhookOrderCreatedPayload = { organizationId: "", }, productPrice: { - createdAt: new Date("2023-10-20T19:59:57.420Z"), - modifiedAt: new Date("2024-11-21T15:56:29.957Z"), + createdAt: new Date("2024-10-19T19:59:57.420Z"), + modifiedAt: new Date("2025-11-21T15:56:29.957Z"), id: "", isArchived: false, productId: "", @@ -82,16 +82,16 @@ let value: WebhookOrderCreatedPayload = { durationInMonths: 532669, type: "fixed", basisPoints: 316542, - createdAt: new Date("2023-05-05T18:39:05.975Z"), - modifiedAt: new Date("2023-04-20T15:40:09.196Z"), + createdAt: new Date("2024-05-04T18:39:05.975Z"), + modifiedAt: new Date("2024-04-19T15:40:09.196Z"), id: "", metadata: { "key": 914971, }, name: "", code: "", - startsAt: new Date("2024-03-12T23:47:56.593Z"), - endsAt: new Date("2024-03-08T09:23:45.816Z"), + startsAt: new Date("2025-03-12T23:47:56.593Z"), + endsAt: new Date("2025-03-08T09:23:45.816Z"), maxRedemptions: 289913, redemptionsCount: 577710, organizationId: "", @@ -100,18 +100,18 @@ let value: WebhookOrderCreatedPayload = { metadata: { "key": false, }, - createdAt: new Date("2024-05-21T23:12:32.595Z"), - modifiedAt: new Date("2023-01-13T14:31:45.263Z"), + createdAt: new Date("2025-05-21T23:12:32.595Z"), + modifiedAt: new Date("2024-01-13T14:31:45.263Z"), id: "", amount: 770873, currency: "Solomon Islands Dollar", recurringInterval: "month", status: "unpaid", - currentPeriodStart: new Date("2023-04-29T16:31:11.826Z"), - currentPeriodEnd: new Date("2023-06-18T02:32:25.611Z"), + currentPeriodStart: new Date("2024-04-28T16:31:11.826Z"), + currentPeriodEnd: new Date("2024-06-17T02:32:25.611Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2023-05-07T09:54:10.374Z"), - endedAt: new Date("2023-09-15T08:37:16.402Z"), + startedAt: new Date("2024-05-06T09:54:10.374Z"), + endedAt: new Date("2024-09-14T08:37:16.402Z"), customerId: "", productId: "", priceId: "", @@ -125,7 +125,7 @@ let value: WebhookOrderCreatedPayload = { ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------ | -| `type` | [components.WebhookOrderCreatedPayloadType](../../models/components/webhookordercreatedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.Order](../../models/components/order.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ---------------------------------------------------- | ---------------------------------------------------- | ---------------------------------------------------- | ---------------------------------------------------- | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.Order](../../models/components/order.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/webhookordercreatedpayloadtype.md b/docs/models/components/webhookordercreatedpayloadtype.md deleted file mode 100644 index e7452f22..00000000 --- a/docs/models/components/webhookordercreatedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookOrderCreatedPayloadType - -## Example Usage - -```typescript -import { WebhookOrderCreatedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookOrderCreatedPayloadType = "order.created"; -``` - -## Values - -```typescript -"order.created" -``` \ No newline at end of file diff --git a/docs/models/components/webhookorganizationupdatedpayload.md b/docs/models/components/webhookorganizationupdatedpayload.md index 1b1079d5..bb7414f9 100644 --- a/docs/models/components/webhookorganizationupdatedpayload.md +++ b/docs/models/components/webhookorganizationupdatedpayload.md @@ -11,8 +11,8 @@ import { WebhookOrganizationUpdatedPayload } from "@polar-sh/sdk/models/componen let value: WebhookOrganizationUpdatedPayload = { data: { - createdAt: new Date("2022-05-25T08:22:59.213Z"), - modifiedAt: new Date("2022-11-02T06:36:12.349Z"), + createdAt: new Date("2023-05-25T08:22:59.213Z"), + modifiedAt: new Date("2023-11-02T06:36:12.349Z"), id: "", name: "", slug: "", @@ -34,7 +34,7 @@ let value: WebhookOrganizationUpdatedPayload = { ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -| `type` | [components.WebhookOrganizationUpdatedPayloadType](../../models/components/webhookorganizationupdatedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.Organization](../../models/components/organization.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.Organization](../../models/components/organization.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/webhookorganizationupdatedpayloadtype.md b/docs/models/components/webhookorganizationupdatedpayloadtype.md deleted file mode 100644 index ccf79f14..00000000 --- a/docs/models/components/webhookorganizationupdatedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookOrganizationUpdatedPayloadType - -## Example Usage - -```typescript -import { WebhookOrganizationUpdatedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookOrganizationUpdatedPayloadType = "organization.updated"; -``` - -## Values - -```typescript -"organization.updated" -``` \ No newline at end of file diff --git a/docs/models/components/webhookpledgecreatedpayload.md b/docs/models/components/webhookpledgecreatedpayload.md index 429b5088..5b460141 100644 --- a/docs/models/components/webhookpledgecreatedpayload.md +++ b/docs/models/components/webhookpledgecreatedpayload.md @@ -11,8 +11,8 @@ import { WebhookPledgeCreatedPayload } from "@polar-sh/sdk/models/components"; let value: WebhookPledgeCreatedPayload = { data: { - createdAt: new Date("2023-12-12T15:52:26.486Z"), - modifiedAt: new Date("2024-03-17T00:12:28.102Z"), + createdAt: new Date("2024-12-11T15:52:26.486Z"), + modifiedAt: new Date("2025-03-17T00:12:28.102Z"), id: "", amount: 737882, currency: "UAE Dirham", @@ -20,14 +20,16 @@ let value: WebhookPledgeCreatedPayload = { type: "pay_on_completion", issue: { id: "066e9be7-04de-454e-95a4-18e93ac58a2f", + platform: "github", number: 979665, title: "", state: "open", - issueCreatedAt: new Date("2023-06-15T05:10:45.704Z"), + issueCreatedAt: new Date("2024-06-14T05:10:45.704Z"), needsConfirmationSolved: false, funding: {}, repository: { id: "20366ea6-f95b-47ee-9584-afd51f6457ff", + platform: "github", isPrivate: false, name: "MyOrg", description: "knottily ugh per though scratchy", @@ -37,6 +39,7 @@ let value: WebhookPledgeCreatedPayload = { profileSettings: {}, organization: { id: "8a17d9f4-1a1c-448c-8c7f-744b6604dcb0", + platform: "github", name: "", avatarUrl: "https://liquid-thorn.info/", isPersonal: false, @@ -50,8 +53,8 @@ let value: WebhookPledgeCreatedPayload = { organizationId: "", }, internalOrganization: { - createdAt: new Date("2023-02-12T04:50:27.888Z"), - modifiedAt: new Date("2023-01-15T19:49:53.185Z"), + createdAt: new Date("2024-02-12T04:50:27.888Z"), + modifiedAt: new Date("2024-01-15T19:49:53.185Z"), id: "", name: "", slug: "", @@ -77,7 +80,7 @@ let value: WebhookPledgeCreatedPayload = { ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------- | -| `type` | [components.WebhookPledgeCreatedPayloadType](../../models/components/webhookpledgecreatedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.Pledge](../../models/components/pledge.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------------ | ------------------------------------------------------ | ------------------------------------------------------ | ------------------------------------------------------ | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.Pledge](../../models/components/pledge.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/webhookpledgecreatedpayloadtype.md b/docs/models/components/webhookpledgecreatedpayloadtype.md deleted file mode 100644 index fe295167..00000000 --- a/docs/models/components/webhookpledgecreatedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookPledgeCreatedPayloadType - -## Example Usage - -```typescript -import { WebhookPledgeCreatedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookPledgeCreatedPayloadType = "pledge.created"; -``` - -## Values - -```typescript -"pledge.created" -``` \ No newline at end of file diff --git a/docs/models/components/webhookpledgeupdatedpayload.md b/docs/models/components/webhookpledgeupdatedpayload.md index 5cea244e..b8693366 100644 --- a/docs/models/components/webhookpledgeupdatedpayload.md +++ b/docs/models/components/webhookpledgeupdatedpayload.md @@ -11,8 +11,8 @@ import { WebhookPledgeUpdatedPayload } from "@polar-sh/sdk/models/components"; let value: WebhookPledgeUpdatedPayload = { data: { - createdAt: new Date("2022-09-23T07:10:05.509Z"), - modifiedAt: new Date("2024-11-11T12:54:59.231Z"), + createdAt: new Date("2023-09-23T07:10:05.509Z"), + modifiedAt: new Date("2025-11-11T12:54:59.231Z"), id: "", amount: 164347, currency: "Nakfa", @@ -20,14 +20,16 @@ let value: WebhookPledgeUpdatedPayload = { type: "pay_on_completion", issue: { id: "4b0ed1cf-79a4-4a76-9ece-d09ba4601893", + platform: "github", number: 472077, title: "", state: "open", - issueCreatedAt: new Date("2022-06-06T04:52:00.062Z"), + issueCreatedAt: new Date("2023-06-06T04:52:00.062Z"), needsConfirmationSolved: false, funding: {}, repository: { id: "9fa1d619-365a-4613-b8c0-919d37c22ebb", + platform: "github", isPrivate: false, name: "MyOrg", description: "volleyball fast pish except entire queasily reasoning", @@ -37,6 +39,7 @@ let value: WebhookPledgeUpdatedPayload = { profileSettings: {}, organization: { id: "63d61b49-9f34-4eb7-ab66-284a6dc29b81", + platform: "github", name: "", avatarUrl: "https://golden-moment.biz/", isPersonal: false, @@ -50,8 +53,8 @@ let value: WebhookPledgeUpdatedPayload = { organizationId: "", }, internalOrganization: { - createdAt: new Date("2023-07-21T15:47:00.097Z"), - modifiedAt: new Date("2022-10-08T06:27:13.427Z"), + createdAt: new Date("2024-07-20T15:47:00.097Z"), + modifiedAt: new Date("2023-10-08T06:27:13.427Z"), id: "", name: "", slug: "", @@ -77,7 +80,7 @@ let value: WebhookPledgeUpdatedPayload = { ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------- | -| `type` | [components.WebhookPledgeUpdatedPayloadType](../../models/components/webhookpledgeupdatedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.Pledge](../../models/components/pledge.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------------ | ------------------------------------------------------ | ------------------------------------------------------ | ------------------------------------------------------ | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.Pledge](../../models/components/pledge.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/webhookpledgeupdatedpayloadtype.md b/docs/models/components/webhookpledgeupdatedpayloadtype.md deleted file mode 100644 index decec699..00000000 --- a/docs/models/components/webhookpledgeupdatedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookPledgeUpdatedPayloadType - -## Example Usage - -```typescript -import { WebhookPledgeUpdatedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookPledgeUpdatedPayloadType = "pledge.updated"; -``` - -## Values - -```typescript -"pledge.updated" -``` \ No newline at end of file diff --git a/docs/models/components/webhookproductcreatedpayload.md b/docs/models/components/webhookproductcreatedpayload.md index db8cbaa1..73554634 100644 --- a/docs/models/components/webhookproductcreatedpayload.md +++ b/docs/models/components/webhookproductcreatedpayload.md @@ -11,8 +11,8 @@ import { WebhookProductCreatedPayload } from "@polar-sh/sdk/models/components"; let value: WebhookProductCreatedPayload = { data: { - createdAt: new Date("2022-04-04T21:52:52.496Z"), - modifiedAt: new Date("2024-06-06T08:49:54.446Z"), + createdAt: new Date("2023-04-04T21:52:52.496Z"), + modifiedAt: new Date("2025-06-06T08:49:54.446Z"), id: "", name: "", description: @@ -25,8 +25,8 @@ let value: WebhookProductCreatedPayload = { }, prices: [ { - createdAt: new Date("2024-12-29T15:39:22.988Z"), - modifiedAt: new Date("2024-01-31T14:39:50.524Z"), + createdAt: new Date("2025-12-29T15:39:22.988Z"), + modifiedAt: new Date("2025-01-30T14:39:50.524Z"), id: "", isArchived: false, productId: "", @@ -36,8 +36,8 @@ let value: WebhookProductCreatedPayload = { ], benefits: [ { - createdAt: new Date("2023-11-01T12:23:46.032Z"), - modifiedAt: new Date("2024-11-27T23:07:28.367Z"), + createdAt: new Date("2024-10-31T12:23:46.032Z"), + modifiedAt: new Date("2025-11-27T23:07:28.367Z"), id: "", description: "and minus confute pish", selectable: false, @@ -62,10 +62,10 @@ let value: WebhookProductCreatedPayload = { checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-05-26T12:06:04.723Z"), + lastModifiedAt: new Date("2025-05-26T12:06:04.723Z"), version: "", isUploaded: false, - createdAt: new Date("2022-06-27T17:44:33.524Z"), + createdAt: new Date("2023-06-27T17:44:33.524Z"), sizeReadable: "", publicUrl: "https://understated-tune-up.biz/", }, @@ -74,8 +74,8 @@ let value: WebhookProductCreatedPayload = { { customFieldId: "", customField: { - createdAt: new Date("2024-07-30T07:22:19.737Z"), - modifiedAt: new Date("2023-10-26T12:11:28.317Z"), + createdAt: new Date("2025-07-30T07:22:19.737Z"), + modifiedAt: new Date("2024-10-25T12:11:28.317Z"), id: "", metadata: { "key": 575838, @@ -95,7 +95,7 @@ let value: WebhookProductCreatedPayload = { ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | -| `type` | [components.WebhookProductCreatedPayloadType](../../models/components/webhookproductcreatedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.Product](../../models/components/product.md) | :heavy_check_mark: | A product. | \ No newline at end of file +| Field | Type | Required | Description | +| -------------------------------------------------------- | -------------------------------------------------------- | -------------------------------------------------------- | -------------------------------------------------------- | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.Product](../../models/components/product.md) | :heavy_check_mark: | A product. | \ No newline at end of file diff --git a/docs/models/components/webhookproductcreatedpayloadtype.md b/docs/models/components/webhookproductcreatedpayloadtype.md deleted file mode 100644 index b13cdc63..00000000 --- a/docs/models/components/webhookproductcreatedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookProductCreatedPayloadType - -## Example Usage - -```typescript -import { WebhookProductCreatedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookProductCreatedPayloadType = "product.created"; -``` - -## Values - -```typescript -"product.created" -``` \ No newline at end of file diff --git a/docs/models/components/webhookproductupdatedpayload.md b/docs/models/components/webhookproductupdatedpayload.md index 18d46a13..f6ed2d18 100644 --- a/docs/models/components/webhookproductupdatedpayload.md +++ b/docs/models/components/webhookproductupdatedpayload.md @@ -11,8 +11,8 @@ import { WebhookProductUpdatedPayload } from "@polar-sh/sdk/models/components"; let value: WebhookProductUpdatedPayload = { data: { - createdAt: new Date("2023-11-10T06:40:42.932Z"), - modifiedAt: new Date("2022-09-24T23:08:07.624Z"), + createdAt: new Date("2024-11-09T06:40:42.932Z"), + modifiedAt: new Date("2023-09-24T23:08:07.624Z"), id: "", name: "", description: "confirm mid individual reboot", @@ -24,8 +24,8 @@ let value: WebhookProductUpdatedPayload = { }, prices: [ { - createdAt: new Date("2023-09-13T14:57:06.534Z"), - modifiedAt: new Date("2022-03-28T20:15:02.629Z"), + createdAt: new Date("2024-09-12T14:57:06.534Z"), + modifiedAt: new Date("2023-03-28T20:15:02.629Z"), id: "", isArchived: false, productId: "", @@ -35,8 +35,8 @@ let value: WebhookProductUpdatedPayload = { ], benefits: [ { - createdAt: new Date("2022-09-21T15:17:36.784Z"), - modifiedAt: new Date("2023-10-14T17:36:45.405Z"), + createdAt: new Date("2023-09-21T15:17:36.784Z"), + modifiedAt: new Date("2024-10-13T17:36:45.405Z"), id: "", description: "triangular past except hepatitis pro collaboration wisely account ah without", @@ -62,10 +62,10 @@ let value: WebhookProductUpdatedPayload = { checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-02-21T00:08:54.044Z"), + lastModifiedAt: new Date("2023-02-21T00:08:54.044Z"), version: "", isUploaded: false, - createdAt: new Date("2022-01-31T12:55:38.637Z"), + createdAt: new Date("2023-01-31T12:55:38.637Z"), sizeReadable: "", publicUrl: "https://white-chiffonier.info", }, @@ -74,8 +74,8 @@ let value: WebhookProductUpdatedPayload = { { customFieldId: "", customField: { - createdAt: new Date("2024-07-31T20:50:15.524Z"), - modifiedAt: new Date("2023-11-20T04:44:06.594Z"), + createdAt: new Date("2025-07-31T20:50:15.524Z"), + modifiedAt: new Date("2024-11-19T04:44:06.594Z"), id: "", metadata: { "key": false, @@ -95,7 +95,7 @@ let value: WebhookProductUpdatedPayload = { ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------- | -| `type` | [components.WebhookProductUpdatedPayloadType](../../models/components/webhookproductupdatedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.Product](../../models/components/product.md) | :heavy_check_mark: | A product. | \ No newline at end of file +| Field | Type | Required | Description | +| -------------------------------------------------------- | -------------------------------------------------------- | -------------------------------------------------------- | -------------------------------------------------------- | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.Product](../../models/components/product.md) | :heavy_check_mark: | A product. | \ No newline at end of file diff --git a/docs/models/components/webhookproductupdatedpayloadtype.md b/docs/models/components/webhookproductupdatedpayloadtype.md deleted file mode 100644 index 63cf7887..00000000 --- a/docs/models/components/webhookproductupdatedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookProductUpdatedPayloadType - -## Example Usage - -```typescript -import { WebhookProductUpdatedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookProductUpdatedPayloadType = "product.updated"; -``` - -## Values - -```typescript -"product.updated" -``` \ No newline at end of file diff --git a/docs/models/components/webhooksubscriptionactivepayload.md b/docs/models/components/webhooksubscriptionactivepayload.md index 60dc7303..e809b3f9 100644 --- a/docs/models/components/webhooksubscriptionactivepayload.md +++ b/docs/models/components/webhooksubscriptionactivepayload.md @@ -12,18 +12,18 @@ import { WebhookSubscriptionActivePayload } from "@polar-sh/sdk/models/component let value: WebhookSubscriptionActivePayload = { data: { - createdAt: new Date("2024-10-26T05:31:01.527Z"), - modifiedAt: new Date("2022-09-01T17:18:42.245Z"), + createdAt: new Date("2025-10-26T05:31:01.527Z"), + modifiedAt: new Date("2023-09-01T17:18:42.245Z"), id: "", amount: 553542, currency: "Aruban Guilder", recurringInterval: "month", status: "past_due", - currentPeriodStart: new Date("2023-12-27T18:04:43.696Z"), - currentPeriodEnd: new Date("2023-09-29T18:30:50.452Z"), + currentPeriodStart: new Date("2024-12-26T18:04:43.696Z"), + currentPeriodEnd: new Date("2024-09-28T18:30:50.452Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2024-08-11T01:59:44.328Z"), - endedAt: new Date("2024-12-24T18:31:51.343Z"), + startedAt: new Date("2025-08-11T01:59:44.328Z"), + endedAt: new Date("2025-12-24T18:31:51.343Z"), customerId: "", productId: "", priceId: "", @@ -33,8 +33,8 @@ let value: WebhookSubscriptionActivePayload = { "key": false, }, customer: { - createdAt: new Date("2023-05-25T17:46:27.444Z"), - modifiedAt: new Date("2024-07-02T23:49:03.163Z"), + createdAt: new Date("2024-05-24T17:46:27.444Z"), + modifiedAt: new Date("2025-07-02T23:49:03.163Z"), id: "", metadata: { "key": "", @@ -58,8 +58,8 @@ let value: WebhookSubscriptionActivePayload = { publicName: "", }, product: { - createdAt: new Date("2024-02-07T10:09:35.758Z"), - modifiedAt: new Date("2024-07-29T21:23:38.273Z"), + createdAt: new Date("2025-02-06T10:09:35.758Z"), + modifiedAt: new Date("2025-07-29T21:23:38.273Z"), id: "", name: "", description: "home naturally watery before", @@ -71,8 +71,8 @@ let value: WebhookSubscriptionActivePayload = { }, prices: [ { - createdAt: new Date("2023-05-08T20:45:44.261Z"), - modifiedAt: new Date("2022-11-09T00:35:33.800Z"), + createdAt: new Date("2024-05-07T20:45:44.261Z"), + modifiedAt: new Date("2023-11-09T00:35:33.800Z"), id: "", isArchived: false, productId: "", @@ -82,8 +82,8 @@ let value: WebhookSubscriptionActivePayload = { ], benefits: [ { - createdAt: new Date("2024-02-23T13:34:54.556Z"), - modifiedAt: new Date("2022-06-09T23:00:47.892Z"), + createdAt: new Date("2025-02-22T13:34:54.556Z"), + modifiedAt: new Date("2023-06-09T23:00:47.892Z"), id: "", description: "metabolise impact worth shameful mount gradient oof even", @@ -112,10 +112,10 @@ let value: WebhookSubscriptionActivePayload = { checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2023-07-07T19:22:40.277Z"), + lastModifiedAt: new Date("2024-07-06T19:22:40.277Z"), version: "", isUploaded: false, - createdAt: new Date("2023-09-04T04:26:49.288Z"), + createdAt: new Date("2024-09-03T04:26:49.288Z"), sizeReadable: "", publicUrl: "https://pleasing-help.biz/", }, @@ -124,8 +124,8 @@ let value: WebhookSubscriptionActivePayload = { { customFieldId: "", customField: { - createdAt: new Date("2023-02-14T17:30:08.402Z"), - modifiedAt: new Date("2024-05-10T10:23:09.731Z"), + createdAt: new Date("2024-02-14T17:30:08.402Z"), + modifiedAt: new Date("2025-05-10T10:23:09.731Z"), id: "", metadata: { "key": 508271, @@ -148,8 +148,8 @@ let value: WebhookSubscriptionActivePayload = { ], }, price: { - createdAt: new Date("2024-11-24T23:28:50.658Z"), - modifiedAt: new Date("2024-05-19T03:49:33.823Z"), + createdAt: new Date("2025-11-24T23:28:50.658Z"), + modifiedAt: new Date("2025-05-19T03:49:33.823Z"), id: "", isArchived: false, productId: "", @@ -163,16 +163,16 @@ let value: WebhookSubscriptionActivePayload = { duration: "repeating", type: "percentage", basisPoints: 288348, - createdAt: new Date("2022-11-16T07:58:25.136Z"), - modifiedAt: new Date("2024-10-03T03:11:16.049Z"), + createdAt: new Date("2023-11-16T07:58:25.136Z"), + modifiedAt: new Date("2025-10-03T03:11:16.049Z"), id: "", metadata: { "key": false, }, name: "", code: "", - startsAt: new Date("2022-08-11T21:05:33.502Z"), - endsAt: new Date("2023-09-17T18:30:47.093Z"), + startsAt: new Date("2023-08-11T21:05:33.502Z"), + endsAt: new Date("2024-09-16T18:30:47.093Z"), maxRedemptions: 745764, redemptionsCount: 353036, organizationId: "", @@ -183,7 +183,7 @@ let value: WebhookSubscriptionActivePayload = { ## Fields -| Field | Type | Required | Description | -| ------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------ | ------------------------------------------------------------------------------------------------------------------ | -| `type` | [components.WebhookSubscriptionActivePayloadType](../../models/components/webhooksubscriptionactivepayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.Subscription](../../models/components/subscription.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.Subscription](../../models/components/subscription.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/webhooksubscriptionactivepayloadtype.md b/docs/models/components/webhooksubscriptionactivepayloadtype.md deleted file mode 100644 index 9186713c..00000000 --- a/docs/models/components/webhooksubscriptionactivepayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookSubscriptionActivePayloadType - -## Example Usage - -```typescript -import { WebhookSubscriptionActivePayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookSubscriptionActivePayloadType = "subscription.active"; -``` - -## Values - -```typescript -"subscription.active" -``` \ No newline at end of file diff --git a/docs/models/components/webhooksubscriptioncanceledpayload.md b/docs/models/components/webhooksubscriptioncanceledpayload.md index 51093006..5cfb41db 100644 --- a/docs/models/components/webhooksubscriptioncanceledpayload.md +++ b/docs/models/components/webhooksubscriptioncanceledpayload.md @@ -12,18 +12,18 @@ import { WebhookSubscriptionCanceledPayload } from "@polar-sh/sdk/models/compone let value: WebhookSubscriptionCanceledPayload = { data: { - createdAt: new Date("2023-04-22T01:59:26.650Z"), - modifiedAt: new Date("2023-09-23T15:13:56.903Z"), + createdAt: new Date("2024-04-21T01:59:26.650Z"), + modifiedAt: new Date("2024-09-22T15:13:56.903Z"), id: "", amount: 467109, currency: "Sudanese Pound", recurringInterval: "month", status: "active", - currentPeriodStart: new Date("2023-01-05T23:44:25.788Z"), - currentPeriodEnd: new Date("2023-10-30T15:27:04.484Z"), + currentPeriodStart: new Date("2024-01-05T23:44:25.788Z"), + currentPeriodEnd: new Date("2024-10-29T15:27:04.484Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2024-04-30T10:48:39.079Z"), - endedAt: new Date("2022-03-25T10:55:20.447Z"), + startedAt: new Date("2025-04-30T10:48:39.079Z"), + endedAt: new Date("2023-03-25T10:55:20.447Z"), customerId: "", productId: "", priceId: "", @@ -33,8 +33,8 @@ let value: WebhookSubscriptionCanceledPayload = { "key": "", }, customer: { - createdAt: new Date("2023-12-30T22:18:25.349Z"), - modifiedAt: new Date("2024-03-20T06:56:16.111Z"), + createdAt: new Date("2024-12-29T22:18:25.349Z"), + modifiedAt: new Date("2025-03-20T06:56:16.111Z"), id: "", metadata: { "key": 982804, @@ -58,8 +58,8 @@ let value: WebhookSubscriptionCanceledPayload = { publicName: "", }, product: { - createdAt: new Date("2022-07-02T11:07:10.887Z"), - modifiedAt: new Date("2023-08-07T00:52:08.467Z"), + createdAt: new Date("2023-07-02T11:07:10.887Z"), + modifiedAt: new Date("2024-08-06T00:52:08.467Z"), id: "", name: "", description: @@ -72,8 +72,8 @@ let value: WebhookSubscriptionCanceledPayload = { }, prices: [ { - createdAt: new Date("2022-12-02T01:00:40.535Z"), - modifiedAt: new Date("2024-01-31T22:38:35.808Z"), + createdAt: new Date("2023-12-02T01:00:40.535Z"), + modifiedAt: new Date("2025-01-30T22:38:35.808Z"), id: "", isArchived: false, productId: "", @@ -83,8 +83,8 @@ let value: WebhookSubscriptionCanceledPayload = { ], benefits: [ { - createdAt: new Date("2024-07-29T08:16:06.752Z"), - modifiedAt: new Date("2023-05-12T19:42:35.257Z"), + createdAt: new Date("2025-07-29T08:16:06.752Z"), + modifiedAt: new Date("2024-05-11T19:42:35.257Z"), id: "", description: "verify past meh viability victoriously ha", selectable: false, @@ -112,10 +112,10 @@ let value: WebhookSubscriptionCanceledPayload = { checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-03-11T13:54:59.030Z"), + lastModifiedAt: new Date("2025-03-11T13:54:59.030Z"), version: "", isUploaded: false, - createdAt: new Date("2024-10-03T16:55:27.960Z"), + createdAt: new Date("2025-10-03T16:55:27.960Z"), sizeReadable: "", publicUrl: "https://rotating-guidance.biz/", }, @@ -124,8 +124,8 @@ let value: WebhookSubscriptionCanceledPayload = { { customFieldId: "", customField: { - createdAt: new Date("2023-01-18T02:26:54.532Z"), - modifiedAt: new Date("2022-04-29T04:52:40.857Z"), + createdAt: new Date("2024-01-18T02:26:54.532Z"), + modifiedAt: new Date("2023-04-29T04:52:40.857Z"), id: "", metadata: { "key": 447678, @@ -141,8 +141,8 @@ let value: WebhookSubscriptionCanceledPayload = { ], }, price: { - createdAt: new Date("2024-06-14T11:52:00.847Z"), - modifiedAt: new Date("2024-10-17T07:28:48.905Z"), + createdAt: new Date("2025-06-14T11:52:00.847Z"), + modifiedAt: new Date("2025-10-17T07:28:48.905Z"), id: "", isArchived: false, productId: "", @@ -152,16 +152,16 @@ let value: WebhookSubscriptionCanceledPayload = { duration: "once", type: "fixed", basisPoints: 365473, - createdAt: new Date("2024-02-04T21:57:43.798Z"), - modifiedAt: new Date("2022-10-28T23:39:35.956Z"), + createdAt: new Date("2025-02-03T21:57:43.798Z"), + modifiedAt: new Date("2023-10-28T23:39:35.956Z"), id: "", metadata: { "key": false, }, name: "", code: "", - startsAt: new Date("2024-05-16T16:29:20.566Z"), - endsAt: new Date("2022-08-01T16:05:42.769Z"), + startsAt: new Date("2025-05-16T16:29:20.566Z"), + endsAt: new Date("2023-08-01T16:05:42.769Z"), maxRedemptions: 330837, redemptionsCount: 825303, organizationId: "", @@ -172,7 +172,7 @@ let value: WebhookSubscriptionCanceledPayload = { ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------- | ---------------------------------------------------------------------------------------------------------------------- | -| `type` | [components.WebhookSubscriptionCanceledPayloadType](../../models/components/webhooksubscriptioncanceledpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.Subscription](../../models/components/subscription.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.Subscription](../../models/components/subscription.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/webhooksubscriptioncanceledpayloadtype.md b/docs/models/components/webhooksubscriptioncanceledpayloadtype.md deleted file mode 100644 index 990d1bb2..00000000 --- a/docs/models/components/webhooksubscriptioncanceledpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookSubscriptionCanceledPayloadType - -## Example Usage - -```typescript -import { WebhookSubscriptionCanceledPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookSubscriptionCanceledPayloadType = "subscription.canceled"; -``` - -## Values - -```typescript -"subscription.canceled" -``` \ No newline at end of file diff --git a/docs/models/components/webhooksubscriptioncreatedpayload.md b/docs/models/components/webhooksubscriptioncreatedpayload.md index 9f9f2763..272c902b 100644 --- a/docs/models/components/webhooksubscriptioncreatedpayload.md +++ b/docs/models/components/webhooksubscriptioncreatedpayload.md @@ -11,18 +11,18 @@ import { WebhookSubscriptionCreatedPayload } from "@polar-sh/sdk/models/componen let value: WebhookSubscriptionCreatedPayload = { data: { - createdAt: new Date("2023-02-21T08:43:45.283Z"), - modifiedAt: new Date("2023-09-07T06:05:32.228Z"), + createdAt: new Date("2024-02-21T08:43:45.283Z"), + modifiedAt: new Date("2024-09-06T06:05:32.228Z"), id: "", amount: 668218, currency: "Pound Sterling", recurringInterval: "month", status: "trialing", - currentPeriodStart: new Date("2022-12-05T03:31:10.013Z"), - currentPeriodEnd: new Date("2024-10-29T15:13:36.657Z"), + currentPeriodStart: new Date("2023-12-05T03:31:10.013Z"), + currentPeriodEnd: new Date("2025-10-29T15:13:36.657Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2024-08-31T12:55:25.056Z"), - endedAt: new Date("2024-07-31T21:36:43.500Z"), + startedAt: new Date("2025-08-31T12:55:25.056Z"), + endedAt: new Date("2025-07-31T21:36:43.500Z"), customerId: "", productId: "", priceId: "", @@ -32,8 +32,8 @@ let value: WebhookSubscriptionCreatedPayload = { "key": 344289, }, customer: { - createdAt: new Date("2023-08-25T12:55:52.067Z"), - modifiedAt: new Date("2024-06-12T11:40:46.096Z"), + createdAt: new Date("2024-08-24T12:55:52.067Z"), + modifiedAt: new Date("2025-06-12T11:40:46.096Z"), id: "", metadata: { "key": "", @@ -57,8 +57,8 @@ let value: WebhookSubscriptionCreatedPayload = { publicName: "", }, product: { - createdAt: new Date("2023-09-13T16:15:37.701Z"), - modifiedAt: new Date("2022-07-23T15:43:25.483Z"), + createdAt: new Date("2024-09-12T16:15:37.701Z"), + modifiedAt: new Date("2023-07-23T15:43:25.483Z"), id: "", name: "", description: "against so immense", @@ -70,8 +70,8 @@ let value: WebhookSubscriptionCreatedPayload = { }, prices: [ { - createdAt: new Date("2023-04-03T14:57:04.115Z"), - modifiedAt: new Date("2024-05-06T14:43:32.754Z"), + createdAt: new Date("2024-04-02T14:57:04.115Z"), + modifiedAt: new Date("2025-05-06T14:43:32.754Z"), id: "", isArchived: false, productId: "", @@ -81,8 +81,8 @@ let value: WebhookSubscriptionCreatedPayload = { ], benefits: [ { - createdAt: new Date("2022-10-12T06:39:45.765Z"), - modifiedAt: new Date("2024-04-10T23:31:39.054Z"), + createdAt: new Date("2023-10-12T06:39:45.765Z"), + modifiedAt: new Date("2025-04-10T23:31:39.054Z"), id: "", description: "probable than boo yum huzzah outside", selectable: false, @@ -114,10 +114,10 @@ let value: WebhookSubscriptionCreatedPayload = { checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-02-28T21:24:26.026Z"), + lastModifiedAt: new Date("2023-02-28T21:24:26.026Z"), version: "", isUploaded: false, - createdAt: new Date("2023-03-11T06:14:35.072Z"), + createdAt: new Date("2024-03-10T06:14:35.072Z"), sizeReadable: "", publicUrl: "https://sunny-premier.org/", }, @@ -126,8 +126,8 @@ let value: WebhookSubscriptionCreatedPayload = { { customFieldId: "", customField: { - createdAt: new Date("2024-04-29T02:57:40.478Z"), - modifiedAt: new Date("2024-12-25T16:18:25.276Z"), + createdAt: new Date("2025-04-29T02:57:40.478Z"), + modifiedAt: new Date("2025-12-25T16:18:25.276Z"), id: "", metadata: { "key": 37129, @@ -143,8 +143,8 @@ let value: WebhookSubscriptionCreatedPayload = { ], }, price: { - createdAt: new Date("2024-06-21T12:36:00.354Z"), - modifiedAt: new Date("2024-08-07T06:48:26.335Z"), + createdAt: new Date("2025-06-21T12:36:00.354Z"), + modifiedAt: new Date("2025-08-07T06:48:26.335Z"), id: "", isArchived: false, productId: "", @@ -160,16 +160,16 @@ let value: WebhookSubscriptionCreatedPayload = { type: "fixed", amount: 665872, currency: "Iranian Rial", - createdAt: new Date("2024-04-21T22:35:32.835Z"), - modifiedAt: new Date("2023-08-02T09:00:29.309Z"), + createdAt: new Date("2025-04-21T22:35:32.835Z"), + modifiedAt: new Date("2024-08-01T09:00:29.309Z"), id: "", metadata: { "key": "", }, name: "", code: "", - startsAt: new Date("2022-10-25T08:26:08.475Z"), - endsAt: new Date("2022-10-10T19:59:22.296Z"), + startsAt: new Date("2023-10-25T08:26:08.475Z"), + endsAt: new Date("2023-10-10T19:59:22.296Z"), maxRedemptions: 532320, redemptionsCount: 703189, organizationId: "", @@ -180,7 +180,7 @@ let value: WebhookSubscriptionCreatedPayload = { ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -| `type` | [components.WebhookSubscriptionCreatedPayloadType](../../models/components/webhooksubscriptioncreatedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.Subscription](../../models/components/subscription.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.Subscription](../../models/components/subscription.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/webhooksubscriptioncreatedpayloadtype.md b/docs/models/components/webhooksubscriptioncreatedpayloadtype.md deleted file mode 100644 index fab16a04..00000000 --- a/docs/models/components/webhooksubscriptioncreatedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookSubscriptionCreatedPayloadType - -## Example Usage - -```typescript -import { WebhookSubscriptionCreatedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookSubscriptionCreatedPayloadType = "subscription.created"; -``` - -## Values - -```typescript -"subscription.created" -``` \ No newline at end of file diff --git a/docs/models/components/webhooksubscriptionrevokedpayload.md b/docs/models/components/webhooksubscriptionrevokedpayload.md index f75ee326..14128c39 100644 --- a/docs/models/components/webhooksubscriptionrevokedpayload.md +++ b/docs/models/components/webhooksubscriptionrevokedpayload.md @@ -12,18 +12,18 @@ import { WebhookSubscriptionRevokedPayload } from "@polar-sh/sdk/models/componen let value: WebhookSubscriptionRevokedPayload = { data: { - createdAt: new Date("2022-09-25T08:32:22.615Z"), - modifiedAt: new Date("2022-12-30T10:27:46.222Z"), + createdAt: new Date("2023-09-25T08:32:22.615Z"), + modifiedAt: new Date("2023-12-30T10:27:46.222Z"), id: "", amount: 343067, currency: "Dobra", recurringInterval: "month", status: "incomplete", - currentPeriodStart: new Date("2023-09-26T23:35:22.282Z"), - currentPeriodEnd: new Date("2023-03-12T05:38:01.720Z"), + currentPeriodStart: new Date("2024-09-25T23:35:22.282Z"), + currentPeriodEnd: new Date("2024-03-11T05:38:01.720Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2023-11-25T15:24:55.609Z"), - endedAt: new Date("2022-10-20T00:59:50.671Z"), + startedAt: new Date("2024-11-24T15:24:55.609Z"), + endedAt: new Date("2023-10-20T00:59:50.671Z"), customerId: "", productId: "", priceId: "", @@ -33,8 +33,8 @@ let value: WebhookSubscriptionRevokedPayload = { "key": false, }, customer: { - createdAt: new Date("2024-04-13T23:48:55.441Z"), - modifiedAt: new Date("2022-03-16T05:59:47.707Z"), + createdAt: new Date("2025-04-13T23:48:55.441Z"), + modifiedAt: new Date("2023-03-16T05:59:47.707Z"), id: "", metadata: { "key": false, @@ -58,8 +58,8 @@ let value: WebhookSubscriptionRevokedPayload = { publicName: "", }, product: { - createdAt: new Date("2023-02-09T06:12:33.108Z"), - modifiedAt: new Date("2023-06-04T12:09:50.425Z"), + createdAt: new Date("2024-02-09T06:12:33.108Z"), + modifiedAt: new Date("2024-06-03T12:09:50.425Z"), id: "", name: "", description: "toward acidic meh opposite shoot yowza", @@ -71,8 +71,8 @@ let value: WebhookSubscriptionRevokedPayload = { }, prices: [ { - createdAt: new Date("2024-08-08T23:38:36.457Z"), - modifiedAt: new Date("2023-01-05T23:27:19.376Z"), + createdAt: new Date("2025-08-08T23:38:36.457Z"), + modifiedAt: new Date("2024-01-05T23:27:19.376Z"), id: "", isArchived: false, productId: "", @@ -85,8 +85,8 @@ let value: WebhookSubscriptionRevokedPayload = { ], benefits: [ { - createdAt: new Date("2023-10-29T13:53:32.868Z"), - modifiedAt: new Date("2022-02-11T16:01:53.719Z"), + createdAt: new Date("2024-10-28T13:53:32.868Z"), + modifiedAt: new Date("2023-02-11T16:01:53.719Z"), id: "", description: "fuel oof matter under", selectable: false, @@ -111,10 +111,10 @@ let value: WebhookSubscriptionRevokedPayload = { checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-12-21T16:20:06.057Z"), + lastModifiedAt: new Date("2023-12-21T16:20:06.057Z"), version: "", isUploaded: false, - createdAt: new Date("2024-06-10T15:29:17.298Z"), + createdAt: new Date("2025-06-10T15:29:17.298Z"), sizeReadable: "", publicUrl: "https://indolent-other.net", }, @@ -123,8 +123,8 @@ let value: WebhookSubscriptionRevokedPayload = { { customFieldId: "", customField: { - createdAt: new Date("2024-06-13T18:55:12.078Z"), - modifiedAt: new Date("2022-07-02T00:29:30.258Z"), + createdAt: new Date("2025-06-13T18:55:12.078Z"), + modifiedAt: new Date("2023-07-02T00:29:30.258Z"), id: "", metadata: { "key": false, @@ -140,8 +140,8 @@ let value: WebhookSubscriptionRevokedPayload = { ], }, price: { - createdAt: new Date("2023-11-14T17:27:52.001Z"), - modifiedAt: new Date("2022-05-06T16:52:19.881Z"), + createdAt: new Date("2024-11-13T17:27:52.001Z"), + modifiedAt: new Date("2023-05-06T16:52:19.881Z"), id: "", isArchived: false, productId: "", @@ -155,16 +155,16 @@ let value: WebhookSubscriptionRevokedPayload = { type: "percentage", amount: 963600, currency: "Naira", - createdAt: new Date("2022-11-25T20:02:18.063Z"), - modifiedAt: new Date("2024-11-13T22:33:54.853Z"), + createdAt: new Date("2023-11-25T20:02:18.063Z"), + modifiedAt: new Date("2025-11-13T22:33:54.853Z"), id: "", metadata: { "key": 697518, }, name: "", code: "", - startsAt: new Date("2023-11-26T23:42:11.595Z"), - endsAt: new Date("2024-11-10T09:22:01.009Z"), + startsAt: new Date("2024-11-25T23:42:11.595Z"), + endsAt: new Date("2025-11-10T09:22:01.009Z"), maxRedemptions: 914603, redemptionsCount: 148004, organizationId: "", @@ -175,7 +175,7 @@ let value: WebhookSubscriptionRevokedPayload = { ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -| `type` | [components.WebhookSubscriptionRevokedPayloadType](../../models/components/webhooksubscriptionrevokedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.Subscription](../../models/components/subscription.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.Subscription](../../models/components/subscription.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/webhooksubscriptionrevokedpayloadtype.md b/docs/models/components/webhooksubscriptionrevokedpayloadtype.md deleted file mode 100644 index 49ff0aa5..00000000 --- a/docs/models/components/webhooksubscriptionrevokedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookSubscriptionRevokedPayloadType - -## Example Usage - -```typescript -import { WebhookSubscriptionRevokedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookSubscriptionRevokedPayloadType = "subscription.revoked"; -``` - -## Values - -```typescript -"subscription.revoked" -``` \ No newline at end of file diff --git a/docs/models/components/webhooksubscriptionupdatedpayload.md b/docs/models/components/webhooksubscriptionupdatedpayload.md index f1c47cba..2983e43b 100644 --- a/docs/models/components/webhooksubscriptionupdatedpayload.md +++ b/docs/models/components/webhooksubscriptionupdatedpayload.md @@ -15,18 +15,18 @@ import { WebhookSubscriptionUpdatedPayload } from "@polar-sh/sdk/models/componen let value: WebhookSubscriptionUpdatedPayload = { data: { - createdAt: new Date("2024-12-04T08:48:14.783Z"), - modifiedAt: new Date("2023-05-09T01:09:28.036Z"), + createdAt: new Date("2025-12-04T08:48:14.783Z"), + modifiedAt: new Date("2024-05-08T01:09:28.036Z"), id: "", amount: 227129, currency: "Pound Sterling", recurringInterval: "year", status: "incomplete_expired", - currentPeriodStart: new Date("2023-02-22T02:51:06.328Z"), - currentPeriodEnd: new Date("2023-06-09T12:27:33.773Z"), + currentPeriodStart: new Date("2024-02-22T02:51:06.328Z"), + currentPeriodEnd: new Date("2024-06-08T12:27:33.773Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2023-09-23T07:43:22.108Z"), - endedAt: new Date("2024-12-27T17:25:33.535Z"), + startedAt: new Date("2024-09-22T07:43:22.108Z"), + endedAt: new Date("2025-12-27T17:25:33.535Z"), customerId: "", productId: "", priceId: "", @@ -36,8 +36,8 @@ let value: WebhookSubscriptionUpdatedPayload = { "key": "", }, customer: { - createdAt: new Date("2023-01-23T08:27:25.525Z"), - modifiedAt: new Date("2022-10-16T03:05:22.272Z"), + createdAt: new Date("2024-01-23T08:27:25.525Z"), + modifiedAt: new Date("2023-10-16T03:05:22.272Z"), id: "", metadata: { "key": 100804, @@ -61,8 +61,8 @@ let value: WebhookSubscriptionUpdatedPayload = { publicName: "", }, product: { - createdAt: new Date("2024-04-02T09:01:37.891Z"), - modifiedAt: new Date("2022-11-12T11:10:45.405Z"), + createdAt: new Date("2025-04-02T09:01:37.891Z"), + modifiedAt: new Date("2023-11-12T11:10:45.405Z"), id: "", name: "", description: "sweet for badly incidentally whereas beneath", @@ -74,8 +74,8 @@ let value: WebhookSubscriptionUpdatedPayload = { }, prices: [ { - createdAt: new Date("2023-06-16T10:56:54.092Z"), - modifiedAt: new Date("2024-01-19T18:40:42.345Z"), + createdAt: new Date("2024-06-15T10:56:54.092Z"), + modifiedAt: new Date("2025-01-18T18:40:42.345Z"), id: "", isArchived: false, productId: "", @@ -85,8 +85,8 @@ let value: WebhookSubscriptionUpdatedPayload = { ], benefits: [ { - createdAt: new Date("2024-04-06T11:35:34.778Z"), - modifiedAt: new Date("2024-02-28T02:36:07.300Z"), + createdAt: new Date("2025-04-06T11:35:34.778Z"), + modifiedAt: new Date("2025-02-27T02:36:07.300Z"), id: "", description: "overburden mountain wrongly plan psst promptly ha", selectable: false, @@ -107,10 +107,10 @@ let value: WebhookSubscriptionUpdatedPayload = { checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2023-12-27T17:49:51.811Z"), + lastModifiedAt: new Date("2024-12-26T17:49:51.811Z"), version: "", isUploaded: false, - createdAt: new Date("2024-07-22T01:12:42.157Z"), + createdAt: new Date("2025-07-22T01:12:42.157Z"), sizeReadable: "", publicUrl: "https://smart-overcoat.org/", }, @@ -119,8 +119,8 @@ let value: WebhookSubscriptionUpdatedPayload = { { customFieldId: "", customField: { - createdAt: new Date("2022-06-19T02:07:21.588Z"), - modifiedAt: new Date("2022-12-09T02:01:52.269Z"), + createdAt: new Date("2023-06-19T02:07:21.588Z"), + modifiedAt: new Date("2023-12-09T02:01:52.269Z"), id: "", metadata: { "key": "", @@ -136,8 +136,8 @@ let value: WebhookSubscriptionUpdatedPayload = { ], }, price: { - createdAt: new Date("2024-01-04T23:23:29.876Z"), - modifiedAt: new Date("2022-08-26T03:38:10.416Z"), + createdAt: new Date("2025-01-03T23:23:29.876Z"), + modifiedAt: new Date("2023-08-26T03:38:10.416Z"), id: "", isArchived: false, productId: "", @@ -148,16 +148,16 @@ let value: WebhookSubscriptionUpdatedPayload = { durationInMonths: 649373, type: "percentage", basisPoints: 283557, - createdAt: new Date("2022-11-10T14:49:35.672Z"), - modifiedAt: new Date("2022-12-10T12:12:48.348Z"), + createdAt: new Date("2023-11-10T14:49:35.672Z"), + modifiedAt: new Date("2023-12-10T12:12:48.348Z"), id: "", metadata: { "key": "", }, name: "", code: "", - startsAt: new Date("2024-09-15T12:11:57.238Z"), - endsAt: new Date("2024-07-29T19:18:16.265Z"), + startsAt: new Date("2025-09-15T12:11:57.238Z"), + endsAt: new Date("2025-07-29T19:18:16.265Z"), maxRedemptions: 461639, redemptionsCount: 367251, organizationId: "", @@ -168,7 +168,7 @@ let value: WebhookSubscriptionUpdatedPayload = { ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------------------------- | -| `type` | [components.WebhookSubscriptionUpdatedPayloadType](../../models/components/webhooksubscriptionupdatedpayloadtype.md) | :heavy_check_mark: | N/A | -| `data` | [components.Subscription](../../models/components/subscription.md) | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | ------------------------------------------------------------------ | +| `type` | *string* | :heavy_check_mark: | N/A | +| `data` | [components.Subscription](../../models/components/subscription.md) | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/components/webhooksubscriptionupdatedpayloadtype.md b/docs/models/components/webhooksubscriptionupdatedpayloadtype.md deleted file mode 100644 index ea80fef8..00000000 --- a/docs/models/components/webhooksubscriptionupdatedpayloadtype.md +++ /dev/null @@ -1,15 +0,0 @@ -# WebhookSubscriptionUpdatedPayloadType - -## Example Usage - -```typescript -import { WebhookSubscriptionUpdatedPayloadType } from "@polar-sh/sdk/models/components"; - -let value: WebhookSubscriptionUpdatedPayloadType = "subscription.updated"; -``` - -## Values - -```typescript -"subscription.updated" -``` \ No newline at end of file diff --git a/docs/models/errors/alreadycanceledsubscription.md b/docs/models/errors/alreadycanceledsubscription.md index 0285d0d4..f39bf071 100644 --- a/docs/models/errors/alreadycanceledsubscription.md +++ b/docs/models/errors/alreadycanceledsubscription.md @@ -10,7 +10,7 @@ import { AlreadyCanceledSubscription } from "@polar-sh/sdk/models/errors"; ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------- | -------------------------------------------------------------------------------------------------- | -| `error` | [errors.AlreadyCanceledSubscriptionError](../../models/errors/alreadycanceledsubscriptionerror.md) | :heavy_check_mark: | N/A | -| `detail` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------ | ------------------ | ------------------ | ------------------ | +| `error` | *string* | :heavy_check_mark: | N/A | +| `detail` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/errors/alreadycanceledsubscriptionerror.md b/docs/models/errors/alreadycanceledsubscriptionerror.md deleted file mode 100644 index fa24ad88..00000000 --- a/docs/models/errors/alreadycanceledsubscriptionerror.md +++ /dev/null @@ -1,15 +0,0 @@ -# AlreadyCanceledSubscriptionError - -## Example Usage - -```typescript -import { AlreadyCanceledSubscriptionError } from "@polar-sh/sdk/models/errors"; - -let value: AlreadyCanceledSubscriptionError = "AlreadyCanceledSubscription"; -``` - -## Values - -```typescript -"AlreadyCanceledSubscription" -``` \ No newline at end of file diff --git a/docs/models/errors/errort.md b/docs/models/errors/errort.md deleted file mode 100644 index 29db9add..00000000 --- a/docs/models/errors/errort.md +++ /dev/null @@ -1,15 +0,0 @@ -# ErrorT - -## Example Usage - -```typescript -import { ErrorT } from "@polar-sh/sdk/models/errors"; - -let value: ErrorT = "ResourceNotFound"; -``` - -## Values - -```typescript -"ResourceNotFound" -``` \ No newline at end of file diff --git a/docs/models/errors/notpermitted.md b/docs/models/errors/notpermitted.md index 657ee36d..427971b6 100644 --- a/docs/models/errors/notpermitted.md +++ b/docs/models/errors/notpermitted.md @@ -10,7 +10,7 @@ import { NotPermitted } from "@polar-sh/sdk/models/errors"; ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------- | -------------------------------------------------------------------- | -------------------------------------------------------------------- | -------------------------------------------------------------------- | -| `error` | [errors.NotPermittedError](../../models/errors/notpermittederror.md) | :heavy_check_mark: | N/A | -| `detail` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------ | ------------------ | ------------------ | ------------------ | +| `error` | *string* | :heavy_check_mark: | N/A | +| `detail` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/errors/notpermittederror.md b/docs/models/errors/notpermittederror.md deleted file mode 100644 index f9a06326..00000000 --- a/docs/models/errors/notpermittederror.md +++ /dev/null @@ -1,15 +0,0 @@ -# NotPermittedError - -## Example Usage - -```typescript -import { NotPermittedError } from "@polar-sh/sdk/models/errors"; - -let value: NotPermittedError = "NotPermitted"; -``` - -## Values - -```typescript -"NotPermitted" -``` \ No newline at end of file diff --git a/docs/models/errors/resourcenotfound.md b/docs/models/errors/resourcenotfound.md index ca4395f3..272ad26e 100644 --- a/docs/models/errors/resourcenotfound.md +++ b/docs/models/errors/resourcenotfound.md @@ -10,7 +10,7 @@ import { ResourceNotFound } from "@polar-sh/sdk/models/errors"; ## Fields -| Field | Type | Required | Description | -| ---------------------------------------------- | ---------------------------------------------- | ---------------------------------------------- | ---------------------------------------------- | -| `error` | [errors.ErrorT](../../models/errors/errort.md) | :heavy_check_mark: | N/A | -| `detail` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------ | ------------------ | ------------------ | ------------------ | +| `error` | *string* | :heavy_check_mark: | N/A | +| `detail` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/errors/unauthorized.md b/docs/models/errors/unauthorized.md index df5fbb33..8fb5be44 100644 --- a/docs/models/errors/unauthorized.md +++ b/docs/models/errors/unauthorized.md @@ -10,7 +10,7 @@ import { Unauthorized } from "@polar-sh/sdk/models/errors"; ## Fields -| Field | Type | Required | Description | -| -------------------------------------------------------------------- | -------------------------------------------------------------------- | -------------------------------------------------------------------- | -------------------------------------------------------------------- | -| `error` | [errors.UnauthorizedError](../../models/errors/unauthorizederror.md) | :heavy_check_mark: | N/A | -| `detail` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file +| Field | Type | Required | Description | +| ------------------ | ------------------ | ------------------ | ------------------ | +| `error` | *string* | :heavy_check_mark: | N/A | +| `detail` | *string* | :heavy_check_mark: | N/A | \ No newline at end of file diff --git a/docs/models/errors/unauthorizederror.md b/docs/models/errors/unauthorizederror.md deleted file mode 100644 index 8d6cf8cc..00000000 --- a/docs/models/errors/unauthorizederror.md +++ /dev/null @@ -1,15 +0,0 @@ -# UnauthorizedError - -## Example Usage - -```typescript -import { UnauthorizedError } from "@polar-sh/sdk/models/errors"; - -let value: UnauthorizedError = "Unauthorized"; -``` - -## Values - -```typescript -"Unauthorized" -``` \ No newline at end of file diff --git a/docs/models/operations/advertisementslistresponse.md b/docs/models/operations/advertisementslistresponse.md index 8985cdb4..980813b3 100644 --- a/docs/models/operations/advertisementslistresponse.md +++ b/docs/models/operations/advertisementslistresponse.md @@ -9,21 +9,21 @@ let value: AdvertisementsListResponse = { result: { items: [ { - createdAt: new Date("2023-09-10T00:03:37.019Z"), - modifiedAt: new Date("2024-11-20T14:19:41.572Z"), + createdAt: new Date("2023-07-02T16:15:14.675Z"), + modifiedAt: new Date("2025-04-12T07:16:10.826Z"), id: "", - imageUrl: "https://dense-programme.name/", - imageUrlDark: "https://chubby-monasticism.info/", + imageUrl: "https://stale-zen.net", + imageUrlDark: "https://rundown-reward.info", text: "", - linkUrl: "https://frivolous-gym.biz", + linkUrl: "https://elastic-airbus.net/", }, ], pagination: { - totalCount: 200932, - maxPage: 508014, + totalCount: 349556, + maxPage: 758592, }, dimensions: [ - 829139, + 130229, ], }, }; diff --git a/docs/models/operations/benefitsgrantsresponse.md b/docs/models/operations/benefitsgrantsresponse.md index 36248c67..79267b3a 100644 --- a/docs/models/operations/benefitsgrantsresponse.md +++ b/docs/models/operations/benefitsgrantsresponse.md @@ -9,8 +9,8 @@ let value: BenefitsGrantsResponse = { result: { items: [ { - createdAt: new Date("2022-12-04T15:27:18.312Z"), - modifiedAt: new Date("2022-02-02T13:50:21.161Z"), + createdAt: new Date("2025-09-25T11:00:47.759Z"), + modifiedAt: new Date("2024-07-26T07:43:54.459Z"), id: "", isGranted: false, isRevoked: false, @@ -19,12 +19,33 @@ let value: BenefitsGrantsResponse = { customerId: "", userId: "", benefitId: "", - properties: {}, + customer: { + createdAt: new Date("2025-01-21T21:27:26.400Z"), + modifiedAt: new Date("2024-07-11T13:24:15.441Z"), + id: "", + metadata: { + "key": 980995, + }, + email: "Maxime45@yahoo.com", + emailVerified: false, + name: "", + billingAddress: { + country: "United Arab Emirates", + }, + taxId: [ + "", + ], + organizationId: "", + avatarUrl: "https://kosher-aftermath.info/", + }, + properties: { + advertisementCampaignId: "", + }, }, ], pagination: { - totalCount: 428795, - maxPage: 99307, + totalCount: 883267, + maxPage: 963239, }, }, }; diff --git a/docs/models/operations/benefitslistresponse.md b/docs/models/operations/benefitslistresponse.md index 28a47723..8ae55468 100644 --- a/docs/models/operations/benefitslistresponse.md +++ b/docs/models/operations/benefitslistresponse.md @@ -9,23 +9,30 @@ let value: BenefitsListResponse = { result: { items: [ { - createdAt: new Date("2022-01-26T22:48:01.116Z"), - modifiedAt: new Date("2023-04-26T19:37:47.188Z"), + createdAt: new Date("2024-02-01T21:53:59.428Z"), + modifiedAt: new Date("2023-04-20T02:33:09.911Z"), id: "", - description: "till so yuck except", + description: "except furthermore stranger than", selectable: false, deletable: false, organizationId: "", properties: { - guildId: "", - roleId: "", - guildToken: "", + prefix: "", + expires: { + ttl: 745815, + timeframe: "day", + }, + activations: { + limit: 220474, + enableCustomerAdmin: false, + }, + limitUsage: 361381, }, }, ], pagination: { - totalCount: 651972, - maxPage: 315542, + totalCount: 552589, + maxPage: 336087, }, }, }; diff --git a/docs/models/operations/benefitsupdatebenefitupdate.md b/docs/models/operations/benefitsupdatebenefitupdate.md index d5aa7117..45fc7e74 100644 --- a/docs/models/operations/benefitsupdatebenefitupdate.md +++ b/docs/models/operations/benefitsupdatebenefitupdate.md @@ -28,7 +28,7 @@ const value: components.BenefitGitHubRepositoryUpdate = { properties: { repositoryOwner: "polarsource", repositoryName: "private_repo", - permission: "pull", + permission: "admin", }, }; ``` diff --git a/docs/models/operations/benefitsupdaterequest.md b/docs/models/operations/benefitsupdaterequest.md index ee2f7231..83d15ac1 100644 --- a/docs/models/operations/benefitsupdaterequest.md +++ b/docs/models/operations/benefitsupdaterequest.md @@ -7,7 +7,13 @@ import { BenefitsUpdateRequest } from "@polar-sh/sdk/models/operations"; let value: BenefitsUpdateRequest = { id: "", - requestBody: {}, + requestBody: { + properties: { + repositoryOwner: "polarsource", + repositoryName: "private_repo", + permission: "pull", + }, + }, }; ``` diff --git a/docs/models/operations/checkoutlinkslistresponse.md b/docs/models/operations/checkoutlinkslistresponse.md index 403f69cd..e4954bad 100644 --- a/docs/models/operations/checkoutlinkslistresponse.md +++ b/docs/models/operations/checkoutlinkslistresponse.md @@ -9,49 +9,47 @@ let value: CheckoutLinksListResponse = { result: { items: [ { - createdAt: new Date("2022-03-01T00:27:19.326Z"), - modifiedAt: new Date("2024-06-08T19:11:06.560Z"), + createdAt: new Date("2024-06-29T12:39:44.029Z"), + modifiedAt: new Date("2023-01-17T07:46:40.038Z"), id: "", metadata: { "key": false, }, + paymentProcessor: "stripe", clientSecret: "", - successUrl: "https://irresponsible-kinase.info", + successUrl: "https://perfumed-premeditation.com", label: "", allowDiscountCodes: false, productId: "", productPriceId: "", discountId: "", product: { - createdAt: new Date("2023-07-14T08:53:09.254Z"), - modifiedAt: new Date("2024-06-12T15:23:06.895Z"), + createdAt: new Date("2025-02-01T12:07:52.157Z"), + modifiedAt: new Date("2023-04-03T01:32:48.709Z"), id: "", name: "", - description: - "card hmph how uselessly portray faint ferociously beyond qua", + description: "weakly aw unless heartache heartfelt", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2022-07-20T12:08:42.008Z"), - modifiedAt: new Date("2023-08-28T10:00:00.988Z"), + createdAt: new Date("2023-02-02T00:46:51.716Z"), + modifiedAt: new Date("2023-07-09T18:22:31.091Z"), id: "", isArchived: false, productId: "", - priceCurrency: "", - priceAmount: 284483, - recurringInterval: "month", + recurringInterval: "year", }, ], benefits: [ { - createdAt: new Date("2024-05-10T23:33:33.951Z"), - modifiedAt: new Date("2023-09-02T08:37:51.173Z"), + createdAt: new Date("2025-03-25T18:58:01.050Z"), + modifiedAt: new Date("2025-07-23T04:21:06.226Z"), id: "", - type: "license_keys", + type: "downloadables", description: - "without upon table amid midst always jealously excitedly", + "shiny declaration athwart brr miskey recommendation yowza reiterate if meanwhile", selectable: false, deletable: false, organizationId: "", @@ -62,58 +60,56 @@ let value: CheckoutLinksListResponse = { id: "", organizationId: "", name: "", - path: "/etc/namedb", + path: "/var/mail", mimeType: "", - size: 143096, + size: 414720, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-08-13T06:17:28.680Z"), + lastModifiedAt: new Date("2023-01-12T14:30:26.716Z"), version: "", isUploaded: false, - createdAt: new Date("2023-04-03T02:58:06.798Z"), + createdAt: new Date("2023-08-07T08:13:47.825Z"), sizeReadable: "", - publicUrl: "https://exotic-term.name/", + publicUrl: "https://haunting-status.info", }, ], }, productPrice: { - createdAt: new Date("2024-09-27T13:25:44.103Z"), - modifiedAt: new Date("2022-08-13T11:19:58.638Z"), + createdAt: new Date("2023-03-21T05:28:53.838Z"), + modifiedAt: new Date("2025-08-18T01:01:53.905Z"), id: "", isArchived: false, productId: "", - priceCurrency: "", - priceAmount: 65329, - recurringInterval: "year", + recurringInterval: "month", }, discount: { duration: "once", - durationInMonths: 605091, - type: "fixed", - amount: 157070, - currency: "Mauritius Rupee", - createdAt: new Date("2024-01-02T06:51:40.408Z"), - modifiedAt: new Date("2024-01-31T09:06:03.992Z"), + durationInMonths: 594407, + type: "percentage", + amount: 352419, + currency: "Danish Krone", + createdAt: new Date("2023-09-29T10:14:16.977Z"), + modifiedAt: new Date("2023-04-10T18:30:00.576Z"), id: "", metadata: { "key": "", }, name: "", code: "", - startsAt: new Date("2023-07-23T15:57:25.365Z"), - endsAt: new Date("2023-01-05T21:57:51.624Z"), - maxRedemptions: 926674, - redemptionsCount: 481221, + startsAt: new Date("2024-12-07T01:02:09.495Z"), + endsAt: new Date("2025-02-20T22:33:52.566Z"), + maxRedemptions: 416604, + redemptionsCount: 943644, organizationId: "", }, - url: "https://multicolored-zebra.org", + url: "https://second-haircut.biz/", }, ], pagination: { - totalCount: 987408, - maxPage: 240387, + totalCount: 194648, + maxPage: 167613, }, }, }; diff --git a/docs/models/operations/checkoutscustomlistresponse.md b/docs/models/operations/checkoutscustomlistresponse.md index 3db8a6c2..bc793e98 100644 --- a/docs/models/operations/checkoutscustomlistresponse.md +++ b/docs/models/operations/checkoutscustomlistresponse.md @@ -9,20 +9,21 @@ let value: CheckoutsCustomListResponse = { result: { items: [ { - createdAt: new Date("2024-06-11T09:05:14.093Z"), - modifiedAt: new Date("2023-05-27T23:48:56.996Z"), + createdAt: new Date("2025-01-02T09:18:02.838Z"), + modifiedAt: new Date("2024-11-15T02:48:54.405Z"), id: "", - status: "open", + paymentProcessor: "stripe", + status: "succeeded", clientSecret: "", - url: "https://hollow-blowgun.info/", - expiresAt: new Date("2024-11-17T07:20:20.409Z"), - successUrl: "https://willing-midwife.com", + url: "https://shimmering-bungalow.net", + expiresAt: new Date("2025-06-27T16:57:19.473Z"), + successUrl: "https://gleaming-countess.com/", embedOrigin: "", - amount: 226988, - taxAmount: 186365, - currency: "Colombian Peso", - subtotalAmount: 888343, - totalAmount: 204017, + amount: 868686, + taxAmount: 537619, + currency: "Solomon Islands Dollar", + subtotalAmount: 217602, + totalAmount: 124657, productId: "", productPriceId: "", discountId: "", @@ -34,41 +35,45 @@ let value: CheckoutsCustomListResponse = { isPaymentFormRequired: false, customerId: "", customerName: "", - customerEmail: "Augusta_White43@yahoo.com", + customerEmail: "Rosario44@gmail.com", customerIpAddress: "", customerBillingAddress: { - country: "Wallis and Futuna", + country: "Romania", }, customerTaxId: "", paymentProcessorMetadata: {}, metadata: { - "key": 544554, + "key": 897201, }, product: { - createdAt: new Date("2022-03-24T15:56:51.260Z"), - modifiedAt: new Date("2022-11-03T09:06:30.437Z"), + createdAt: new Date("2023-12-13T02:41:01.266Z"), + modifiedAt: new Date("2025-04-02T06:32:43.364Z"), id: "", name: "", - description: "mmm unless respray connect whenever", + description: + "outgoing purple geez since apropos robust without upon table", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2022-02-05T01:40:30.252Z"), - modifiedAt: new Date("2022-01-25T04:32:31.394Z"), + createdAt: new Date("2023-11-04T13:06:12.786Z"), + modifiedAt: new Date("2024-03-15T02:47:24.650Z"), id: "", isArchived: false, productId: "", + priceCurrency: "", + priceAmount: 407058, + recurringInterval: "year", }, ], benefits: [ { - createdAt: new Date("2023-11-24T08:52:06.134Z"), - modifiedAt: new Date("2022-05-21T01:42:30.363Z"), + createdAt: new Date("2023-05-07T04:54:40.908Z"), + modifiedAt: new Date("2023-05-04T10:00:03.073Z"), id: "", - type: "github_repository", - description: "broken since nab", + type: "ads", + description: "status yippee after sundae", selectable: false, deletable: false, organizationId: "", @@ -79,38 +84,38 @@ let value: CheckoutsCustomListResponse = { id: "", organizationId: "", name: "", - path: "/lib", + path: "/opt/sbin", mimeType: "", - size: 498711, + size: 362677, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-10-11T05:12:55.893Z"), + lastModifiedAt: new Date("2023-09-27T00:40:29.017Z"), version: "", isUploaded: false, - createdAt: new Date("2022-08-10T01:37:49.523Z"), + createdAt: new Date("2025-09-18T18:45:50.627Z"), sizeReadable: "", - publicUrl: "https://winged-invite.org", + publicUrl: "https://grubby-couch.org", }, ], }, productPrice: { - createdAt: new Date("2022-01-04T03:36:40.213Z"), - modifiedAt: new Date("2022-10-25T00:03:32.852Z"), + createdAt: new Date("2024-11-22T01:36:41.126Z"), + modifiedAt: new Date("2023-10-31T16:41:22.925Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - minimumAmount: 916633, - maximumAmount: 415447, - presetAmount: 463038, - recurringInterval: "month", + priceAmount: 177892, + recurringInterval: "year", }, discount: { - duration: "forever", + duration: "once", + durationInMonths: 574457, type: "percentage", - basisPoints: 63427, + amount: 693777, + currency: "Egyptian Pound", id: "", name: "", code: "", @@ -120,36 +125,29 @@ let value: CheckoutsCustomListResponse = { { customFieldId: "", customField: { - createdAt: new Date("2023-08-09T14:47:20.206Z"), - modifiedAt: new Date("2024-12-03T00:44:17.794Z"), + createdAt: new Date("2024-01-05T21:57:51.624Z"), + modifiedAt: new Date("2025-10-12T15:13:45.035Z"), id: "", metadata: { - "key": false, + "key": 570553, }, slug: "", name: "", organizationId: "", - properties: { - options: [ - { - value: "", - label: "", - }, - ], - }, + properties: {}, }, - order: 345445, + order: 531387, required: false, }, ], customerMetadata: { - "key": 660278, + "key": false, }, }, ], pagination: { - totalCount: 458447, - maxPage: 554611, + totalCount: 895939, + maxPage: 987408, }, }, }; diff --git a/docs/models/operations/customerportalbenefitgrantslistresponse.md b/docs/models/operations/customerportalbenefitgrantslistresponse.md index 8ece3a46..e74f1d0a 100644 --- a/docs/models/operations/customerportalbenefitgrantslistresponse.md +++ b/docs/models/operations/customerportalbenefitgrantslistresponse.md @@ -9,63 +9,75 @@ let value: CustomerPortalBenefitGrantsListResponse = { result: { items: [ { - createdAt: new Date("2024-04-10T01:39:52.504Z"), - modifiedAt: new Date("2024-10-22T20:05:01.882Z"), + createdAt: new Date("2023-03-26T15:21:43.295Z"), + modifiedAt: new Date("2024-06-30T02:18:36.520Z"), id: "", - grantedAt: new Date("2024-05-16T05:43:28.083Z"), - revokedAt: new Date("2022-12-07T08:40:22.698Z"), + grantedAt: new Date("2025-05-09T22:10:56.397Z"), + revokedAt: new Date("2024-12-13T21:12:16.851Z"), customerId: "", benefitId: "", subscriptionId: "", orderId: "", isGranted: false, isRevoked: false, + customer: { + createdAt: new Date("2025-12-23T06:42:41.549Z"), + modifiedAt: new Date("2025-04-25T01:05:15.633Z"), + id: "", + email: "Hannah_Hoeger33@hotmail.com", + emailVerified: false, + name: "", + billingAddress: { + country: "Madagascar", + }, + taxId: [ + "br_cnpj", + ], + oauthAccounts: { + "key": { + accountId: "", + accountUsername: "", + }, + }, + }, benefit: { - createdAt: new Date("2022-05-11T09:25:22.123Z"), - modifiedAt: new Date("2022-02-13T14:07:36.704Z"), + createdAt: new Date("2025-04-19T21:02:01.154Z"), + modifiedAt: new Date("2024-07-10T15:52:40.789Z"), id: "", - description: "pish heavily weakly aw unless heartache", + description: "circa around underneath yowza guide hence negative", selectable: false, deletable: false, organizationId: "", organization: { - createdAt: new Date("2024-01-21T22:27:17.016Z"), - modifiedAt: new Date("2023-02-24T13:40:14.894Z"), + createdAt: new Date("2024-09-01T04:24:59.727Z"), + modifiedAt: new Date("2023-08-11T11:47:49.202Z"), id: "", name: "", slug: "", - avatarUrl: "https://optimal-sightseeing.name", + avatarUrl: "https://noted-postbox.info/", bio: "", - company: "Howell and Sons", + company: "Hane Inc", blog: "", location: "", - email: "Chad77@gmail.com", + email: "Rose.Wisoky49@yahoo.com", twitterUsername: "", - pledgeMinimumAmount: 919857, + pledgeMinimumAmount: 477431, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 420942, + defaultUpfrontSplitToContributors: 399266, profileSettings: {}, featureSettings: {}, }, properties: { - prefix: "", - expires: { - ttl: 788509, - timeframe: "year", - }, - activations: { - limit: 928743, - enableCustomerAdmin: false, - }, - limitUsage: 997164, + repositoryOwner: "polarsource", + repositoryName: "private_repo", }, }, properties: {}, }, ], pagination: { - totalCount: 734579, - maxPage: 334548, + totalCount: 374779, + maxPage: 299514, }, }, }; diff --git a/docs/models/operations/customerportaldownloadableslistresponse.md b/docs/models/operations/customerportaldownloadableslistresponse.md index 9cd28ba4..69430304 100644 --- a/docs/models/operations/customerportaldownloadableslistresponse.md +++ b/docs/models/operations/customerportaldownloadableslistresponse.md @@ -15,28 +15,28 @@ let value: CustomerPortalDownloadablesListResponse = { id: "", organizationId: "", name: "", - path: "/boot", + path: "/usr/local/src", mimeType: "", - size: 410001, + size: 451001, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2023-07-13T23:57:26.668Z"), + lastModifiedAt: new Date("2023-10-12T16:44:39.135Z"), download: { - url: "https://eminent-gym.net", - expiresAt: new Date("2024-05-02T05:31:54.972Z"), + url: "https://cultivated-unique.name/", + expiresAt: new Date("2023-10-15T14:45:48.682Z"), }, version: "", isUploaded: false, - service: "organization_avatar", + service: "downloadable", sizeReadable: "", }, }, ], pagination: { - totalCount: 16754, - maxPage: 675549, + totalCount: 993475, + maxPage: 644684, }, }, }; diff --git a/docs/models/operations/customerportallicensekeyslistresponse.md b/docs/models/operations/customerportallicensekeyslistresponse.md index 282b8452..a0fdec68 100644 --- a/docs/models/operations/customerportallicensekeyslistresponse.md +++ b/docs/models/operations/customerportallicensekeyslistresponse.md @@ -15,43 +15,43 @@ let value: CustomerPortalLicenseKeysListResponse = { customerId: "", user: { id: "", - email: "Luna67@gmail.com", + email: "Philip_Ortiz14@gmail.com", publicName: "", }, customer: { - createdAt: new Date("2023-01-02T17:03:51.334Z"), - modifiedAt: new Date("2022-03-11T18:33:07.848Z"), + createdAt: new Date("2025-04-07T19:39:30.908Z"), + modifiedAt: new Date("2023-09-20T15:54:20.278Z"), id: "", metadata: { "key": false, }, - email: "Rico_Swift@yahoo.com", + email: "Werner41@gmail.com", emailVerified: false, name: "", billingAddress: { - country: "Dominica", + country: "Andorra", }, taxId: [ - "th_vat", + "jp_trn", ], organizationId: "", - avatarUrl: "https://shoddy-fisherman.org/", + avatarUrl: "https://waterlogged-hepatitis.com", }, benefitId: "", key: "", displayKey: "", status: "granted", - limitActivations: 580303, - usage: 130247, - limitUsage: 883330, - validations: 136012, - lastValidatedAt: new Date("2023-12-12T02:42:16.684Z"), - expiresAt: new Date("2022-09-05T05:28:52.147Z"), + limitActivations: 473214, + usage: 575300, + limitUsage: 351869, + validations: 488006, + lastValidatedAt: new Date("2023-05-19T22:17:21.271Z"), + expiresAt: new Date("2023-06-27T10:23:07.802Z"), }, ], pagination: { - totalCount: 756640, - maxPage: 184194, + totalCount: 903528, + maxPage: 177033, }, }, }; diff --git a/docs/models/operations/customerportalorderslistqueryparamproductpricetypefilter.md b/docs/models/operations/customerportalorderslistqueryparamproductpricetypefilter.md index 9a31ecbd..14837997 100644 --- a/docs/models/operations/customerportalorderslistqueryparamproductpricetypefilter.md +++ b/docs/models/operations/customerportalorderslistqueryparamproductpricetypefilter.md @@ -15,7 +15,7 @@ const value: components.ProductPriceType = "recurring"; ```typescript const value: components.ProductPriceType[] = [ - "recurring", + "one_time", ]; ``` diff --git a/docs/models/operations/customerportalorderslistresponse.md b/docs/models/operations/customerportalorderslistresponse.md index d1201629..d81ca82c 100644 --- a/docs/models/operations/customerportalorderslistresponse.md +++ b/docs/models/operations/customerportalorderslistresponse.md @@ -9,46 +9,45 @@ let value: CustomerPortalOrdersListResponse = { result: { items: [ { - createdAt: new Date("2024-02-16T17:16:46.367Z"), - modifiedAt: new Date("2023-07-25T14:04:05.326Z"), + createdAt: new Date("2025-11-06T05:51:47.281Z"), + modifiedAt: new Date("2023-04-17T22:03:33.923Z"), id: "", - amount: 556542, - taxAmount: 604432, - currency: "Danish Krone", + amount: 230217, + taxAmount: 299227, + currency: "Forint", customerId: "", productId: "", productPriceId: "", subscriptionId: "", userId: "", product: { - createdAt: new Date("2023-09-24T00:28:40.141Z"), - modifiedAt: new Date("2022-10-17T04:01:55.543Z"), + createdAt: new Date("2023-04-16T17:08:57.790Z"), + modifiedAt: new Date("2023-06-19T12:29:53.961Z"), id: "", name: "", - description: "meanwhile unaccountably between against provider", + description: + "ride quit indeed tooth above absentmindedly ouch nor unless", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2022-08-02T08:02:13.737Z"), - modifiedAt: new Date("2022-07-03T16:53:40.680Z"), + createdAt: new Date("2024-12-08T16:10:07.436Z"), + modifiedAt: new Date("2024-12-04T07:36:09.332Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - priceAmount: 977856, - recurringInterval: "month", + priceAmount: 414709, }, ], benefits: [ { - createdAt: new Date("2023-10-29T12:28:00.902Z"), - modifiedAt: new Date("2023-04-19T21:02:57.554Z"), + createdAt: new Date("2024-11-18T08:24:51.450Z"), + modifiedAt: new Date("2024-03-03T07:12:01.015Z"), id: "", - type: "downloadables", - description: - "meanwhile actual uh-huh triumphantly amongst affectionate although meh gnaw", + type: "license_keys", + description: "frenetically print technologist violin gorgeous if", selectable: false, deletable: false, organizationId: "", @@ -59,61 +58,66 @@ let value: CustomerPortalOrdersListResponse = { id: "", organizationId: "", name: "", - path: "/private/var", + path: "/mnt", mimeType: "", - size: 81302, + size: 502849, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-12-22T06:34:42.486Z"), + lastModifiedAt: new Date("2023-02-15T18:47:12.706Z"), version: "", isUploaded: false, - createdAt: new Date("2024-09-30T13:17:31.050Z"), + createdAt: new Date("2025-06-30T15:21:44.204Z"), sizeReadable: "", - publicUrl: "https://parallel-testimonial.info", + publicUrl: "https://close-warming.biz", }, ], organization: { - createdAt: new Date("2024-10-24T14:54:44.299Z"), - modifiedAt: new Date("2024-11-02T16:11:07.950Z"), + createdAt: new Date("2023-09-12T20:59:04.584Z"), + modifiedAt: new Date("2025-08-08T17:52:44.076Z"), id: "", name: "", slug: "", - avatarUrl: "https://avaricious-switchboard.org", + avatarUrl: "https://magnificent-swath.info", bio: "", - company: "Kozey, Greenfelder and Bogisich", + company: "Reichert - Gislason", blog: "", location: "", - email: "Misty_Runte@hotmail.com", + email: "Tod59@gmail.com", twitterUsername: "", - pledgeMinimumAmount: 814171, + pledgeMinimumAmount: 946286, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 734276, + defaultUpfrontSplitToContributors: 709877, profileSettings: {}, featureSettings: {}, }, }, productPrice: { - createdAt: new Date("2022-03-15T08:15:52.537Z"), - modifiedAt: new Date("2024-06-24T09:02:21.407Z"), + createdAt: new Date("2025-04-27T21:01:21.314Z"), + modifiedAt: new Date("2023-02-06T13:50:17.641Z"), id: "", isArchived: false, productId: "", + priceCurrency: "", + minimumAmount: 879959, + maximumAmount: 672564, + presetAmount: 237147, + recurringInterval: "month", }, subscription: { - createdAt: new Date("2022-04-05T03:50:46.744Z"), - modifiedAt: new Date("2024-06-20T08:33:00.204Z"), + createdAt: new Date("2023-02-01T20:40:14.607Z"), + modifiedAt: new Date("2023-03-19T06:56:52.426Z"), id: "", - amount: 317088, - currency: "Cape Verde Escudo", + amount: 550269, + currency: "Djibouti Franc", recurringInterval: "month", - status: "incomplete", - currentPeriodStart: new Date("2023-07-01T02:18:36.520Z"), - currentPeriodEnd: new Date("2024-05-09T22:10:56.397Z"), + status: "unpaid", + currentPeriodStart: new Date("2024-12-16T14:56:41.104Z"), + currentPeriodEnd: new Date("2023-02-17T10:35:03.330Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2023-12-14T21:12:16.851Z"), - endedAt: new Date("2024-12-23T06:42:41.549Z"), + startedAt: new Date("2023-11-21T16:58:57.381Z"), + endedAt: new Date("2023-07-20T12:23:36.438Z"), customerId: "", productId: "", priceId: "", @@ -123,8 +127,8 @@ let value: CustomerPortalOrdersListResponse = { }, ], pagination: { - totalCount: 771027, - maxPage: 728290, + totalCount: 958209, + maxPage: 306241, }, }, }; diff --git a/docs/models/operations/customerportalsubscriptionslistresponse.md b/docs/models/operations/customerportalsubscriptionslistresponse.md index 5af0ddbd..58521976 100644 --- a/docs/models/operations/customerportalsubscriptionslistresponse.md +++ b/docs/models/operations/customerportalsubscriptionslistresponse.md @@ -9,18 +9,18 @@ let value: CustomerPortalSubscriptionsListResponse = { result: { items: [ { - createdAt: new Date("2023-03-27T19:23:32.284Z"), - modifiedAt: new Date("2022-05-13T09:45:50.507Z"), + createdAt: new Date("2024-10-29T03:30:19.700Z"), + modifiedAt: new Date("2024-07-23T17:16:26.152Z"), id: "", - amount: 379758, - currency: "Trinidad and Tobago Dollar", + amount: 907111, + currency: "UAE Dirham", recurringInterval: "month", - status: "incomplete", - currentPeriodStart: new Date("2023-08-06T08:45:43.654Z"), - currentPeriodEnd: new Date("2023-10-28T18:18:02.027Z"), + status: "incomplete_expired", + currentPeriodStart: new Date("2025-05-06T19:40:45.220Z"), + currentPeriodEnd: new Date("2024-03-02T09:50:18.418Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2022-05-10T16:07:10.579Z"), - endedAt: new Date("2024-04-19T21:02:01.154Z"), + startedAt: new Date("2025-07-06T08:09:01.868Z"), + endedAt: new Date("2024-08-01T21:03:06.067Z"), customerId: "", productId: "", priceId: "", @@ -28,31 +28,34 @@ let value: CustomerPortalSubscriptionsListResponse = { checkoutId: "", userId: "", product: { - createdAt: new Date("2023-07-11T15:52:40.789Z"), - modifiedAt: new Date("2023-10-06T12:04:09.498Z"), + createdAt: new Date("2025-11-07T04:58:21.844Z"), + modifiedAt: new Date("2024-04-29T23:40:43.285Z"), id: "", name: "", - description: "appertain overproduce which", + description: "ceramics plus blah likewise and", isRecurring: false, isArchived: false, organizationId: "", prices: [ { - createdAt: new Date("2023-01-09T15:45:50.642Z"), - modifiedAt: new Date("2024-09-01T08:10:24.577Z"), + createdAt: new Date("2023-11-07T03:08:42.980Z"), + modifiedAt: new Date("2024-05-06T11:17:28.215Z"), id: "", isArchived: false, productId: "", - recurringInterval: "month", + priceCurrency: "", + minimumAmount: 94903, + maximumAmount: 386002, + presetAmount: 617859, }, ], benefits: [ { - createdAt: new Date("2022-06-07T13:45:15.402Z"), - modifiedAt: new Date("2023-04-29T18:28:37.139Z"), + createdAt: new Date("2025-10-17T12:43:49.669Z"), + modifiedAt: new Date("2024-06-30T02:59:06.785Z"), id: "", - type: "custom", - description: "where that advertisement considering now", + type: "ads", + description: "sleet before bravely tankful step-mother anti", selectable: false, deletable: false, organizationId: "", @@ -63,57 +66,56 @@ let value: CustomerPortalSubscriptionsListResponse = { id: "", organizationId: "", name: "", - path: "/opt/include", + path: "/usr/libexec", mimeType: "", - size: 374779, + size: 253262, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-11-25T06:24:50.807Z"), + lastModifiedAt: new Date("2023-11-12T05:07:17.320Z"), version: "", isUploaded: false, - createdAt: new Date("2022-01-25T01:58:27.894Z"), + createdAt: new Date("2025-12-14T06:40:09.825Z"), sizeReadable: "", - publicUrl: "https://known-disposer.biz", + publicUrl: "https://silky-replacement.biz/", }, ], organization: { - createdAt: new Date("2022-06-23T01:36:53.052Z"), - modifiedAt: new Date("2024-11-06T03:12:54.205Z"), + createdAt: new Date("2025-08-25T00:50:34.161Z"), + modifiedAt: new Date("2023-04-08T15:48:04.523Z"), id: "", name: "", slug: "", - avatarUrl: "https://fatal-diver.org", + avatarUrl: "https://abandoned-programme.name", bio: "", - company: "Cruickshank and Sons", + company: "O'Conner LLC", blog: "", location: "", - email: "Marcelle.Conroy75@yahoo.com", + email: "Colleen33@yahoo.com", twitterUsername: "", - pledgeMinimumAmount: 712800, + pledgeMinimumAmount: 946912, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 23055, + defaultUpfrontSplitToContributors: 712252, profileSettings: {}, featureSettings: {}, }, }, price: { - createdAt: new Date("2023-04-15T20:50:15.089Z"), - modifiedAt: new Date("2024-05-21T07:11:51.975Z"), + createdAt: new Date("2024-06-06T21:54:56.557Z"), + modifiedAt: new Date("2023-03-24T00:32:50.154Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - minimumAmount: 410156, - maximumAmount: 687160, - presetAmount: 24047, + priceAmount: 898072, + recurringInterval: "month", }, }, ], pagination: { - totalCount: 917658, - maxPage: 548156, + totalCount: 357041, + maxPage: 453344, }, }, }; diff --git a/docs/models/operations/customerslistresponse.md b/docs/models/operations/customerslistresponse.md index f2715a21..9a1b05e3 100644 --- a/docs/models/operations/customerslistresponse.md +++ b/docs/models/operations/customerslistresponse.md @@ -9,28 +9,28 @@ let value: CustomersListResponse = { result: { items: [ { - createdAt: new Date("2024-12-25T02:20:19.631Z"), - modifiedAt: new Date("2022-10-10T12:16:52.345Z"), + createdAt: new Date("2025-09-25T21:09:30.950Z"), + modifiedAt: new Date("2025-10-30T14:04:55.140Z"), id: "", metadata: { - "key": 359870, + "key": 291293, }, - email: "Dewayne28@yahoo.com", + email: "Shane_Schmitt81@gmail.com", emailVerified: false, name: "", billingAddress: { - country: "Mali", + country: "Ghana", }, taxId: [ - "", + "pe_ruc", ], organizationId: "", - avatarUrl: "https://massive-bonfire.com/", + avatarUrl: "https://smoggy-basket.net", }, ], pagination: { - totalCount: 710705, - maxPage: 742004, + totalCount: 85912, + maxPage: 822406, }, }, }; diff --git a/docs/models/operations/customfieldslistresponse.md b/docs/models/operations/customfieldslistresponse.md index df701356..eadb4dfd 100644 --- a/docs/models/operations/customfieldslistresponse.md +++ b/docs/models/operations/customfieldslistresponse.md @@ -9,11 +9,11 @@ let value: CustomFieldsListResponse = { result: { items: [ { - createdAt: new Date("2024-03-02T22:52:48.220Z"), - modifiedAt: new Date("2023-04-04T12:26:13.360Z"), + createdAt: new Date("2024-04-18T21:02:57.554Z"), + modifiedAt: new Date("2025-06-07T19:35:38.599Z"), id: "", metadata: { - "key": 465652, + "key": false, }, slug: "", name: "", @@ -29,8 +29,8 @@ let value: CustomFieldsListResponse = { }, ], pagination: { - totalCount: 765596, - maxPage: 494410, + totalCount: 46738, + maxPage: 641371, }, }, }; diff --git a/docs/models/operations/customfieldtypefilter.md b/docs/models/operations/customfieldtypefilter.md index adf32d03..4c5f4c81 100644 --- a/docs/models/operations/customfieldtypefilter.md +++ b/docs/models/operations/customfieldtypefilter.md @@ -8,14 +8,14 @@ Filter by custom field type. ### `components.CustomFieldType` ```typescript -const value: components.CustomFieldType = "date"; +const value: components.CustomFieldType = "select"; ``` ### `components.CustomFieldType[]` ```typescript const value: components.CustomFieldType[] = [ - "date", + "number", ]; ``` diff --git a/docs/models/operations/discountslistresponse.md b/docs/models/operations/discountslistresponse.md index f830d918..90497a49 100644 --- a/docs/models/operations/discountslistresponse.md +++ b/docs/models/operations/discountslistresponse.md @@ -9,30 +9,31 @@ let value: DiscountsListResponse = { result: { items: [ { - duration: "repeating", - durationInMonths: 364171, + duration: "once", + durationInMonths: 610935, type: "fixed", - basisPoints: 466235, - createdAt: new Date("2024-11-17T08:36:55.539Z"), - modifiedAt: new Date("2023-04-23T13:46:31.465Z"), + basisPoints: 584575, + createdAt: new Date("2024-09-07T16:45:09.899Z"), + modifiedAt: new Date("2025-03-14T14:49:55.703Z"), id: "", metadata: { - "key": false, + "key": "", }, name: "", code: "", - startsAt: new Date("2024-09-23T23:11:43.932Z"), - endsAt: new Date("2024-03-29T05:10:24.186Z"), - maxRedemptions: 202049, - redemptionsCount: 425149, + startsAt: new Date("2024-04-18T19:47:29.352Z"), + endsAt: new Date("2024-09-26T16:42:50.105Z"), + maxRedemptions: 8088, + redemptionsCount: 271660, organizationId: "", products: [ { - createdAt: new Date("2023-12-08T23:04:13.096Z"), - modifiedAt: new Date("2022-10-09T10:28:05.599Z"), + createdAt: new Date("2024-06-16T19:37:34.527Z"), + modifiedAt: new Date("2023-07-17T20:04:23.072Z"), id: "", name: "", - description: "jovially armchair collaborate pfft", + description: + "democratize immaculate packaging for boohoo gosh terrorise official", isRecurring: false, isArchived: false, organizationId: "", @@ -41,8 +42,8 @@ let value: DiscountsListResponse = { }, ], pagination: { - totalCount: 171866, - maxPage: 689614, + totalCount: 50203, + maxPage: 884662, }, }, }; diff --git a/docs/models/operations/externalorganizationslistresponse.md b/docs/models/operations/externalorganizationslistresponse.md index 167d4a9c..56f8ddf7 100644 --- a/docs/models/operations/externalorganizationslistresponse.md +++ b/docs/models/operations/externalorganizationslistresponse.md @@ -9,23 +9,24 @@ let value: ExternalOrganizationsListResponse = { result: { items: [ { - id: "9b8900c4-cb91-416e-b36a-70be99dd26db", + id: "133a344f-fd77-4572-942e-b2650b752748", + platform: "github", name: "", - avatarUrl: "https://joyful-procurement.net/", + avatarUrl: "https://instructive-numeracy.org/", isPersonal: false, bio: "", prettyName: "", - company: "Rath - Murazik", + company: "Hansen - Nolan", blog: "", location: "", - email: "Elliot43@yahoo.com", + email: "Darian_Schuster32@hotmail.com", twitterUsername: "", organizationId: "", }, ], pagination: { - totalCount: 145482, - maxPage: 479962, + totalCount: 429518, + maxPage: 543484, }, }, }; diff --git a/docs/models/operations/fileslistresponse.md b/docs/models/operations/fileslistresponse.md index 8fbd202e..35d8129e 100644 --- a/docs/models/operations/fileslistresponse.md +++ b/docs/models/operations/fileslistresponse.md @@ -12,24 +12,23 @@ let value: FilesListResponse = { id: "", organizationId: "", name: "", - path: "/etc", + path: "/private/tmp", mimeType: "", - size: 594786, + size: 452807, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-01-13T15:19:31.438Z"), + lastModifiedAt: new Date("2025-02-07T20:02:50.033Z"), version: "", isUploaded: false, - createdAt: new Date("2022-08-29T10:19:40.657Z"), + createdAt: new Date("2025-03-02T22:52:48.220Z"), sizeReadable: "", - publicUrl: "https://sorrowful-editor.org", }, ], pagination: { - totalCount: 130265, - maxPage: 473927, + totalCount: 418356, + maxPage: 526689, }, }, }; diff --git a/docs/models/operations/filesupdateresponsefilesupdate.md b/docs/models/operations/filesupdateresponsefilesupdate.md index d7b9af26..52b6072e 100644 --- a/docs/models/operations/filesupdateresponsefilesupdate.md +++ b/docs/models/operations/filesupdateresponsefilesupdate.md @@ -12,17 +12,17 @@ const value: components.DownloadableFileRead = { id: "", organizationId: "", name: "", - path: "/dev", + path: "/sys", mimeType: "", - size: 634463, + size: 291415, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2024-11-30T16:23:05.668Z"), + lastModifiedAt: new Date("2024-01-17T15:00:59.946Z"), version: "", isUploaded: false, - createdAt: new Date("2024-09-27T18:33:14.332Z"), + createdAt: new Date("2024-02-24T16:19:54.015Z"), sizeReadable: "", }; ``` @@ -34,19 +34,19 @@ const value: components.ProductMediaFileRead = { id: "", organizationId: "", name: "", - path: "/bin", + path: "/home/user", mimeType: "", - size: 270207, + size: 206932, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-04-29T01:05:59.299Z"), + lastModifiedAt: new Date("2024-05-17T14:12:14.525Z"), version: "", isUploaded: false, - createdAt: new Date("2023-03-21T10:32:34.816Z"), + createdAt: new Date("2023-05-21T17:17:39.998Z"), sizeReadable: "", - publicUrl: "https://dead-sand.info/", + publicUrl: "https://measly-armchair.info/", }; ``` @@ -57,19 +57,19 @@ const value: components.OrganizationAvatarFileRead = { id: "", organizationId: "", name: "", - path: "/opt/include", + path: "/usr/lib", mimeType: "", - size: 297223, + size: 974257, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-11-11T01:24:16.150Z"), + lastModifiedAt: new Date("2024-07-01T20:45:28.973Z"), version: "", isUploaded: false, - createdAt: new Date("2023-04-06T07:25:07.743Z"), + createdAt: new Date("2023-10-09T19:48:17.819Z"), sizeReadable: "", - publicUrl: "https://milky-procurement.com/", + publicUrl: "https://courageous-tray.net", }; ``` diff --git a/docs/models/operations/filesuploadedrequest.md b/docs/models/operations/filesuploadedrequest.md index 07b87ee6..4c497036 100644 --- a/docs/models/operations/filesuploadedrequest.md +++ b/docs/models/operations/filesuploadedrequest.md @@ -9,10 +9,10 @@ let value: FilesUploadedRequest = { id: "", fileUploadCompleted: { id: "", - path: "/usr/include", + path: "/private", parts: [ { - number: 440191, + number: 765596, checksumEtag: "", checksumSha256Base64: "", }, diff --git a/docs/models/operations/filesuploadedresponsefilesuploaded.md b/docs/models/operations/filesuploadedresponsefilesuploaded.md index ae0fb139..2e26ff68 100644 --- a/docs/models/operations/filesuploadedresponsefilesuploaded.md +++ b/docs/models/operations/filesuploadedresponsefilesuploaded.md @@ -12,17 +12,17 @@ const value: components.DownloadableFileRead = { id: "", organizationId: "", name: "", - path: "/proc", + path: "/private/var", mimeType: "", - size: 474816, + size: 678035, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-02-28T18:14:17.837Z"), + lastModifiedAt: new Date("2025-06-21T03:34:01.976Z"), version: "", isUploaded: false, - createdAt: new Date("2022-12-19T08:16:20.843Z"), + createdAt: new Date("2025-01-13T09:28:29.148Z"), sizeReadable: "", }; ``` @@ -34,19 +34,19 @@ const value: components.ProductMediaFileRead = { id: "", organizationId: "", name: "", - path: "/dev", + path: "/opt", mimeType: "", - size: 760315, + size: 478443, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2023-06-08T10:31:05.437Z"), + lastModifiedAt: new Date("2024-05-25T23:50:00.815Z"), version: "", isUploaded: false, - createdAt: new Date("2023-03-23T05:58:45.443Z"), + createdAt: new Date("2025-11-17T08:36:55.539Z"), sizeReadable: "", - publicUrl: "https://questionable-haversack.com", + publicUrl: "https://unwilling-thorn.net/", }; ``` @@ -57,19 +57,19 @@ const value: components.OrganizationAvatarFileRead = { id: "", organizationId: "", name: "", - path: "/private/tmp", + path: "/home/user", mimeType: "", - size: 192437, + size: 425149, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2023-04-05T18:07:06.210Z"), + lastModifiedAt: new Date("2024-12-07T23:04:13.096Z"), version: "", isUploaded: false, - createdAt: new Date("2024-08-23T07:17:40.744Z"), + createdAt: new Date("2023-10-09T10:28:05.599Z"), sizeReadable: "", - publicUrl: "https://irresponsible-alligator.org/", + publicUrl: "https://long-term-nephew.name/", }; ``` diff --git a/docs/models/operations/licensekeyslistresponse.md b/docs/models/operations/licensekeyslistresponse.md index 47c84ded..8834884d 100644 --- a/docs/models/operations/licensekeyslistresponse.md +++ b/docs/models/operations/licensekeyslistresponse.md @@ -15,43 +15,43 @@ let value: LicenseKeysListResponse = { customerId: "", user: { id: "", - email: "Preston_Hane15@hotmail.com", + email: "Mary.Gerhold-Hessel46@gmail.com", publicName: "", }, customer: { - createdAt: new Date("2022-03-15T19:09:10.567Z"), - modifiedAt: new Date("2022-06-22T14:36:35.854Z"), + createdAt: new Date("2024-09-04T13:28:38.697Z"), + modifiedAt: new Date("2025-06-30T11:25:29.230Z"), id: "", metadata: { - "key": 629747, + "key": 280175, }, - email: "Destany_Kris67@gmail.com", + email: "Katheryn_Heidenreich8@hotmail.com", emailVerified: false, name: "", billingAddress: { - country: "Saint Pierre and Miquelon", + country: "Pitcairn Islands", }, taxId: [ - "", + "id_npwp", ], organizationId: "", - avatarUrl: "https://querulous-fencing.name", + avatarUrl: "https://oval-retrospectivity.org", }, benefitId: "", key: "", displayKey: "", - status: "granted", - limitActivations: 847045, - usage: 952417, - limitUsage: 901839, - validations: 44753, - lastValidatedAt: new Date("2024-07-23T17:59:18.862Z"), - expiresAt: new Date("2024-07-11T21:54:59.517Z"), + status: "disabled", + limitActivations: 310549, + usage: 118971, + limitUsage: 39770, + validations: 390548, + lastValidatedAt: new Date("2023-01-09T04:02:40.519Z"), + expiresAt: new Date("2025-03-19T17:51:10.770Z"), }, ], pagination: { - totalCount: 130669, - maxPage: 720958, + totalCount: 451768, + maxPage: 732230, }, }, }; diff --git a/docs/models/operations/metricsgetrequest.md b/docs/models/operations/metricsgetrequest.md index d55eef95..c4694a98 100644 --- a/docs/models/operations/metricsgetrequest.md +++ b/docs/models/operations/metricsgetrequest.md @@ -7,9 +7,9 @@ import { MetricsGetRequest } from "@polar-sh/sdk/models/operations"; import { RFCDate } from "@polar-sh/sdk/types"; let value: MetricsGetRequest = { - startDate: new RFCDate("2022-04-16"), - endDate: new RFCDate("2022-06-28"), - interval: "year", + startDate: new RFCDate("2025-10-12"), + endDate: new RFCDate("2025-11-13"), + interval: "month", }; ``` diff --git a/docs/models/operations/oauth2authorizeresponseoauth2authorize.md b/docs/models/operations/oauth2authorizeresponseoauth2authorize.md index aebcaea1..276a9198 100644 --- a/docs/models/operations/oauth2authorizeresponseoauth2authorize.md +++ b/docs/models/operations/oauth2authorizeresponseoauth2authorize.md @@ -10,22 +10,22 @@ Successful Response ```typescript const value: components.AuthorizeResponseUser = { client: { - createdAt: new Date("2022-02-07T17:42:25.899Z"), - modifiedAt: new Date("2023-06-16T23:24:38.141Z"), + createdAt: new Date("2025-01-06T17:59:23.766Z"), + modifiedAt: new Date("2023-02-17T03:45:50.562Z"), clientId: "", clientName: "", - clientUri: "https://prickly-yak.com", - logoUri: "https://gleaming-account.name/", - tosUri: "https://infinite-heating.org", - policyUri: "https://fatherly-fat.biz", + clientUri: "https://all-postbox.net", + logoUri: "https://hard-to-find-department.org/", + tosUri: "https://slushy-offset.com/", + policyUri: "https://fatal-strait.biz/", }, sub: { id: "", - email: "Marcia_Gibson86@gmail.com", - avatarUrl: "https://flawed-tusk.com/", + email: "Lolita.Goyette@hotmail.com", + avatarUrl: "https://well-groomed-packaging.org/", }, scopes: [ - "admin", + "license_keys:read", ], }; ``` @@ -35,28 +35,28 @@ const value: components.AuthorizeResponseUser = { ```typescript const value: components.AuthorizeResponseOrganization = { client: { - createdAt: new Date("2022-07-10T09:38:33.519Z"), - modifiedAt: new Date("2024-02-14T02:44:27.976Z"), + createdAt: new Date("2024-07-13T06:25:35.667Z"), + modifiedAt: new Date("2023-06-30T02:24:12.549Z"), clientId: "", clientName: "", - clientUri: "https://oval-bonfire.info", - logoUri: "https://delectable-encouragement.net", - tosUri: "https://shadowy-season.net/", - policyUri: "https://humiliating-octave.biz", + clientUri: "https://critical-haircut.info", + logoUri: "https://experienced-aircraft.name/", + tosUri: "https://best-league.com/", + policyUri: "https://shrill-freezing.org", }, sub: { id: "", slug: "", - avatarUrl: "https://suburban-skeleton.info/", + avatarUrl: "https://ultimate-perfection.com/", }, scopes: [ - "benefits:read", + "products:write", ], organizations: [ { id: "", slug: "", - avatarUrl: "https://kooky-deduction.biz/", + avatarUrl: "https://posh-reconsideration.name", }, ], }; diff --git a/docs/models/operations/oauth2clientslistresponse.md b/docs/models/operations/oauth2clientslistresponse.md index 7bd2ab1c..0486c330 100644 --- a/docs/models/operations/oauth2clientslistresponse.md +++ b/docs/models/operations/oauth2clientslistresponse.md @@ -10,20 +10,20 @@ let value: Oauth2ClientsListResponse = { items: [ { redirectUris: [ - "https://quarrelsome-spirit.name", + "https://wasteful-tool.net/", ], clientName: "", - createdAt: new Date("2023-12-11T12:44:47.120Z"), - modifiedAt: new Date("2024-12-06T12:57:36.581Z"), + createdAt: new Date("2023-09-02T16:34:40.356Z"), + modifiedAt: new Date("2023-11-10T10:11:55.405Z"), clientId: "", clientSecret: "", - clientIdIssuedAt: 720296, - clientSecretExpiresAt: 78474, + clientIdIssuedAt: 829019, + clientSecretExpiresAt: 652211, }, ], pagination: { - totalCount: 716805, - maxPage: 973876, + totalCount: 245939, + maxPage: 869122, }, }, }; diff --git a/docs/models/operations/oauth2clientsoauth2updateclientrequest.md b/docs/models/operations/oauth2clientsoauth2updateclientrequest.md index 6b2590ab..cfc315c3 100644 --- a/docs/models/operations/oauth2clientsoauth2updateclientrequest.md +++ b/docs/models/operations/oauth2clientsoauth2updateclientrequest.md @@ -9,7 +9,7 @@ let value: Oauth2ClientsOauth2UpdateClientRequest = { clientId: "", oAuth2ClientConfigurationUpdate: { redirectUris: [ - "https://ashamed-railway.biz/", + "https://prickly-wheel.name", ], clientName: "", clientId: "", diff --git a/docs/models/operations/oauth2introspecttokentokentypehint.md b/docs/models/operations/oauth2introspecttokentokentypehint.md index fce2a6ac..f6bfc5f0 100644 --- a/docs/models/operations/oauth2introspecttokentokentypehint.md +++ b/docs/models/operations/oauth2introspecttokentokentypehint.md @@ -5,7 +5,7 @@ ```typescript import { Oauth2IntrospectTokenTokenTypeHint } from "@polar-sh/sdk/models/operations"; -let value: Oauth2IntrospectTokenTokenTypeHint = "refresh_token"; +let value: Oauth2IntrospectTokenTokenTypeHint = "access_token"; ``` ## Values diff --git a/docs/models/operations/oauth2requesttokenrequestbody.md b/docs/models/operations/oauth2requesttokenrequestbody.md index 21c374d3..b7521fed 100644 --- a/docs/models/operations/oauth2requesttokenrequestbody.md +++ b/docs/models/operations/oauth2requesttokenrequestbody.md @@ -11,7 +11,7 @@ const value: clientId: "", clientSecret: "", code: "", - redirectUri: "https://raw-waist.com", + redirectUri: "https://sugary-agreement.org", }; ``` diff --git a/docs/models/operations/orderslistresponse.md b/docs/models/operations/orderslistresponse.md index 09fe7347..7484be9d 100644 --- a/docs/models/operations/orderslistresponse.md +++ b/docs/models/operations/orderslistresponse.md @@ -9,18 +9,18 @@ let value: OrdersListResponse = { result: { items: [ { - createdAt: new Date("2024-07-24T20:28:30.681Z"), - modifiedAt: new Date("2023-05-28T07:40:18.625Z"), + createdAt: new Date("2024-06-30T14:06:00.507Z"), + modifiedAt: new Date("2025-10-11T05:12:55.893Z"), id: "", metadata: { - "key": false, + "key": "", }, - amount: 619856, - taxAmount: 145788, - currency: "Swiss Franc", - billingReason: "subscription_create", + amount: 550564, + taxAmount: 973111, + currency: "Cayman Islands Dollar", + billingReason: "subscription_update", billingAddress: { - country: "Svalbard & Jan Mayen Islands", + country: "Antigua and Barbuda", }, customerId: "", productId: "", @@ -29,86 +29,87 @@ let value: OrdersListResponse = { subscriptionId: "", checkoutId: "", customer: { - createdAt: new Date("2022-12-22T00:55:04.745Z"), - modifiedAt: new Date("2024-09-01T06:40:45.626Z"), + createdAt: new Date("2024-07-28T05:07:27.507Z"), + modifiedAt: new Date("2023-01-04T03:36:40.213Z"), id: "", metadata: { - "key": 708312, + "key": "", }, - email: "Alysson.Nitzsche@gmail.com", + email: "Hassie_Jacobson@hotmail.com", emailVerified: false, name: "", billingAddress: { - country: "Zambia", + country: "Azerbaijan", }, taxId: [ - "is_vat", + "jp_rn", ], organizationId: "", - avatarUrl: "https://pushy-cinema.info/", + avatarUrl: "https://trusting-fog.info", }, userId: "", user: { id: "", - email: "Jermey_Bahringer45@yahoo.com", + email: "Jaden59@yahoo.com", publicName: "", }, product: { - createdAt: new Date("2023-07-22T07:02:26.933Z"), - modifiedAt: new Date("2022-05-07T00:58:07.143Z"), + createdAt: new Date("2023-08-29T10:19:40.657Z"), + modifiedAt: new Date("2024-10-04T08:38:09.184Z"), id: "", name: "", description: - "blah sugary throbbing which well madly generally haversack tense intently", + "psst hamburger help on drat woot carelessly preclude ew", isRecurring: false, isArchived: false, organizationId: "", }, productPrice: { - createdAt: new Date("2024-08-05T15:05:18.750Z"), - modifiedAt: new Date("2023-08-18T14:54:19.654Z"), + createdAt: new Date("2024-06-08T17:30:09.345Z"), + modifiedAt: new Date("2025-10-02T16:17:12.780Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - minimumAmount: 5253, - maximumAmount: 911003, - presetAmount: 522192, + minimumAmount: 677492, + maximumAmount: 319975, + presetAmount: 765552, + recurringInterval: "month", }, discount: { duration: "forever", - type: "percentage", - basisPoints: 980995, - createdAt: new Date("2023-04-30T05:00:39.346Z"), - modifiedAt: new Date("2024-02-04T23:21:36.977Z"), + type: "fixed", + basisPoints: 500629, + createdAt: new Date("2023-04-21T18:22:25.645Z"), + modifiedAt: new Date("2025-07-17T08:39:28.965Z"), id: "", metadata: { "key": false, }, name: "", code: "", - startsAt: new Date("2022-04-25T12:59:08.238Z"), - endsAt: new Date("2023-09-30T03:33:59.750Z"), - maxRedemptions: 458572, - redemptionsCount: 992175, + startsAt: new Date("2025-09-15T09:57:46.655Z"), + endsAt: new Date("2023-02-19T01:11:58.352Z"), + maxRedemptions: 852874, + redemptionsCount: 842074, organizationId: "", }, subscription: { metadata: { - "key": false, + "key": "", }, - createdAt: new Date("2022-07-24T01:54:16.556Z"), - modifiedAt: new Date("2022-04-17T23:23:59.287Z"), + createdAt: new Date("2025-03-01T04:04:19.932Z"), + modifiedAt: new Date("2023-03-01T00:27:19.326Z"), id: "", - amount: 453638, - currency: "Lek", - recurringInterval: "month", - status: "canceled", - currentPeriodStart: new Date("2024-08-26T01:26:53.760Z"), - currentPeriodEnd: new Date("2024-11-21T17:00:59.466Z"), + amount: 811861, + currency: "Dobra", + recurringInterval: "year", + status: "active", + currentPeriodStart: new Date("2024-06-28T14:28:28.613Z"), + currentPeriodEnd: new Date("2024-04-17T11:51:25.496Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2024-10-01T21:33:32.957Z"), - endedAt: new Date("2024-09-28T16:24:17.935Z"), + startedAt: new Date("2024-07-13T08:53:09.254Z"), + endedAt: new Date("2025-06-12T15:23:06.895Z"), customerId: "", productId: "", priceId: "", @@ -119,8 +120,8 @@ let value: OrdersListResponse = { }, ], pagination: { - totalCount: 334873, - maxPage: 386586, + totalCount: 868374, + maxPage: 15364, }, }, }; diff --git a/docs/models/operations/organizationslistresponse.md b/docs/models/operations/organizationslistresponse.md index a96688d4..a9dde762 100644 --- a/docs/models/operations/organizationslistresponse.md +++ b/docs/models/operations/organizationslistresponse.md @@ -9,28 +9,28 @@ let value: OrganizationsListResponse = { result: { items: [ { - createdAt: new Date("2024-09-19T07:28:52.145Z"), - modifiedAt: new Date("2024-01-22T03:42:55.455Z"), + createdAt: new Date("2024-12-03T03:15:16.751Z"), + modifiedAt: new Date("2024-04-03T22:26:30.922Z"), id: "", name: "", slug: "", - avatarUrl: "https://ordinary-cauliflower.com/", + avatarUrl: "https://ultimate-numeric.biz/", bio: "", - company: "Kub - Gleichner", + company: "Dooley - Gleason", blog: "", location: "", - email: "Joshuah2@gmail.com", + email: "Lowell_Lindgren26@hotmail.com", twitterUsername: "", - pledgeMinimumAmount: 953086, + pledgeMinimumAmount: 276086, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 456767, + defaultUpfrontSplitToContributors: 940723, profileSettings: {}, featureSettings: {}, }, ], pagination: { - totalCount: 65890, - maxPage: 282682, + totalCount: 20512, + maxPage: 121552, }, }, }; diff --git a/docs/models/operations/productpricetypefilter.md b/docs/models/operations/productpricetypefilter.md index c7464f63..94c050c4 100644 --- a/docs/models/operations/productpricetypefilter.md +++ b/docs/models/operations/productpricetypefilter.md @@ -8,7 +8,7 @@ Filter by product price type. `recurring` will return orders corresponding to su ### `components.ProductPriceType` ```typescript -const value: components.ProductPriceType = "one_time"; +const value: components.ProductPriceType = "recurring"; ``` ### `components.ProductPriceType[]` diff --git a/docs/models/operations/productslistresponse.md b/docs/models/operations/productslistresponse.md index 8981370a..7e1dcd4d 100644 --- a/docs/models/operations/productslistresponse.md +++ b/docs/models/operations/productslistresponse.md @@ -9,45 +9,36 @@ let value: ProductsListResponse = { result: { items: [ { - createdAt: new Date("2024-06-09T10:04:08.807Z"), - modifiedAt: new Date("2024-07-19T01:41:16.881Z"), + createdAt: new Date("2025-10-01T21:33:32.957Z"), + modifiedAt: new Date("2025-09-28T16:24:17.935Z"), id: "", name: "", - description: "although pear general coop barring", + description: "against depend although offensively alliance", isRecurring: false, isArchived: false, organizationId: "", metadata: { - "key": "", + "key": false, }, prices: [ { - createdAt: new Date("2022-05-05T12:03:21.760Z"), - modifiedAt: new Date("2024-08-15T14:15:58.232Z"), + createdAt: new Date("2025-07-11T05:15:47.275Z"), + modifiedAt: new Date("2023-06-21T05:44:00.806Z"), id: "", isArchived: false, productId: "", - priceCurrency: "", - minimumAmount: 395697, - maximumAmount: 609610, - presetAmount: 974618, }, ], benefits: [ { - createdAt: new Date("2023-07-11T20:33:26.772Z"), - modifiedAt: new Date("2024-09-21T23:39:35.603Z"), + createdAt: new Date("2025-08-05T04:22:38.604Z"), + modifiedAt: new Date("2024-01-28T21:34:54.077Z"), id: "", - description: - "although righteously airline psst forecast lest sell now even rundown", + description: "because fencing maul but from", selectable: false, deletable: false, organizationId: "", - properties: { - repositoryOwner: "polarsource", - repositoryName: "private_repo", - permission: "maintain", - }, + properties: {}, }, ], medias: [ @@ -55,52 +46,45 @@ let value: ProductsListResponse = { id: "", organizationId: "", name: "", - path: "/private", + path: "/proc", mimeType: "", - size: 228869, + size: 90205, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2022-08-28T00:24:16.627Z"), + lastModifiedAt: new Date("2024-12-11T14:27:58.846Z"), version: "", isUploaded: false, - createdAt: new Date("2022-01-24T23:25:23.825Z"), + createdAt: new Date("2024-12-03T06:25:18.097Z"), sizeReadable: "", - publicUrl: "https://gullible-reward.com", + publicUrl: "https://authorized-cook.name", }, ], attachedCustomFields: [ { customFieldId: "", customField: { - createdAt: new Date("2022-02-17T03:45:50.562Z"), - modifiedAt: new Date("2023-10-13T18:11:53.175Z"), + createdAt: new Date("2024-03-30T16:46:12.008Z"), + modifiedAt: new Date("2023-01-30T13:17:24.903Z"), id: "", metadata: { - "key": "", + "key": false, }, slug: "", name: "", organizationId: "", - properties: { - options: [ - { - value: "", - label: "", - }, - ], - }, + properties: {}, }, - order: 697365, + order: 290128, required: false, }, ], }, ], pagination: { - totalCount: 791972, - maxPage: 412393, + totalCount: 364789, + maxPage: 455531, }, }, }; diff --git a/docs/models/operations/queryparambenefittypefilter.md b/docs/models/operations/queryparambenefittypefilter.md index 441fbc3a..4eb44717 100644 --- a/docs/models/operations/queryparambenefittypefilter.md +++ b/docs/models/operations/queryparambenefittypefilter.md @@ -8,14 +8,14 @@ Filter by benefit type. ### `components.BenefitType` ```typescript -const value: components.BenefitType = "discord"; +const value: components.BenefitType = "ads"; ``` ### `components.BenefitType[]` ```typescript const value: components.BenefitType[] = [ - "license_keys", + "ads", ]; ``` diff --git a/docs/models/operations/repositorieslistresponse.md b/docs/models/operations/repositorieslistresponse.md index a674dc95..c939d58b 100644 --- a/docs/models/operations/repositorieslistresponse.md +++ b/docs/models/operations/repositorieslistresponse.md @@ -9,52 +9,54 @@ let value: RepositoriesListResponse = { result: { items: [ { - id: "c3de11a8-ec81-4174-afa4-5135a2a1ea92", + id: "caacc71d-90c6-458a-ae04-0db4caac2985", + platform: "github", isPrivate: false, name: "MyOrg", - description: "powerful how stoop that", + description: "doubter ick solemnly nicely commonly wherever", stars: 1337, license: "", homepage: "", profileSettings: {}, organization: { - id: "4ae92454-af8c-4f50-9cb4-4b2dd93f3478", + id: "60e7a8cf-9190-4514-8e3c-65d6f3e48105", + platform: "github", name: "", - avatarUrl: "https://tough-airline.org/", + avatarUrl: "https://excitable-annual.net/", isPersonal: false, bio: "", prettyName: "", - company: "Wehner, Haley and Davis", + company: "D'Amore and Sons", blog: "", location: "", - email: "Marta.Cummings27@gmail.com", + email: "Kelton_Carroll-Deckow@yahoo.com", twitterUsername: "", organizationId: "", }, internalOrganization: { - createdAt: new Date("2023-10-28T17:30:10.640Z"), - modifiedAt: new Date("2023-07-15T04:23:37.588Z"), + createdAt: new Date("2023-05-03T22:07:33.571Z"), + modifiedAt: new Date("2024-10-02T00:29:09.828Z"), id: "", name: "", slug: "", - avatarUrl: "https://proper-stock.com", + avatarUrl: "https://reckless-eternity.info/", bio: "", - company: "Howe and Sons", + company: "Douglas - Lang", blog: "", location: "", - email: "Leon6@gmail.com", + email: "Alexzander_Rolfson99@hotmail.com", twitterUsername: "", - pledgeMinimumAmount: 881310, + pledgeMinimumAmount: 161742, pledgeBadgeShowAmount: false, - defaultUpfrontSplitToContributors: 16985, + defaultUpfrontSplitToContributors: 319680, profileSettings: {}, featureSettings: {}, }, }, ], pagination: { - totalCount: 652443, - maxPage: 562901, + totalCount: 6227, + maxPage: 519466, }, }, }; diff --git a/docs/models/operations/subscriptionslistresponse.md b/docs/models/operations/subscriptionslistresponse.md index 8d26892e..88bccf2f 100644 --- a/docs/models/operations/subscriptionslistresponse.md +++ b/docs/models/operations/subscriptionslistresponse.md @@ -9,18 +9,18 @@ let value: SubscriptionsListResponse = { result: { items: [ { - createdAt: new Date("2022-06-11T16:12:12.042Z"), - modifiedAt: new Date("2023-07-04T00:38:08.268Z"), + createdAt: new Date("2023-07-10T09:38:33.519Z"), + modifiedAt: new Date("2025-02-13T02:44:27.976Z"), id: "", - amount: 180803, - currency: "Zimbabwe Dollar", + amount: 978687, + currency: "Kwacha", recurringInterval: "month", - status: "trialing", - currentPeriodStart: new Date("2022-03-12T07:46:19.683Z"), - currentPeriodEnd: new Date("2023-10-19T01:19:01.556Z"), + status: "active", + currentPeriodStart: new Date("2025-05-08T05:53:08.264Z"), + currentPeriodEnd: new Date("2023-07-16T06:45:03.338Z"), cancelAtPeriodEnd: false, - startedAt: new Date("2022-05-17T05:40:28.556Z"), - endedAt: new Date("2022-10-14T20:50:51.008Z"), + startedAt: new Date("2023-11-21T05:47:05.975Z"), + endedAt: new Date("2025-01-01T15:52:46.782Z"), customerId: "", productId: "", priceId: "", @@ -30,71 +30,69 @@ let value: SubscriptionsListResponse = { "key": "", }, customer: { - createdAt: new Date("2022-04-18T12:50:34.974Z"), - modifiedAt: new Date("2024-06-28T16:41:02.450Z"), + createdAt: new Date("2025-03-09T19:52:42.065Z"), + modifiedAt: new Date("2025-05-21T11:33:27.752Z"), id: "", metadata: { - "key": "", + "key": false, }, - email: "Edwina_Fadel@yahoo.com", + email: "Genesis81@yahoo.com", emailVerified: false, name: "", billingAddress: { - country: "French Southern Territories", + country: "Hungary", }, taxId: [ - "cn_tin", + "", ], organizationId: "", - avatarUrl: "https://frank-atrium.info", + avatarUrl: "https://kooky-deduction.biz/", }, userId: "", user: { id: "", - email: "Jamie61@gmail.com", + email: "Mara_Cronin-Walker@hotmail.com", publicName: "", }, product: { - createdAt: new Date("2022-12-09T23:28:03.526Z"), - modifiedAt: new Date("2024-05-13T12:44:04.791Z"), + createdAt: new Date("2025-07-07T00:56:00.393Z"), + modifiedAt: new Date("2024-08-01T06:43:02.119Z"), id: "", name: "", description: - "darn given pace fraudster honesty enlightened like cheerfully or", + "badly meanwhile disclosure mount wherever thankfully allegation rigidly", isRecurring: false, isArchived: false, organizationId: "", metadata: { - "key": false, + "key": "", }, prices: [ { - createdAt: new Date("2022-11-30T22:04:47.090Z"), - modifiedAt: new Date("2022-02-14T07:51:45.628Z"), + createdAt: new Date("2023-09-27T03:49:30.939Z"), + modifiedAt: new Date("2025-11-23T09:43:27.791Z"), id: "", isArchived: false, productId: "", priceCurrency: "", - priceAmount: 843132, + priceAmount: 34675, + recurringInterval: "year", }, ], benefits: [ { - createdAt: new Date("2022-10-24T13:04:44.480Z"), - modifiedAt: new Date("2024-04-23T05:52:51.473Z"), + createdAt: new Date("2024-01-01T21:33:09.750Z"), + modifiedAt: new Date("2023-09-24T08:14:03.791Z"), id: "", description: - "mmm luck oh fussy graft astride ascertain mainstream", + "oval anenst petty which unlined although righteously airline psst", selectable: false, deletable: false, organizationId: "", properties: { - archived: { - "key": false, - }, - files: [ - "", - ], + repositoryOwner: "polarsource", + repositoryName: "private_repo", + permission: "triage", }, }, ], @@ -103,76 +101,73 @@ let value: SubscriptionsListResponse = { id: "", organizationId: "", name: "", - path: "/usr/local/bin", + path: "/etc/defaults", mimeType: "", - size: 962380, + size: 541143, storageVersion: "", checksumEtag: "", checksumSha256Base64: "", checksumSha256Hex: "", - lastModifiedAt: new Date("2023-11-12T13:52:42.697Z"), + lastModifiedAt: new Date("2023-01-07T21:20:12.170Z"), version: "", isUploaded: false, - createdAt: new Date("2022-05-09T03:26:26.188Z"), + createdAt: new Date("2023-08-19T09:38:38.711Z"), sizeReadable: "", - publicUrl: "https://angelic-flu.com", + publicUrl: "https://gruesome-subexpression.biz/", }, ], attachedCustomFields: [ { customFieldId: "", customField: { - createdAt: new Date("2024-09-12T00:09:48.443Z"), - modifiedAt: new Date("2022-08-21T04:25:21.569Z"), + createdAt: new Date("2025-09-25T04:15:37.769Z"), + modifiedAt: new Date("2023-07-07T22:13:16.221Z"), id: "", metadata: { - "key": false, + "key": 395874, }, slug: "", name: "", organizationId: "", properties: {}, }, - order: 396391, + order: 65139, required: false, }, ], }, price: { - createdAt: new Date("2024-07-14T10:56:14.102Z"), - modifiedAt: new Date("2023-03-29T06:43:43.157Z"), + createdAt: new Date("2025-12-29T22:14:55.291Z"), + modifiedAt: new Date("2024-04-08T00:17:00.771Z"), id: "", isArchived: false, productId: "", - priceCurrency: "", - minimumAmount: 982407, - maximumAmount: 198849, - presetAmount: 879491, - recurringInterval: "month", + recurringInterval: "year", }, discount: { - duration: "once", + duration: "repeating", + durationInMonths: 505052, type: "fixed", - basisPoints: 372767, - createdAt: new Date("2022-07-16T11:52:25.526Z"), - modifiedAt: new Date("2023-06-20T01:41:54.596Z"), + basisPoints: 251859, + createdAt: new Date("2025-08-10T16:52:30.619Z"), + modifiedAt: new Date("2023-03-26T02:50:46.475Z"), id: "", metadata: { - "key": "", + "key": 489133, }, name: "", code: "", - startsAt: new Date("2022-02-12T14:32:02.870Z"), - endsAt: new Date("2024-02-27T05:59:10.672Z"), - maxRedemptions: 333800, - redemptionsCount: 172302, + startsAt: new Date("2024-06-22T22:06:31.167Z"), + endsAt: new Date("2025-06-01T03:35:11.920Z"), + maxRedemptions: 152042, + redemptionsCount: 988523, organizationId: "", }, }, ], pagination: { - totalCount: 947974, - maxPage: 488559, + totalCount: 314581, + maxPage: 826020, }, }, }; diff --git a/docs/models/operations/tokentypehint.md b/docs/models/operations/tokentypehint.md index cf18c8fe..f9e721bf 100644 --- a/docs/models/operations/tokentypehint.md +++ b/docs/models/operations/tokentypehint.md @@ -5,7 +5,7 @@ ```typescript import { TokenTypeHint } from "@polar-sh/sdk/models/operations"; -let value: TokenTypeHint = "refresh_token"; +let value: TokenTypeHint = "access_token"; ``` ## Values diff --git a/jsr.json b/jsr.json index dd089f9c..65248b5b 100644 --- a/jsr.json +++ b/jsr.json @@ -2,7 +2,7 @@ { "name": "@polar-sh/sdk", - "version": "0.19.2", + "version": "0.20.0", "exports": { ".": "./src/index.ts", "./models/errors": "./src/models/errors/index.ts", diff --git a/package-lock.json b/package-lock.json index 66177fef..c13978b6 100644 --- a/package-lock.json +++ b/package-lock.json @@ -1,12 +1,12 @@ { "name": "@polar-sh/sdk", - "version": "0.19.2", + "version": "0.20.0", "lockfileVersion": 3, "requires": true, "packages": { "": { "name": "@polar-sh/sdk", - "version": "0.19.2", + "version": "0.20.0", "dependencies": { "standardwebhooks": "^1.0.0" }, diff --git a/package.json b/package.json index e5dc18e6..14328c62 100644 --- a/package.json +++ b/package.json @@ -1,6 +1,6 @@ { "name": "@polar-sh/sdk", - "version": "0.19.2", + "version": "0.20.0", "author": "Speakeasy", "main": "./index.js", "sideEffects": false, diff --git a/src/funcs/advertisementsList.ts b/src/funcs/advertisementsList.ts index 321c3fee..9005c0ac 100644 --- a/src/funcs/advertisementsList.ts +++ b/src/funcs/advertisementsList.ts @@ -165,7 +165,7 @@ export async function advertisementsList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -179,7 +179,7 @@ export async function advertisementsList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/benefitsGrants.ts b/src/funcs/benefitsGrants.ts index 210df072..7acc1559 100644 --- a/src/funcs/benefitsGrants.ts +++ b/src/funcs/benefitsGrants.ts @@ -178,7 +178,7 @@ export async function benefitsGrants( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -192,7 +192,7 @@ export async function benefitsGrants( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/benefitsList.ts b/src/funcs/benefitsList.ts index f53e1469..774a2539 100644 --- a/src/funcs/benefitsList.ts +++ b/src/funcs/benefitsList.ts @@ -165,7 +165,7 @@ export async function benefitsList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -179,7 +179,7 @@ export async function benefitsList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/checkoutLinksList.ts b/src/funcs/checkoutLinksList.ts index 1fbe3d7d..fc7b705a 100644 --- a/src/funcs/checkoutLinksList.ts +++ b/src/funcs/checkoutLinksList.ts @@ -166,7 +166,7 @@ export async function checkoutLinksList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -180,7 +180,7 @@ export async function checkoutLinksList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/checkoutsCustomList.ts b/src/funcs/checkoutsCustomList.ts index b7c283fe..9ee4c780 100644 --- a/src/funcs/checkoutsCustomList.ts +++ b/src/funcs/checkoutsCustomList.ts @@ -167,7 +167,7 @@ export async function checkoutsCustomList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -181,7 +181,7 @@ export async function checkoutsCustomList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/customFieldsList.ts b/src/funcs/customFieldsList.ts index 6be03f6f..f829e62d 100644 --- a/src/funcs/customFieldsList.ts +++ b/src/funcs/customFieldsList.ts @@ -167,7 +167,7 @@ export async function customFieldsList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -181,7 +181,7 @@ export async function customFieldsList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/customerPortalBenefitGrantsList.ts b/src/funcs/customerPortalBenefitGrantsList.ts index ad8b1b34..b024a5bb 100644 --- a/src/funcs/customerPortalBenefitGrantsList.ts +++ b/src/funcs/customerPortalBenefitGrantsList.ts @@ -175,7 +175,7 @@ export async function customerPortalBenefitGrantsList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -189,7 +189,7 @@ export async function customerPortalBenefitGrantsList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/customerPortalDownloadablesList.ts b/src/funcs/customerPortalDownloadablesList.ts index 1e29aa83..d11d04ed 100644 --- a/src/funcs/customerPortalDownloadablesList.ts +++ b/src/funcs/customerPortalDownloadablesList.ts @@ -167,7 +167,7 @@ export async function customerPortalDownloadablesList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -181,7 +181,7 @@ export async function customerPortalDownloadablesList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/customerPortalLicenseKeysList.ts b/src/funcs/customerPortalLicenseKeysList.ts index 355854cd..135971b7 100644 --- a/src/funcs/customerPortalLicenseKeysList.ts +++ b/src/funcs/customerPortalLicenseKeysList.ts @@ -175,7 +175,7 @@ export async function customerPortalLicenseKeysList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -189,7 +189,7 @@ export async function customerPortalLicenseKeysList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/customerPortalOrdersList.ts b/src/funcs/customerPortalOrdersList.ts index 9d60a227..e64c4bff 100644 --- a/src/funcs/customerPortalOrdersList.ts +++ b/src/funcs/customerPortalOrdersList.ts @@ -170,7 +170,7 @@ export async function customerPortalOrdersList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -184,7 +184,7 @@ export async function customerPortalOrdersList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/customerPortalSubscriptionsList.ts b/src/funcs/customerPortalSubscriptionsList.ts index 5afc6506..b67f9a88 100644 --- a/src/funcs/customerPortalSubscriptionsList.ts +++ b/src/funcs/customerPortalSubscriptionsList.ts @@ -173,7 +173,7 @@ export async function customerPortalSubscriptionsList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -187,7 +187,7 @@ export async function customerPortalSubscriptionsList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/customersList.ts b/src/funcs/customersList.ts index 533a40fe..e080c083 100644 --- a/src/funcs/customersList.ts +++ b/src/funcs/customersList.ts @@ -166,7 +166,7 @@ export async function customersList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -180,7 +180,7 @@ export async function customersList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/discountsList.ts b/src/funcs/discountsList.ts index bf72501f..d7788709 100644 --- a/src/funcs/discountsList.ts +++ b/src/funcs/discountsList.ts @@ -166,7 +166,7 @@ export async function discountsList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -180,7 +180,7 @@ export async function discountsList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/externalOrganizationsList.ts b/src/funcs/externalOrganizationsList.ts index 0dd3f3f6..eecedd88 100644 --- a/src/funcs/externalOrganizationsList.ts +++ b/src/funcs/externalOrganizationsList.ts @@ -168,7 +168,7 @@ export async function externalOrganizationsList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -182,7 +182,7 @@ export async function externalOrganizationsList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/filesList.ts b/src/funcs/filesList.ts index 6f3834d3..6c9d224a 100644 --- a/src/funcs/filesList.ts +++ b/src/funcs/filesList.ts @@ -163,7 +163,7 @@ export async function filesList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -177,7 +177,7 @@ export async function filesList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/licenseKeysList.ts b/src/funcs/licenseKeysList.ts index 42d63aec..d38f89ca 100644 --- a/src/funcs/licenseKeysList.ts +++ b/src/funcs/licenseKeysList.ts @@ -173,7 +173,7 @@ export async function licenseKeysList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -187,7 +187,7 @@ export async function licenseKeysList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/oauth2ClientsList.ts b/src/funcs/oauth2ClientsList.ts index 4a936b81..ad1925ab 100644 --- a/src/funcs/oauth2ClientsList.ts +++ b/src/funcs/oauth2ClientsList.ts @@ -163,7 +163,7 @@ export async function oauth2ClientsList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -177,7 +177,7 @@ export async function oauth2ClientsList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/ordersList.ts b/src/funcs/ordersList.ts index e5d02805..7d3200b2 100644 --- a/src/funcs/ordersList.ts +++ b/src/funcs/ordersList.ts @@ -167,7 +167,7 @@ export async function ordersList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -181,7 +181,7 @@ export async function ordersList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/organizationsList.ts b/src/funcs/organizationsList.ts index 0855410b..e56305d9 100644 --- a/src/funcs/organizationsList.ts +++ b/src/funcs/organizationsList.ts @@ -165,7 +165,7 @@ export async function organizationsList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -179,7 +179,7 @@ export async function organizationsList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/productsList.ts b/src/funcs/productsList.ts index 8290b8b4..f0880518 100644 --- a/src/funcs/productsList.ts +++ b/src/funcs/productsList.ts @@ -169,7 +169,7 @@ export async function productsList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -183,7 +183,7 @@ export async function productsList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/repositoriesList.ts b/src/funcs/repositoriesList.ts index 6925f5d8..8533dfcd 100644 --- a/src/funcs/repositoriesList.ts +++ b/src/funcs/repositoriesList.ts @@ -169,7 +169,7 @@ export async function repositoriesList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -183,7 +183,7 @@ export async function repositoriesList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/funcs/subscriptionsList.ts b/src/funcs/subscriptionsList.ts index 3754e7a8..55d615d4 100644 --- a/src/funcs/subscriptionsList.ts +++ b/src/funcs/subscriptionsList.ts @@ -169,7 +169,7 @@ export async function subscriptionsList( >; "~next"?: { page: number }; } => { - const page = request?.page || 0; + const page = request?.page ?? 1; const nextPage = page + 1; const numPages = dlv(responseData, "pagination.max_page"); if (numPages == null || numPages <= page) { @@ -183,7 +183,7 @@ export async function subscriptionsList( if (!Array.isArray(results) || !results.length) { return { next: () => null }; } - const limit = request?.limit || 0; + const limit = request?.limit ?? 10; if (results.length < limit) { return { next: () => null }; } diff --git a/src/lib/config.ts b/src/lib/config.ts index 0008e97f..63e0db19 100644 --- a/src/lib/config.ts +++ b/src/lib/config.ts @@ -60,7 +60,7 @@ export function serverURLFromOptions(options: SDKOptions): URL | null { export const SDK_METADATA = { language: "typescript", openapiDocVersion: "0.1.0", - sdkVersion: "0.19.2", - genVersion: "2.481.0", - userAgent: "speakeasy-sdk/typescript 0.19.2 2.481.0 0.1.0 @polar-sh/sdk", + sdkVersion: "0.20.0", + genVersion: "2.484.0", + userAgent: "speakeasy-sdk/typescript 0.20.0 2.484.0 0.1.0 @polar-sh/sdk", } as const; diff --git a/src/lib/security.ts b/src/lib/security.ts index 4404346c..10222617 100644 --- a/src/lib/security.ts +++ b/src/lib/security.ts @@ -118,7 +118,7 @@ export function resolveSecurity( ...options: SecurityInput[][] ): SecurityState | null { const state: SecurityState = { - basic: { username: "", password: "" }, + basic: {}, headers: {}, queryParams: {}, cookies: {}, diff --git a/src/models/components/authorizeresponseorganization.ts b/src/models/components/authorizeresponseorganization.ts index 85e3c45f..3fd7fff3 100644 --- a/src/models/components/authorizeresponseorganization.ts +++ b/src/models/components/authorizeresponseorganization.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -22,13 +21,6 @@ import { } from "./oauth2clientpublic.js"; import { Scope, Scope$inboundSchema, Scope$outboundSchema } from "./scope.js"; -export const AuthorizeResponseOrganizationSubType = { - Organization: "organization", -} as const; -export type AuthorizeResponseOrganizationSubType = ClosedEnum< - typeof AuthorizeResponseOrganizationSubType ->; - export type AuthorizeResponseOrganization = { client: OAuth2ClientPublic; subType?: "organization" | undefined; @@ -37,30 +29,6 @@ export type AuthorizeResponseOrganization = { organizations: Array; }; -/** @internal */ -export const AuthorizeResponseOrganizationSubType$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - AuthorizeResponseOrganizationSubType, - ); - -/** @internal */ -export const AuthorizeResponseOrganizationSubType$outboundSchema: - z.ZodNativeEnum = - AuthorizeResponseOrganizationSubType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace AuthorizeResponseOrganizationSubType$ { - /** @deprecated use `AuthorizeResponseOrganizationSubType$inboundSchema` instead. */ - export const inboundSchema = - AuthorizeResponseOrganizationSubType$inboundSchema; - /** @deprecated use `AuthorizeResponseOrganizationSubType$outboundSchema` instead. */ - export const outboundSchema = - AuthorizeResponseOrganizationSubType$outboundSchema; -} - /** @internal */ export const AuthorizeResponseOrganization$inboundSchema: z.ZodType< AuthorizeResponseOrganization, @@ -94,7 +62,7 @@ export const AuthorizeResponseOrganization$outboundSchema: z.ZodType< AuthorizeResponseOrganization > = z.object({ client: OAuth2ClientPublic$outboundSchema, - subType: z.literal("organization").default("organization"), + subType: z.literal("organization").default("organization" as const), sub: z.nullable(AuthorizeOrganization$outboundSchema), scopes: z.array(Scope$outboundSchema), organizations: z.array(AuthorizeOrganization$outboundSchema), diff --git a/src/models/components/authorizeresponseuser.ts b/src/models/components/authorizeresponseuser.ts index d1b6cd66..05c359a2 100644 --- a/src/models/components/authorizeresponseuser.ts +++ b/src/models/components/authorizeresponseuser.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -22,13 +21,6 @@ import { } from "./oauth2clientpublic.js"; import { Scope, Scope$inboundSchema, Scope$outboundSchema } from "./scope.js"; -export const AuthorizeResponseUserSubType = { - User: "user", -} as const; -export type AuthorizeResponseUserSubType = ClosedEnum< - typeof AuthorizeResponseUserSubType ->; - export type AuthorizeResponseUser = { client: OAuth2ClientPublic; subType?: "user" | undefined; @@ -36,27 +28,6 @@ export type AuthorizeResponseUser = { scopes: Array; }; -/** @internal */ -export const AuthorizeResponseUserSubType$inboundSchema: z.ZodNativeEnum< - typeof AuthorizeResponseUserSubType -> = z.nativeEnum(AuthorizeResponseUserSubType); - -/** @internal */ -export const AuthorizeResponseUserSubType$outboundSchema: z.ZodNativeEnum< - typeof AuthorizeResponseUserSubType -> = AuthorizeResponseUserSubType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace AuthorizeResponseUserSubType$ { - /** @deprecated use `AuthorizeResponseUserSubType$inboundSchema` instead. */ - export const inboundSchema = AuthorizeResponseUserSubType$inboundSchema; - /** @deprecated use `AuthorizeResponseUserSubType$outboundSchema` instead. */ - export const outboundSchema = AuthorizeResponseUserSubType$outboundSchema; -} - /** @internal */ export const AuthorizeResponseUser$inboundSchema: z.ZodType< AuthorizeResponseUser, @@ -88,7 +59,7 @@ export const AuthorizeResponseUser$outboundSchema: z.ZodType< AuthorizeResponseUser > = z.object({ client: OAuth2ClientPublic$outboundSchema, - subType: z.literal("user").default("user"), + subType: z.literal("user").default("user" as const), sub: z.nullable(AuthorizeUser$outboundSchema), scopes: z.array(Scope$outboundSchema), }).transform((v) => { diff --git a/src/models/components/benefitads.ts b/src/models/components/benefitads.ts index c225a94c..9b7fedf0 100644 --- a/src/models/components/benefitads.ts +++ b/src/models/components/benefitads.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,11 +14,6 @@ import { BenefitAdsProperties$outboundSchema, } from "./benefitadsproperties.js"; -export const BenefitAdsType = { - Ads: "ads", -} as const; -export type BenefitAdsType = ClosedEnum; - /** * A benefit of type `ads`. * @@ -63,27 +57,6 @@ export type BenefitAds = { properties: BenefitAdsProperties; }; -/** @internal */ -export const BenefitAdsType$inboundSchema: z.ZodNativeEnum< - typeof BenefitAdsType -> = z.nativeEnum(BenefitAdsType); - -/** @internal */ -export const BenefitAdsType$outboundSchema: z.ZodNativeEnum< - typeof BenefitAdsType -> = BenefitAdsType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitAdsType$ { - /** @deprecated use `BenefitAdsType$inboundSchema` instead. */ - export const inboundSchema = BenefitAdsType$inboundSchema; - /** @deprecated use `BenefitAdsType$outboundSchema` instead. */ - export const outboundSchema = BenefitAdsType$outboundSchema; -} - /** @internal */ export const BenefitAds$inboundSchema: z.ZodType< BenefitAds, @@ -131,7 +104,7 @@ export const BenefitAds$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - type: z.literal("ads").default("ads"), + type: z.literal("ads").default("ads" as const), description: z.string(), selectable: z.boolean(), deletable: z.boolean(), diff --git a/src/models/components/benefitadscreate.ts b/src/models/components/benefitadscreate.ts index 1a51ef36..9113cec4 100644 --- a/src/models/components/benefitadscreate.ts +++ b/src/models/components/benefitadscreate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,11 +14,6 @@ import { BenefitAdsProperties$outboundSchema, } from "./benefitadsproperties.js"; -export const BenefitAdsCreateType = { - Ads: "ads", -} as const; -export type BenefitAdsCreateType = ClosedEnum; - export type BenefitAdsCreate = { type?: "ads" | undefined; /** @@ -36,27 +30,6 @@ export type BenefitAdsCreate = { properties: BenefitAdsProperties; }; -/** @internal */ -export const BenefitAdsCreateType$inboundSchema: z.ZodNativeEnum< - typeof BenefitAdsCreateType -> = z.nativeEnum(BenefitAdsCreateType); - -/** @internal */ -export const BenefitAdsCreateType$outboundSchema: z.ZodNativeEnum< - typeof BenefitAdsCreateType -> = BenefitAdsCreateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitAdsCreateType$ { - /** @deprecated use `BenefitAdsCreateType$inboundSchema` instead. */ - export const inboundSchema = BenefitAdsCreateType$inboundSchema; - /** @deprecated use `BenefitAdsCreateType$outboundSchema` instead. */ - export const outboundSchema = BenefitAdsCreateType$outboundSchema; -} - /** @internal */ export const BenefitAdsCreate$inboundSchema: z.ZodType< BenefitAdsCreate, @@ -87,7 +60,7 @@ export const BenefitAdsCreate$outboundSchema: z.ZodType< z.ZodTypeDef, BenefitAdsCreate > = z.object({ - type: z.literal("ads").default("ads"), + type: z.literal("ads").default("ads" as const), description: z.string(), organizationId: z.nullable(z.string()).optional(), properties: BenefitAdsProperties$outboundSchema, diff --git a/src/models/components/benefitadssubscriber.ts b/src/models/components/benefitadssubscriber.ts index 636b9eec..80d2ed7e 100644 --- a/src/models/components/benefitadssubscriber.ts +++ b/src/models/components/benefitadssubscriber.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -21,13 +20,6 @@ import { Organization$outboundSchema, } from "./organization.js"; -export const BenefitAdsSubscriberType = { - Ads: "ads", -} as const; -export type BenefitAdsSubscriberType = ClosedEnum< - typeof BenefitAdsSubscriberType ->; - export type BenefitAdsSubscriber = { /** * Creation timestamp of the object. @@ -65,27 +57,6 @@ export type BenefitAdsSubscriber = { properties: BenefitAdsProperties; }; -/** @internal */ -export const BenefitAdsSubscriberType$inboundSchema: z.ZodNativeEnum< - typeof BenefitAdsSubscriberType -> = z.nativeEnum(BenefitAdsSubscriberType); - -/** @internal */ -export const BenefitAdsSubscriberType$outboundSchema: z.ZodNativeEnum< - typeof BenefitAdsSubscriberType -> = BenefitAdsSubscriberType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitAdsSubscriberType$ { - /** @deprecated use `BenefitAdsSubscriberType$inboundSchema` instead. */ - export const inboundSchema = BenefitAdsSubscriberType$inboundSchema; - /** @deprecated use `BenefitAdsSubscriberType$outboundSchema` instead. */ - export const outboundSchema = BenefitAdsSubscriberType$outboundSchema; -} - /** @internal */ export const BenefitAdsSubscriber$inboundSchema: z.ZodType< BenefitAdsSubscriber, @@ -135,7 +106,7 @@ export const BenefitAdsSubscriber$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - type: z.literal("ads").default("ads"), + type: z.literal("ads").default("ads" as const), description: z.string(), selectable: z.boolean(), deletable: z.boolean(), diff --git a/src/models/components/benefitadsupdate.ts b/src/models/components/benefitadsupdate.ts index 81d8b211..711b8315 100644 --- a/src/models/components/benefitadsupdate.ts +++ b/src/models/components/benefitadsupdate.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,11 +13,6 @@ import { BenefitAdsProperties$outboundSchema, } from "./benefitadsproperties.js"; -export const BenefitAdsUpdateType = { - Ads: "ads", -} as const; -export type BenefitAdsUpdateType = ClosedEnum; - export type BenefitAdsUpdate = { /** * The description of the benefit. Will be displayed on products having this benefit. @@ -28,27 +22,6 @@ export type BenefitAdsUpdate = { properties?: BenefitAdsProperties | null | undefined; }; -/** @internal */ -export const BenefitAdsUpdateType$inboundSchema: z.ZodNativeEnum< - typeof BenefitAdsUpdateType -> = z.nativeEnum(BenefitAdsUpdateType); - -/** @internal */ -export const BenefitAdsUpdateType$outboundSchema: z.ZodNativeEnum< - typeof BenefitAdsUpdateType -> = BenefitAdsUpdateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitAdsUpdateType$ { - /** @deprecated use `BenefitAdsUpdateType$inboundSchema` instead. */ - export const inboundSchema = BenefitAdsUpdateType$inboundSchema; - /** @deprecated use `BenefitAdsUpdateType$outboundSchema` instead. */ - export const outboundSchema = BenefitAdsUpdateType$outboundSchema; -} - /** @internal */ export const BenefitAdsUpdate$inboundSchema: z.ZodType< BenefitAdsUpdate, @@ -74,7 +47,7 @@ export const BenefitAdsUpdate$outboundSchema: z.ZodType< BenefitAdsUpdate > = z.object({ description: z.nullable(z.string()).optional(), - type: z.literal("ads").default("ads"), + type: z.literal("ads").default("ads" as const), properties: z.nullable(BenefitAdsProperties$outboundSchema).optional(), }); diff --git a/src/models/components/benefitcustom.ts b/src/models/components/benefitcustom.ts index 645d14ab..545ce58f 100644 --- a/src/models/components/benefitcustom.ts +++ b/src/models/components/benefitcustom.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,11 +14,6 @@ import { BenefitCustomProperties$outboundSchema, } from "./benefitcustomproperties.js"; -export const BenefitCustomType = { - Custom: "custom", -} as const; -export type BenefitCustomType = ClosedEnum; - /** * A benefit of type `custom`. * @@ -67,27 +61,6 @@ export type BenefitCustom = { isTaxApplicable: boolean; }; -/** @internal */ -export const BenefitCustomType$inboundSchema: z.ZodNativeEnum< - typeof BenefitCustomType -> = z.nativeEnum(BenefitCustomType); - -/** @internal */ -export const BenefitCustomType$outboundSchema: z.ZodNativeEnum< - typeof BenefitCustomType -> = BenefitCustomType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitCustomType$ { - /** @deprecated use `BenefitCustomType$inboundSchema` instead. */ - export const inboundSchema = BenefitCustomType$inboundSchema; - /** @deprecated use `BenefitCustomType$outboundSchema` instead. */ - export const outboundSchema = BenefitCustomType$outboundSchema; -} - /** @internal */ export const BenefitCustom$inboundSchema: z.ZodType< BenefitCustom, @@ -138,7 +111,7 @@ export const BenefitCustom$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - type: z.literal("custom").default("custom"), + type: z.literal("custom").default("custom" as const), description: z.string(), selectable: z.boolean(), deletable: z.boolean(), diff --git a/src/models/components/benefitcustomcreate.ts b/src/models/components/benefitcustomcreate.ts index 2343bf8b..dfb5abe7 100644 --- a/src/models/components/benefitcustomcreate.ts +++ b/src/models/components/benefitcustomcreate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,13 +14,6 @@ import { BenefitCustomCreateProperties$outboundSchema, } from "./benefitcustomcreateproperties.js"; -export const BenefitCustomCreateType = { - Custom: "custom", -} as const; -export type BenefitCustomCreateType = ClosedEnum< - typeof BenefitCustomCreateType ->; - /** * Schema to create a benefit of type `custom`. */ @@ -41,27 +33,6 @@ export type BenefitCustomCreate = { properties: BenefitCustomCreateProperties; }; -/** @internal */ -export const BenefitCustomCreateType$inboundSchema: z.ZodNativeEnum< - typeof BenefitCustomCreateType -> = z.nativeEnum(BenefitCustomCreateType); - -/** @internal */ -export const BenefitCustomCreateType$outboundSchema: z.ZodNativeEnum< - typeof BenefitCustomCreateType -> = BenefitCustomCreateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitCustomCreateType$ { - /** @deprecated use `BenefitCustomCreateType$inboundSchema` instead. */ - export const inboundSchema = BenefitCustomCreateType$inboundSchema; - /** @deprecated use `BenefitCustomCreateType$outboundSchema` instead. */ - export const outboundSchema = BenefitCustomCreateType$outboundSchema; -} - /** @internal */ export const BenefitCustomCreate$inboundSchema: z.ZodType< BenefitCustomCreate, @@ -92,7 +63,7 @@ export const BenefitCustomCreate$outboundSchema: z.ZodType< z.ZodTypeDef, BenefitCustomCreate > = z.object({ - type: z.literal("custom").default("custom"), + type: z.literal("custom").default("custom" as const), description: z.string(), organizationId: z.nullable(z.string()).optional(), properties: BenefitCustomCreateProperties$outboundSchema, diff --git a/src/models/components/benefitcustomsubscriber.ts b/src/models/components/benefitcustomsubscriber.ts index 672a2233..c65f2995 100644 --- a/src/models/components/benefitcustomsubscriber.ts +++ b/src/models/components/benefitcustomsubscriber.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -21,13 +20,6 @@ import { Organization$outboundSchema, } from "./organization.js"; -export const BenefitCustomSubscriberType = { - Custom: "custom", -} as const; -export type BenefitCustomSubscriberType = ClosedEnum< - typeof BenefitCustomSubscriberType ->; - export type BenefitCustomSubscriber = { /** * Creation timestamp of the object. @@ -65,27 +57,6 @@ export type BenefitCustomSubscriber = { properties: BenefitCustomSubscriberProperties; }; -/** @internal */ -export const BenefitCustomSubscriberType$inboundSchema: z.ZodNativeEnum< - typeof BenefitCustomSubscriberType -> = z.nativeEnum(BenefitCustomSubscriberType); - -/** @internal */ -export const BenefitCustomSubscriberType$outboundSchema: z.ZodNativeEnum< - typeof BenefitCustomSubscriberType -> = BenefitCustomSubscriberType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitCustomSubscriberType$ { - /** @deprecated use `BenefitCustomSubscriberType$inboundSchema` instead. */ - export const inboundSchema = BenefitCustomSubscriberType$inboundSchema; - /** @deprecated use `BenefitCustomSubscriberType$outboundSchema` instead. */ - export const outboundSchema = BenefitCustomSubscriberType$outboundSchema; -} - /** @internal */ export const BenefitCustomSubscriber$inboundSchema: z.ZodType< BenefitCustomSubscriber, @@ -135,7 +106,7 @@ export const BenefitCustomSubscriber$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - type: z.literal("custom").default("custom"), + type: z.literal("custom").default("custom" as const), description: z.string(), selectable: z.boolean(), deletable: z.boolean(), diff --git a/src/models/components/benefitcustomupdate.ts b/src/models/components/benefitcustomupdate.ts index 418b8271..ae2c5fc7 100644 --- a/src/models/components/benefitcustomupdate.ts +++ b/src/models/components/benefitcustomupdate.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { BenefitCustomProperties$outboundSchema, } from "./benefitcustomproperties.js"; -export const BenefitCustomUpdateType = { - Custom: "custom", -} as const; -export type BenefitCustomUpdateType = ClosedEnum< - typeof BenefitCustomUpdateType ->; - export type BenefitCustomUpdate = { /** * The description of the benefit. Will be displayed on products having this benefit. @@ -30,27 +22,6 @@ export type BenefitCustomUpdate = { properties?: BenefitCustomProperties | null | undefined; }; -/** @internal */ -export const BenefitCustomUpdateType$inboundSchema: z.ZodNativeEnum< - typeof BenefitCustomUpdateType -> = z.nativeEnum(BenefitCustomUpdateType); - -/** @internal */ -export const BenefitCustomUpdateType$outboundSchema: z.ZodNativeEnum< - typeof BenefitCustomUpdateType -> = BenefitCustomUpdateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitCustomUpdateType$ { - /** @deprecated use `BenefitCustomUpdateType$inboundSchema` instead. */ - export const inboundSchema = BenefitCustomUpdateType$inboundSchema; - /** @deprecated use `BenefitCustomUpdateType$outboundSchema` instead. */ - export const outboundSchema = BenefitCustomUpdateType$outboundSchema; -} - /** @internal */ export const BenefitCustomUpdate$inboundSchema: z.ZodType< BenefitCustomUpdate, @@ -76,7 +47,7 @@ export const BenefitCustomUpdate$outboundSchema: z.ZodType< BenefitCustomUpdate > = z.object({ description: z.nullable(z.string()).optional(), - type: z.literal("custom").default("custom"), + type: z.literal("custom").default("custom" as const), properties: z.nullable(BenefitCustomProperties$outboundSchema).optional(), }); diff --git a/src/models/components/benefitdiscord.ts b/src/models/components/benefitdiscord.ts index 0e40c4ba..aa11a423 100644 --- a/src/models/components/benefitdiscord.ts +++ b/src/models/components/benefitdiscord.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,11 +14,6 @@ import { BenefitDiscordProperties$outboundSchema, } from "./benefitdiscordproperties.js"; -export const BenefitDiscordType = { - Discord: "discord", -} as const; -export type BenefitDiscordType = ClosedEnum; - /** * A benefit of type `discord`. * @@ -63,27 +57,6 @@ export type BenefitDiscord = { properties: BenefitDiscordProperties; }; -/** @internal */ -export const BenefitDiscordType$inboundSchema: z.ZodNativeEnum< - typeof BenefitDiscordType -> = z.nativeEnum(BenefitDiscordType); - -/** @internal */ -export const BenefitDiscordType$outboundSchema: z.ZodNativeEnum< - typeof BenefitDiscordType -> = BenefitDiscordType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitDiscordType$ { - /** @deprecated use `BenefitDiscordType$inboundSchema` instead. */ - export const inboundSchema = BenefitDiscordType$inboundSchema; - /** @deprecated use `BenefitDiscordType$outboundSchema` instead. */ - export const outboundSchema = BenefitDiscordType$outboundSchema; -} - /** @internal */ export const BenefitDiscord$inboundSchema: z.ZodType< BenefitDiscord, @@ -131,7 +104,7 @@ export const BenefitDiscord$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - type: z.literal("discord").default("discord"), + type: z.literal("discord").default("discord" as const), description: z.string(), selectable: z.boolean(), deletable: z.boolean(), diff --git a/src/models/components/benefitdiscordcreate.ts b/src/models/components/benefitdiscordcreate.ts index 8b824d0a..2ded6595 100644 --- a/src/models/components/benefitdiscordcreate.ts +++ b/src/models/components/benefitdiscordcreate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,13 +14,6 @@ import { BenefitDiscordCreateProperties$outboundSchema, } from "./benefitdiscordcreateproperties.js"; -export const BenefitDiscordCreateType = { - Discord: "discord", -} as const; -export type BenefitDiscordCreateType = ClosedEnum< - typeof BenefitDiscordCreateType ->; - export type BenefitDiscordCreate = { type?: "discord" | undefined; /** @@ -38,27 +30,6 @@ export type BenefitDiscordCreate = { properties: BenefitDiscordCreateProperties; }; -/** @internal */ -export const BenefitDiscordCreateType$inboundSchema: z.ZodNativeEnum< - typeof BenefitDiscordCreateType -> = z.nativeEnum(BenefitDiscordCreateType); - -/** @internal */ -export const BenefitDiscordCreateType$outboundSchema: z.ZodNativeEnum< - typeof BenefitDiscordCreateType -> = BenefitDiscordCreateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitDiscordCreateType$ { - /** @deprecated use `BenefitDiscordCreateType$inboundSchema` instead. */ - export const inboundSchema = BenefitDiscordCreateType$inboundSchema; - /** @deprecated use `BenefitDiscordCreateType$outboundSchema` instead. */ - export const outboundSchema = BenefitDiscordCreateType$outboundSchema; -} - /** @internal */ export const BenefitDiscordCreate$inboundSchema: z.ZodType< BenefitDiscordCreate, @@ -89,7 +60,7 @@ export const BenefitDiscordCreate$outboundSchema: z.ZodType< z.ZodTypeDef, BenefitDiscordCreate > = z.object({ - type: z.literal("discord").default("discord"), + type: z.literal("discord").default("discord" as const), description: z.string(), organizationId: z.nullable(z.string()).optional(), properties: BenefitDiscordCreateProperties$outboundSchema, diff --git a/src/models/components/benefitdiscordsubscriber.ts b/src/models/components/benefitdiscordsubscriber.ts index fd7d53af..8e47405b 100644 --- a/src/models/components/benefitdiscordsubscriber.ts +++ b/src/models/components/benefitdiscordsubscriber.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -21,13 +20,6 @@ import { Organization$outboundSchema, } from "./organization.js"; -export const BenefitDiscordSubscriberType = { - Discord: "discord", -} as const; -export type BenefitDiscordSubscriberType = ClosedEnum< - typeof BenefitDiscordSubscriberType ->; - export type BenefitDiscordSubscriber = { /** * Creation timestamp of the object. @@ -65,27 +57,6 @@ export type BenefitDiscordSubscriber = { properties: BenefitDiscordSubscriberProperties; }; -/** @internal */ -export const BenefitDiscordSubscriberType$inboundSchema: z.ZodNativeEnum< - typeof BenefitDiscordSubscriberType -> = z.nativeEnum(BenefitDiscordSubscriberType); - -/** @internal */ -export const BenefitDiscordSubscriberType$outboundSchema: z.ZodNativeEnum< - typeof BenefitDiscordSubscriberType -> = BenefitDiscordSubscriberType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitDiscordSubscriberType$ { - /** @deprecated use `BenefitDiscordSubscriberType$inboundSchema` instead. */ - export const inboundSchema = BenefitDiscordSubscriberType$inboundSchema; - /** @deprecated use `BenefitDiscordSubscriberType$outboundSchema` instead. */ - export const outboundSchema = BenefitDiscordSubscriberType$outboundSchema; -} - /** @internal */ export const BenefitDiscordSubscriber$inboundSchema: z.ZodType< BenefitDiscordSubscriber, @@ -135,7 +106,7 @@ export const BenefitDiscordSubscriber$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - type: z.literal("discord").default("discord"), + type: z.literal("discord").default("discord" as const), description: z.string(), selectable: z.boolean(), deletable: z.boolean(), diff --git a/src/models/components/benefitdiscordupdate.ts b/src/models/components/benefitdiscordupdate.ts index 76be1e47..3cc84095 100644 --- a/src/models/components/benefitdiscordupdate.ts +++ b/src/models/components/benefitdiscordupdate.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { BenefitDiscordCreateProperties$outboundSchema, } from "./benefitdiscordcreateproperties.js"; -export const BenefitDiscordUpdateType = { - Discord: "discord", -} as const; -export type BenefitDiscordUpdateType = ClosedEnum< - typeof BenefitDiscordUpdateType ->; - export type BenefitDiscordUpdate = { /** * The description of the benefit. Will be displayed on products having this benefit. @@ -30,27 +22,6 @@ export type BenefitDiscordUpdate = { properties?: BenefitDiscordCreateProperties | null | undefined; }; -/** @internal */ -export const BenefitDiscordUpdateType$inboundSchema: z.ZodNativeEnum< - typeof BenefitDiscordUpdateType -> = z.nativeEnum(BenefitDiscordUpdateType); - -/** @internal */ -export const BenefitDiscordUpdateType$outboundSchema: z.ZodNativeEnum< - typeof BenefitDiscordUpdateType -> = BenefitDiscordUpdateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitDiscordUpdateType$ { - /** @deprecated use `BenefitDiscordUpdateType$inboundSchema` instead. */ - export const inboundSchema = BenefitDiscordUpdateType$inboundSchema; - /** @deprecated use `BenefitDiscordUpdateType$outboundSchema` instead. */ - export const outboundSchema = BenefitDiscordUpdateType$outboundSchema; -} - /** @internal */ export const BenefitDiscordUpdate$inboundSchema: z.ZodType< BenefitDiscordUpdate, @@ -77,7 +48,7 @@ export const BenefitDiscordUpdate$outboundSchema: z.ZodType< BenefitDiscordUpdate > = z.object({ description: z.nullable(z.string()).optional(), - type: z.literal("discord").default("discord"), + type: z.literal("discord").default("discord" as const), properties: z.nullable(BenefitDiscordCreateProperties$outboundSchema) .optional(), }); diff --git a/src/models/components/benefitdownloadables.ts b/src/models/components/benefitdownloadables.ts index fce2b65b..d2159e87 100644 --- a/src/models/components/benefitdownloadables.ts +++ b/src/models/components/benefitdownloadables.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,13 +14,6 @@ import { BenefitDownloadablesProperties$outboundSchema, } from "./benefitdownloadablesproperties.js"; -export const BenefitDownloadablesType = { - Downloadables: "downloadables", -} as const; -export type BenefitDownloadablesType = ClosedEnum< - typeof BenefitDownloadablesType ->; - export type BenefitDownloadables = { /** * Creation timestamp of the object. @@ -55,27 +47,6 @@ export type BenefitDownloadables = { properties: BenefitDownloadablesProperties; }; -/** @internal */ -export const BenefitDownloadablesType$inboundSchema: z.ZodNativeEnum< - typeof BenefitDownloadablesType -> = z.nativeEnum(BenefitDownloadablesType); - -/** @internal */ -export const BenefitDownloadablesType$outboundSchema: z.ZodNativeEnum< - typeof BenefitDownloadablesType -> = BenefitDownloadablesType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitDownloadablesType$ { - /** @deprecated use `BenefitDownloadablesType$inboundSchema` instead. */ - export const inboundSchema = BenefitDownloadablesType$inboundSchema; - /** @deprecated use `BenefitDownloadablesType$outboundSchema` instead. */ - export const outboundSchema = BenefitDownloadablesType$outboundSchema; -} - /** @internal */ export const BenefitDownloadables$inboundSchema: z.ZodType< BenefitDownloadables, @@ -123,7 +94,7 @@ export const BenefitDownloadables$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - type: z.literal("downloadables").default("downloadables"), + type: z.literal("downloadables").default("downloadables" as const), description: z.string(), selectable: z.boolean(), deletable: z.boolean(), diff --git a/src/models/components/benefitdownloadablescreate.ts b/src/models/components/benefitdownloadablescreate.ts index 77661863..ac72f212 100644 --- a/src/models/components/benefitdownloadablescreate.ts +++ b/src/models/components/benefitdownloadablescreate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,13 +14,6 @@ import { BenefitDownloadablesCreateProperties$outboundSchema, } from "./benefitdownloadablescreateproperties.js"; -export const BenefitDownloadablesCreateType = { - Downloadables: "downloadables", -} as const; -export type BenefitDownloadablesCreateType = ClosedEnum< - typeof BenefitDownloadablesCreateType ->; - export type BenefitDownloadablesCreate = { type?: "downloadables" | undefined; /** @@ -35,27 +27,6 @@ export type BenefitDownloadablesCreate = { properties: BenefitDownloadablesCreateProperties; }; -/** @internal */ -export const BenefitDownloadablesCreateType$inboundSchema: z.ZodNativeEnum< - typeof BenefitDownloadablesCreateType -> = z.nativeEnum(BenefitDownloadablesCreateType); - -/** @internal */ -export const BenefitDownloadablesCreateType$outboundSchema: z.ZodNativeEnum< - typeof BenefitDownloadablesCreateType -> = BenefitDownloadablesCreateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitDownloadablesCreateType$ { - /** @deprecated use `BenefitDownloadablesCreateType$inboundSchema` instead. */ - export const inboundSchema = BenefitDownloadablesCreateType$inboundSchema; - /** @deprecated use `BenefitDownloadablesCreateType$outboundSchema` instead. */ - export const outboundSchema = BenefitDownloadablesCreateType$outboundSchema; -} - /** @internal */ export const BenefitDownloadablesCreate$inboundSchema: z.ZodType< BenefitDownloadablesCreate, @@ -86,7 +57,7 @@ export const BenefitDownloadablesCreate$outboundSchema: z.ZodType< z.ZodTypeDef, BenefitDownloadablesCreate > = z.object({ - type: z.literal("downloadables").default("downloadables"), + type: z.literal("downloadables").default("downloadables" as const), description: z.string(), organizationId: z.nullable(z.string()).optional(), properties: BenefitDownloadablesCreateProperties$outboundSchema, diff --git a/src/models/components/benefitdownloadablessubscriber.ts b/src/models/components/benefitdownloadablessubscriber.ts index 711b63a1..6ae7d1b7 100644 --- a/src/models/components/benefitdownloadablessubscriber.ts +++ b/src/models/components/benefitdownloadablessubscriber.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -21,13 +20,6 @@ import { Organization$outboundSchema, } from "./organization.js"; -export const BenefitDownloadablesSubscriberType = { - Downloadables: "downloadables", -} as const; -export type BenefitDownloadablesSubscriberType = ClosedEnum< - typeof BenefitDownloadablesSubscriberType ->; - export type BenefitDownloadablesSubscriber = { /** * Creation timestamp of the object. @@ -62,28 +54,6 @@ export type BenefitDownloadablesSubscriber = { properties: BenefitDownloadablesSubscriberProperties; }; -/** @internal */ -export const BenefitDownloadablesSubscriberType$inboundSchema: z.ZodNativeEnum< - typeof BenefitDownloadablesSubscriberType -> = z.nativeEnum(BenefitDownloadablesSubscriberType); - -/** @internal */ -export const BenefitDownloadablesSubscriberType$outboundSchema: z.ZodNativeEnum< - typeof BenefitDownloadablesSubscriberType -> = BenefitDownloadablesSubscriberType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitDownloadablesSubscriberType$ { - /** @deprecated use `BenefitDownloadablesSubscriberType$inboundSchema` instead. */ - export const inboundSchema = BenefitDownloadablesSubscriberType$inboundSchema; - /** @deprecated use `BenefitDownloadablesSubscriberType$outboundSchema` instead. */ - export const outboundSchema = - BenefitDownloadablesSubscriberType$outboundSchema; -} - /** @internal */ export const BenefitDownloadablesSubscriber$inboundSchema: z.ZodType< BenefitDownloadablesSubscriber, @@ -133,7 +103,7 @@ export const BenefitDownloadablesSubscriber$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - type: z.literal("downloadables").default("downloadables"), + type: z.literal("downloadables").default("downloadables" as const), description: z.string(), selectable: z.boolean(), deletable: z.boolean(), diff --git a/src/models/components/benefitdownloadablesupdate.ts b/src/models/components/benefitdownloadablesupdate.ts index 50220f25..9398ee51 100644 --- a/src/models/components/benefitdownloadablesupdate.ts +++ b/src/models/components/benefitdownloadablesupdate.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { BenefitDownloadablesCreateProperties$outboundSchema, } from "./benefitdownloadablescreateproperties.js"; -export const BenefitDownloadablesUpdateType = { - Downloadables: "downloadables", -} as const; -export type BenefitDownloadablesUpdateType = ClosedEnum< - typeof BenefitDownloadablesUpdateType ->; - export type BenefitDownloadablesUpdate = { /** * The description of the benefit. Will be displayed on products having this benefit. @@ -30,27 +22,6 @@ export type BenefitDownloadablesUpdate = { properties?: BenefitDownloadablesCreateProperties | null | undefined; }; -/** @internal */ -export const BenefitDownloadablesUpdateType$inboundSchema: z.ZodNativeEnum< - typeof BenefitDownloadablesUpdateType -> = z.nativeEnum(BenefitDownloadablesUpdateType); - -/** @internal */ -export const BenefitDownloadablesUpdateType$outboundSchema: z.ZodNativeEnum< - typeof BenefitDownloadablesUpdateType -> = BenefitDownloadablesUpdateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitDownloadablesUpdateType$ { - /** @deprecated use `BenefitDownloadablesUpdateType$inboundSchema` instead. */ - export const inboundSchema = BenefitDownloadablesUpdateType$inboundSchema; - /** @deprecated use `BenefitDownloadablesUpdateType$outboundSchema` instead. */ - export const outboundSchema = BenefitDownloadablesUpdateType$outboundSchema; -} - /** @internal */ export const BenefitDownloadablesUpdate$inboundSchema: z.ZodType< BenefitDownloadablesUpdate, @@ -77,7 +48,7 @@ export const BenefitDownloadablesUpdate$outboundSchema: z.ZodType< BenefitDownloadablesUpdate > = z.object({ description: z.nullable(z.string()).optional(), - type: z.literal("downloadables").default("downloadables"), + type: z.literal("downloadables").default("downloadables" as const), properties: z.nullable(BenefitDownloadablesCreateProperties$outboundSchema) .optional(), }); diff --git a/src/models/components/benefitgithubrepository.ts b/src/models/components/benefitgithubrepository.ts index 11bdd31f..7a66c348 100644 --- a/src/models/components/benefitgithubrepository.ts +++ b/src/models/components/benefitgithubrepository.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,13 +14,6 @@ import { BenefitGitHubRepositoryProperties$outboundSchema, } from "./benefitgithubrepositoryproperties.js"; -export const BenefitGitHubRepositoryType = { - GithubRepository: "github_repository", -} as const; -export type BenefitGitHubRepositoryType = ClosedEnum< - typeof BenefitGitHubRepositoryType ->; - /** * A benefit of type `github_repository`. * @@ -65,27 +57,6 @@ export type BenefitGitHubRepository = { properties: BenefitGitHubRepositoryProperties; }; -/** @internal */ -export const BenefitGitHubRepositoryType$inboundSchema: z.ZodNativeEnum< - typeof BenefitGitHubRepositoryType -> = z.nativeEnum(BenefitGitHubRepositoryType); - -/** @internal */ -export const BenefitGitHubRepositoryType$outboundSchema: z.ZodNativeEnum< - typeof BenefitGitHubRepositoryType -> = BenefitGitHubRepositoryType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitGitHubRepositoryType$ { - /** @deprecated use `BenefitGitHubRepositoryType$inboundSchema` instead. */ - export const inboundSchema = BenefitGitHubRepositoryType$inboundSchema; - /** @deprecated use `BenefitGitHubRepositoryType$outboundSchema` instead. */ - export const outboundSchema = BenefitGitHubRepositoryType$outboundSchema; -} - /** @internal */ export const BenefitGitHubRepository$inboundSchema: z.ZodType< BenefitGitHubRepository, @@ -133,7 +104,7 @@ export const BenefitGitHubRepository$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - type: z.literal("github_repository").default("github_repository"), + type: z.literal("github_repository").default("github_repository" as const), description: z.string(), selectable: z.boolean(), deletable: z.boolean(), diff --git a/src/models/components/benefitgithubrepositorycreate.ts b/src/models/components/benefitgithubrepositorycreate.ts index 0a9f3ec9..8b32168c 100644 --- a/src/models/components/benefitgithubrepositorycreate.ts +++ b/src/models/components/benefitgithubrepositorycreate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,13 +14,6 @@ import { BenefitGitHubRepositoryCreateProperties$outboundSchema, } from "./benefitgithubrepositorycreateproperties.js"; -export const BenefitGitHubRepositoryCreateType = { - GithubRepository: "github_repository", -} as const; -export type BenefitGitHubRepositoryCreateType = ClosedEnum< - typeof BenefitGitHubRepositoryCreateType ->; - export type BenefitGitHubRepositoryCreate = { type?: "github_repository" | undefined; /** @@ -38,28 +30,6 @@ export type BenefitGitHubRepositoryCreate = { properties: BenefitGitHubRepositoryCreateProperties; }; -/** @internal */ -export const BenefitGitHubRepositoryCreateType$inboundSchema: z.ZodNativeEnum< - typeof BenefitGitHubRepositoryCreateType -> = z.nativeEnum(BenefitGitHubRepositoryCreateType); - -/** @internal */ -export const BenefitGitHubRepositoryCreateType$outboundSchema: z.ZodNativeEnum< - typeof BenefitGitHubRepositoryCreateType -> = BenefitGitHubRepositoryCreateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitGitHubRepositoryCreateType$ { - /** @deprecated use `BenefitGitHubRepositoryCreateType$inboundSchema` instead. */ - export const inboundSchema = BenefitGitHubRepositoryCreateType$inboundSchema; - /** @deprecated use `BenefitGitHubRepositoryCreateType$outboundSchema` instead. */ - export const outboundSchema = - BenefitGitHubRepositoryCreateType$outboundSchema; -} - /** @internal */ export const BenefitGitHubRepositoryCreate$inboundSchema: z.ZodType< BenefitGitHubRepositoryCreate, @@ -90,7 +60,7 @@ export const BenefitGitHubRepositoryCreate$outboundSchema: z.ZodType< z.ZodTypeDef, BenefitGitHubRepositoryCreate > = z.object({ - type: z.literal("github_repository").default("github_repository"), + type: z.literal("github_repository").default("github_repository" as const), description: z.string(), organizationId: z.nullable(z.string()).optional(), properties: BenefitGitHubRepositoryCreateProperties$outboundSchema, diff --git a/src/models/components/benefitgithubrepositorysubscriber.ts b/src/models/components/benefitgithubrepositorysubscriber.ts index bb29da56..bc535faa 100644 --- a/src/models/components/benefitgithubrepositorysubscriber.ts +++ b/src/models/components/benefitgithubrepositorysubscriber.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -21,13 +20,6 @@ import { Organization$outboundSchema, } from "./organization.js"; -export const BenefitGitHubRepositorySubscriberType = { - GithubRepository: "github_repository", -} as const; -export type BenefitGitHubRepositorySubscriberType = ClosedEnum< - typeof BenefitGitHubRepositorySubscriberType ->; - export type BenefitGitHubRepositorySubscriber = { /** * Creation timestamp of the object. @@ -65,30 +57,6 @@ export type BenefitGitHubRepositorySubscriber = { properties: BenefitGitHubRepositorySubscriberProperties; }; -/** @internal */ -export const BenefitGitHubRepositorySubscriberType$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - BenefitGitHubRepositorySubscriberType, - ); - -/** @internal */ -export const BenefitGitHubRepositorySubscriberType$outboundSchema: - z.ZodNativeEnum = - BenefitGitHubRepositorySubscriberType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitGitHubRepositorySubscriberType$ { - /** @deprecated use `BenefitGitHubRepositorySubscriberType$inboundSchema` instead. */ - export const inboundSchema = - BenefitGitHubRepositorySubscriberType$inboundSchema; - /** @deprecated use `BenefitGitHubRepositorySubscriberType$outboundSchema` instead. */ - export const outboundSchema = - BenefitGitHubRepositorySubscriberType$outboundSchema; -} - /** @internal */ export const BenefitGitHubRepositorySubscriber$inboundSchema: z.ZodType< BenefitGitHubRepositorySubscriber, @@ -138,7 +106,7 @@ export const BenefitGitHubRepositorySubscriber$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - type: z.literal("github_repository").default("github_repository"), + type: z.literal("github_repository").default("github_repository" as const), description: z.string(), selectable: z.boolean(), deletable: z.boolean(), diff --git a/src/models/components/benefitgithubrepositoryupdate.ts b/src/models/components/benefitgithubrepositoryupdate.ts index f7a860d8..a1c5868e 100644 --- a/src/models/components/benefitgithubrepositoryupdate.ts +++ b/src/models/components/benefitgithubrepositoryupdate.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { BenefitGitHubRepositoryCreateProperties$outboundSchema, } from "./benefitgithubrepositorycreateproperties.js"; -export const BenefitGitHubRepositoryUpdateType = { - GithubRepository: "github_repository", -} as const; -export type BenefitGitHubRepositoryUpdateType = ClosedEnum< - typeof BenefitGitHubRepositoryUpdateType ->; - export type BenefitGitHubRepositoryUpdate = { /** * The description of the benefit. Will be displayed on products having this benefit. @@ -30,28 +22,6 @@ export type BenefitGitHubRepositoryUpdate = { properties?: BenefitGitHubRepositoryCreateProperties | null | undefined; }; -/** @internal */ -export const BenefitGitHubRepositoryUpdateType$inboundSchema: z.ZodNativeEnum< - typeof BenefitGitHubRepositoryUpdateType -> = z.nativeEnum(BenefitGitHubRepositoryUpdateType); - -/** @internal */ -export const BenefitGitHubRepositoryUpdateType$outboundSchema: z.ZodNativeEnum< - typeof BenefitGitHubRepositoryUpdateType -> = BenefitGitHubRepositoryUpdateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitGitHubRepositoryUpdateType$ { - /** @deprecated use `BenefitGitHubRepositoryUpdateType$inboundSchema` instead. */ - export const inboundSchema = BenefitGitHubRepositoryUpdateType$inboundSchema; - /** @deprecated use `BenefitGitHubRepositoryUpdateType$outboundSchema` instead. */ - export const outboundSchema = - BenefitGitHubRepositoryUpdateType$outboundSchema; -} - /** @internal */ export const BenefitGitHubRepositoryUpdate$inboundSchema: z.ZodType< BenefitGitHubRepositoryUpdate, @@ -81,7 +51,7 @@ export const BenefitGitHubRepositoryUpdate$outboundSchema: z.ZodType< BenefitGitHubRepositoryUpdate > = z.object({ description: z.nullable(z.string()).optional(), - type: z.literal("github_repository").default("github_repository"), + type: z.literal("github_repository").default("github_repository" as const), properties: z.nullable(BenefitGitHubRepositoryCreateProperties$outboundSchema) .optional(), }); diff --git a/src/models/components/benefitgrant.ts b/src/models/components/benefitgrant.ts index 1c327693..a43126ae 100644 --- a/src/models/components/benefitgrant.ts +++ b/src/models/components/benefitgrant.ts @@ -43,6 +43,12 @@ import { BenefitGrantLicenseKeysProperties$Outbound, BenefitGrantLicenseKeysProperties$outboundSchema, } from "./benefitgrantlicensekeysproperties.js"; +import { + Customer, + Customer$inboundSchema, + Customer$Outbound, + Customer$outboundSchema, +} from "./customer.js"; export type Properties = | BenefitGrantCustomProperties @@ -101,6 +107,10 @@ export type BenefitGrant = { * The ID of the benefit concerned by this grant. */ benefitId: string; + /** + * A customer in an organization. + */ + customer: Customer; properties: | BenefitGrantCustomProperties | BenefitGrantDownloadablesProperties @@ -198,6 +208,7 @@ export const BenefitGrant$inboundSchema: z.ZodType< customer_id: z.string(), user_id: z.string(), benefit_id: z.string(), + customer: Customer$inboundSchema, properties: z.union([ BenefitGrantCustomProperties$inboundSchema, BenefitGrantDownloadablesProperties$inboundSchema, @@ -236,6 +247,7 @@ export type BenefitGrant$Outbound = { customer_id: string; user_id: string; benefit_id: string; + customer: Customer$Outbound; properties: | BenefitGrantCustomProperties$Outbound | BenefitGrantDownloadablesProperties$Outbound @@ -263,6 +275,7 @@ export const BenefitGrant$outboundSchema: z.ZodType< customerId: z.string(), userId: z.string(), benefitId: z.string(), + customer: Customer$outboundSchema, properties: z.union([ BenefitGrantCustomProperties$outboundSchema, BenefitGrantDownloadablesProperties$outboundSchema, diff --git a/src/models/components/benefitgrantwebhook.ts b/src/models/components/benefitgrantwebhook.ts index 8d27a53a..f478ed12 100644 --- a/src/models/components/benefitgrantwebhook.ts +++ b/src/models/components/benefitgrantwebhook.ts @@ -49,6 +49,12 @@ import { BenefitGrantLicenseKeysProperties$Outbound, BenefitGrantLicenseKeysProperties$outboundSchema, } from "./benefitgrantlicensekeysproperties.js"; +import { + Customer, + Customer$inboundSchema, + Customer$Outbound, + Customer$outboundSchema, +} from "./customer.js"; export type BenefitGrantWebhookProperties = | BenefitGrantCustomProperties @@ -115,6 +121,10 @@ export type BenefitGrantWebhook = { * The ID of the benefit concerned by this grant. */ benefitId: string; + /** + * A customer in an organization. + */ + customer: Customer; properties: | BenefitGrantCustomProperties | BenefitGrantDownloadablesProperties @@ -296,6 +306,7 @@ export const BenefitGrantWebhook$inboundSchema: z.ZodType< customer_id: z.string(), user_id: z.string(), benefit_id: z.string(), + customer: Customer$inboundSchema, properties: z.union([ BenefitGrantCustomProperties$inboundSchema, BenefitGrantDownloadablesProperties$inboundSchema, @@ -346,6 +357,7 @@ export type BenefitGrantWebhook$Outbound = { customer_id: string; user_id: string; benefit_id: string; + customer: Customer$Outbound; properties: | BenefitGrantCustomProperties$Outbound | BenefitGrantDownloadablesProperties$Outbound @@ -383,6 +395,7 @@ export const BenefitGrantWebhook$outboundSchema: z.ZodType< customerId: z.string(), userId: z.string(), benefitId: z.string(), + customer: Customer$outboundSchema, properties: z.union([ BenefitGrantCustomProperties$outboundSchema, BenefitGrantDownloadablesProperties$outboundSchema, diff --git a/src/models/components/benefitlicensekeys.ts b/src/models/components/benefitlicensekeys.ts index 2291492c..38d120e8 100644 --- a/src/models/components/benefitlicensekeys.ts +++ b/src/models/components/benefitlicensekeys.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,11 +14,6 @@ import { BenefitLicenseKeysProperties$outboundSchema, } from "./benefitlicensekeysproperties.js"; -export const BenefitLicenseKeysType = { - LicenseKeys: "license_keys", -} as const; -export type BenefitLicenseKeysType = ClosedEnum; - export type BenefitLicenseKeys = { /** * Creation timestamp of the object. @@ -53,27 +47,6 @@ export type BenefitLicenseKeys = { properties: BenefitLicenseKeysProperties; }; -/** @internal */ -export const BenefitLicenseKeysType$inboundSchema: z.ZodNativeEnum< - typeof BenefitLicenseKeysType -> = z.nativeEnum(BenefitLicenseKeysType); - -/** @internal */ -export const BenefitLicenseKeysType$outboundSchema: z.ZodNativeEnum< - typeof BenefitLicenseKeysType -> = BenefitLicenseKeysType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitLicenseKeysType$ { - /** @deprecated use `BenefitLicenseKeysType$inboundSchema` instead. */ - export const inboundSchema = BenefitLicenseKeysType$inboundSchema; - /** @deprecated use `BenefitLicenseKeysType$outboundSchema` instead. */ - export const outboundSchema = BenefitLicenseKeysType$outboundSchema; -} - /** @internal */ export const BenefitLicenseKeys$inboundSchema: z.ZodType< BenefitLicenseKeys, @@ -121,7 +94,7 @@ export const BenefitLicenseKeys$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - type: z.literal("license_keys").default("license_keys"), + type: z.literal("license_keys").default("license_keys" as const), description: z.string(), selectable: z.boolean(), deletable: z.boolean(), diff --git a/src/models/components/benefitlicensekeyscreate.ts b/src/models/components/benefitlicensekeyscreate.ts index 48de12da..bdcae86a 100644 --- a/src/models/components/benefitlicensekeyscreate.ts +++ b/src/models/components/benefitlicensekeyscreate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,13 +14,6 @@ import { BenefitLicenseKeysCreateProperties$outboundSchema, } from "./benefitlicensekeyscreateproperties.js"; -export const BenefitLicenseKeysCreateType = { - LicenseKeys: "license_keys", -} as const; -export type BenefitLicenseKeysCreateType = ClosedEnum< - typeof BenefitLicenseKeysCreateType ->; - export type BenefitLicenseKeysCreate = { type?: "license_keys" | undefined; /** @@ -35,27 +27,6 @@ export type BenefitLicenseKeysCreate = { properties: BenefitLicenseKeysCreateProperties; }; -/** @internal */ -export const BenefitLicenseKeysCreateType$inboundSchema: z.ZodNativeEnum< - typeof BenefitLicenseKeysCreateType -> = z.nativeEnum(BenefitLicenseKeysCreateType); - -/** @internal */ -export const BenefitLicenseKeysCreateType$outboundSchema: z.ZodNativeEnum< - typeof BenefitLicenseKeysCreateType -> = BenefitLicenseKeysCreateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitLicenseKeysCreateType$ { - /** @deprecated use `BenefitLicenseKeysCreateType$inboundSchema` instead. */ - export const inboundSchema = BenefitLicenseKeysCreateType$inboundSchema; - /** @deprecated use `BenefitLicenseKeysCreateType$outboundSchema` instead. */ - export const outboundSchema = BenefitLicenseKeysCreateType$outboundSchema; -} - /** @internal */ export const BenefitLicenseKeysCreate$inboundSchema: z.ZodType< BenefitLicenseKeysCreate, @@ -86,7 +57,7 @@ export const BenefitLicenseKeysCreate$outboundSchema: z.ZodType< z.ZodTypeDef, BenefitLicenseKeysCreate > = z.object({ - type: z.literal("license_keys").default("license_keys"), + type: z.literal("license_keys").default("license_keys" as const), description: z.string(), organizationId: z.nullable(z.string()).optional(), properties: BenefitLicenseKeysCreateProperties$outboundSchema, diff --git a/src/models/components/benefitlicensekeyssubscriber.ts b/src/models/components/benefitlicensekeyssubscriber.ts index e927ec8d..f9ec734c 100644 --- a/src/models/components/benefitlicensekeyssubscriber.ts +++ b/src/models/components/benefitlicensekeyssubscriber.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -21,13 +20,6 @@ import { Organization$outboundSchema, } from "./organization.js"; -export const BenefitLicenseKeysSubscriberType = { - LicenseKeys: "license_keys", -} as const; -export type BenefitLicenseKeysSubscriberType = ClosedEnum< - typeof BenefitLicenseKeysSubscriberType ->; - export type BenefitLicenseKeysSubscriber = { /** * Creation timestamp of the object. @@ -62,27 +54,6 @@ export type BenefitLicenseKeysSubscriber = { properties: BenefitLicenseKeysSubscriberProperties; }; -/** @internal */ -export const BenefitLicenseKeysSubscriberType$inboundSchema: z.ZodNativeEnum< - typeof BenefitLicenseKeysSubscriberType -> = z.nativeEnum(BenefitLicenseKeysSubscriberType); - -/** @internal */ -export const BenefitLicenseKeysSubscriberType$outboundSchema: z.ZodNativeEnum< - typeof BenefitLicenseKeysSubscriberType -> = BenefitLicenseKeysSubscriberType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitLicenseKeysSubscriberType$ { - /** @deprecated use `BenefitLicenseKeysSubscriberType$inboundSchema` instead. */ - export const inboundSchema = BenefitLicenseKeysSubscriberType$inboundSchema; - /** @deprecated use `BenefitLicenseKeysSubscriberType$outboundSchema` instead. */ - export const outboundSchema = BenefitLicenseKeysSubscriberType$outboundSchema; -} - /** @internal */ export const BenefitLicenseKeysSubscriber$inboundSchema: z.ZodType< BenefitLicenseKeysSubscriber, @@ -132,7 +103,7 @@ export const BenefitLicenseKeysSubscriber$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - type: z.literal("license_keys").default("license_keys"), + type: z.literal("license_keys").default("license_keys" as const), description: z.string(), selectable: z.boolean(), deletable: z.boolean(), diff --git a/src/models/components/benefitlicensekeysupdate.ts b/src/models/components/benefitlicensekeysupdate.ts index 2f1e6a04..b494155d 100644 --- a/src/models/components/benefitlicensekeysupdate.ts +++ b/src/models/components/benefitlicensekeysupdate.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { BenefitLicenseKeysCreateProperties$outboundSchema, } from "./benefitlicensekeyscreateproperties.js"; -export const BenefitLicenseKeysUpdateType = { - LicenseKeys: "license_keys", -} as const; -export type BenefitLicenseKeysUpdateType = ClosedEnum< - typeof BenefitLicenseKeysUpdateType ->; - export type BenefitLicenseKeysUpdate = { /** * The description of the benefit. Will be displayed on products having this benefit. @@ -30,27 +22,6 @@ export type BenefitLicenseKeysUpdate = { properties?: BenefitLicenseKeysCreateProperties | null | undefined; }; -/** @internal */ -export const BenefitLicenseKeysUpdateType$inboundSchema: z.ZodNativeEnum< - typeof BenefitLicenseKeysUpdateType -> = z.nativeEnum(BenefitLicenseKeysUpdateType); - -/** @internal */ -export const BenefitLicenseKeysUpdateType$outboundSchema: z.ZodNativeEnum< - typeof BenefitLicenseKeysUpdateType -> = BenefitLicenseKeysUpdateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace BenefitLicenseKeysUpdateType$ { - /** @deprecated use `BenefitLicenseKeysUpdateType$inboundSchema` instead. */ - export const inboundSchema = BenefitLicenseKeysUpdateType$inboundSchema; - /** @deprecated use `BenefitLicenseKeysUpdateType$outboundSchema` instead. */ - export const outboundSchema = BenefitLicenseKeysUpdateType$outboundSchema; -} - /** @internal */ export const BenefitLicenseKeysUpdate$inboundSchema: z.ZodType< BenefitLicenseKeysUpdate, @@ -77,7 +48,7 @@ export const BenefitLicenseKeysUpdate$outboundSchema: z.ZodType< BenefitLicenseKeysUpdate > = z.object({ description: z.nullable(z.string()).optional(), - type: z.literal("license_keys").default("license_keys"), + type: z.literal("license_keys").default("license_keys" as const), properties: z.nullable(BenefitLicenseKeysCreateProperties$outboundSchema) .optional(), }); diff --git a/src/models/components/checkout.ts b/src/models/components/checkout.ts index 8e5c4f00..10ebf5a7 100644 --- a/src/models/components/checkout.ts +++ b/src/models/components/checkout.ts @@ -54,6 +54,11 @@ import { CheckoutStatus$inboundSchema, CheckoutStatus$outboundSchema, } from "./checkoutstatus.js"; +import { + PaymentProcessor, + PaymentProcessor$inboundSchema, + PaymentProcessor$outboundSchema, +} from "./paymentprocessor.js"; import { ProductPrice, ProductPrice$inboundSchema, @@ -98,7 +103,7 @@ export type Checkout = { * Key-value object storing custom field values. */ customFieldData?: CheckoutCustomFieldData | undefined; - paymentProcessor?: "stripe" | undefined; + paymentProcessor: PaymentProcessor; status: CheckoutStatus; /** * Client secret used to update and complete the checkout session from the client. @@ -464,7 +469,7 @@ export const Checkout$inboundSchema: z.ZodType< id: z.string(), custom_field_data: z.lazy(() => CheckoutCustomFieldData$inboundSchema) .optional(), - payment_processor: z.literal("stripe").optional(), + payment_processor: PaymentProcessor$inboundSchema, status: CheckoutStatus$inboundSchema, client_secret: z.string(), url: z.string(), @@ -552,7 +557,7 @@ export type Checkout$Outbound = { modified_at: string | null; id: string; custom_field_data?: CheckoutCustomFieldData$Outbound | undefined; - payment_processor: "stripe"; + payment_processor: string; status: string; client_secret: string; url: string; @@ -605,7 +610,7 @@ export const Checkout$outboundSchema: z.ZodType< id: z.string(), customFieldData: z.lazy(() => CheckoutCustomFieldData$outboundSchema) .optional(), - paymentProcessor: z.literal("stripe").default("stripe"), + paymentProcessor: PaymentProcessor$outboundSchema, status: CheckoutStatus$outboundSchema, clientSecret: z.string(), url: z.string(), diff --git a/src/models/components/checkoutlink.ts b/src/models/components/checkoutlink.ts index f7e71ab5..03e5b0e7 100644 --- a/src/models/components/checkoutlink.ts +++ b/src/models/components/checkoutlink.ts @@ -37,6 +37,11 @@ import { DiscountPercentageRepeatDurationBase$Outbound, DiscountPercentageRepeatDurationBase$outboundSchema, } from "./discountpercentagerepeatdurationbase.js"; +import { + PaymentProcessor, + PaymentProcessor$inboundSchema, + PaymentProcessor$outboundSchema, +} from "./paymentprocessor.js"; import { ProductPrice, ProductPrice$inboundSchema, @@ -69,7 +74,7 @@ export type CheckoutLink = { */ id: string; metadata: { [k: string]: string | number | boolean }; - paymentProcessor?: "stripe" | undefined; + paymentProcessor: PaymentProcessor; /** * Client secret used to access the checkout link. */ @@ -234,7 +239,7 @@ export const CheckoutLink$inboundSchema: z.ZodType< ), id: z.string(), metadata: z.record(z.union([z.string(), z.number().int(), z.boolean()])), - payment_processor: z.literal("stripe").optional(), + payment_processor: PaymentProcessor$inboundSchema, client_secret: z.string(), success_url: z.nullable(z.string()), label: z.nullable(z.string()), @@ -274,7 +279,7 @@ export type CheckoutLink$Outbound = { modified_at: string | null; id: string; metadata: { [k: string]: string | number | boolean }; - payment_processor: "stripe"; + payment_processor: string; client_secret: string; success_url: string | null; label: string | null; @@ -303,7 +308,7 @@ export const CheckoutLink$outboundSchema: z.ZodType< modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), metadata: z.record(z.union([z.string(), z.number().int(), z.boolean()])), - paymentProcessor: z.literal("stripe").default("stripe"), + paymentProcessor: PaymentProcessor$outboundSchema, clientSecret: z.string(), successUrl: z.nullable(z.string()), label: z.nullable(z.string()), diff --git a/src/models/components/checkoutlinkpricecreate.ts b/src/models/components/checkoutlinkpricecreate.ts index ae5e3f7e..857d750b 100644 --- a/src/models/components/checkoutlinkpricecreate.ts +++ b/src/models/components/checkoutlinkpricecreate.ts @@ -5,25 +5,11 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; export type CheckoutLinkPriceCreateMetadata = string | number | boolean; -/** - * Payment processor to use. Currently only Stripe is supported. - */ -export const CheckoutLinkPriceCreatePaymentProcessor = { - Stripe: "stripe", -} as const; -/** - * Payment processor to use. Currently only Stripe is supported. - */ -export type CheckoutLinkPriceCreatePaymentProcessor = ClosedEnum< - typeof CheckoutLinkPriceCreatePaymentProcessor ->; - export type CheckoutLinkPriceCreate = { /** * Key-value object allowing you to store additional information. @@ -119,29 +105,6 @@ export function checkoutLinkPriceCreateMetadataFromJSON( ); } -/** @internal */ -export const CheckoutLinkPriceCreatePaymentProcessor$inboundSchema: - z.ZodNativeEnum = z - .nativeEnum(CheckoutLinkPriceCreatePaymentProcessor); - -/** @internal */ -export const CheckoutLinkPriceCreatePaymentProcessor$outboundSchema: - z.ZodNativeEnum = - CheckoutLinkPriceCreatePaymentProcessor$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CheckoutLinkPriceCreatePaymentProcessor$ { - /** @deprecated use `CheckoutLinkPriceCreatePaymentProcessor$inboundSchema` instead. */ - export const inboundSchema = - CheckoutLinkPriceCreatePaymentProcessor$inboundSchema; - /** @deprecated use `CheckoutLinkPriceCreatePaymentProcessor$outboundSchema` instead. */ - export const outboundSchema = - CheckoutLinkPriceCreatePaymentProcessor$outboundSchema; -} - /** @internal */ export const CheckoutLinkPriceCreate$inboundSchema: z.ZodType< CheckoutLinkPriceCreate, @@ -185,7 +148,7 @@ export const CheckoutLinkPriceCreate$outboundSchema: z.ZodType< > = z.object({ metadata: z.record(z.union([z.string(), z.number().int(), z.boolean()])) .optional(), - paymentProcessor: z.literal("stripe").default("stripe"), + paymentProcessor: z.literal("stripe").default("stripe" as const), label: z.nullable(z.string()).optional(), allowDiscountCodes: z.boolean().default(true), discountId: z.nullable(z.string()).optional(), diff --git a/src/models/components/checkoutlinkproductcreate.ts b/src/models/components/checkoutlinkproductcreate.ts index 6f05b3ad..da0c118b 100644 --- a/src/models/components/checkoutlinkproductcreate.ts +++ b/src/models/components/checkoutlinkproductcreate.ts @@ -5,25 +5,11 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; export type CheckoutLinkProductCreateMetadata = string | number | boolean; -/** - * Payment processor to use. Currently only Stripe is supported. - */ -export const CheckoutLinkProductCreatePaymentProcessor = { - Stripe: "stripe", -} as const; -/** - * Payment processor to use. Currently only Stripe is supported. - */ -export type CheckoutLinkProductCreatePaymentProcessor = ClosedEnum< - typeof CheckoutLinkProductCreatePaymentProcessor ->; - export type CheckoutLinkProductCreate = { /** * Key-value object allowing you to store additional information. @@ -120,29 +106,6 @@ export function checkoutLinkProductCreateMetadataFromJSON( ); } -/** @internal */ -export const CheckoutLinkProductCreatePaymentProcessor$inboundSchema: - z.ZodNativeEnum = z - .nativeEnum(CheckoutLinkProductCreatePaymentProcessor); - -/** @internal */ -export const CheckoutLinkProductCreatePaymentProcessor$outboundSchema: - z.ZodNativeEnum = - CheckoutLinkProductCreatePaymentProcessor$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CheckoutLinkProductCreatePaymentProcessor$ { - /** @deprecated use `CheckoutLinkProductCreatePaymentProcessor$inboundSchema` instead. */ - export const inboundSchema = - CheckoutLinkProductCreatePaymentProcessor$inboundSchema; - /** @deprecated use `CheckoutLinkProductCreatePaymentProcessor$outboundSchema` instead. */ - export const outboundSchema = - CheckoutLinkProductCreatePaymentProcessor$outboundSchema; -} - /** @internal */ export const CheckoutLinkProductCreate$inboundSchema: z.ZodType< CheckoutLinkProductCreate, @@ -186,7 +149,7 @@ export const CheckoutLinkProductCreate$outboundSchema: z.ZodType< > = z.object({ metadata: z.record(z.union([z.string(), z.number().int(), z.boolean()])) .optional(), - paymentProcessor: z.literal("stripe").default("stripe"), + paymentProcessor: z.literal("stripe").default("stripe" as const), label: z.nullable(z.string()).optional(), allowDiscountCodes: z.boolean().default(true), discountId: z.nullable(z.string()).optional(), diff --git a/src/models/components/checkoutpricecreate.ts b/src/models/components/checkoutpricecreate.ts index adfe662d..2fedb993 100644 --- a/src/models/components/checkoutpricecreate.ts +++ b/src/models/components/checkoutpricecreate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -22,19 +21,6 @@ export type CheckoutPriceCreateMetadata = string | number | boolean; */ export type CheckoutPriceCreateCustomFieldData = {}; -/** - * Payment processor to use. Currently only Stripe is supported. - */ -export const CheckoutPriceCreatePaymentProcessor = { - Stripe: "stripe", -} as const; -/** - * Payment processor to use. Currently only Stripe is supported. - */ -export type CheckoutPriceCreatePaymentProcessor = ClosedEnum< - typeof CheckoutPriceCreatePaymentProcessor ->; - export type CheckoutPriceCreateCustomerMetadata = string | number | boolean; /** @@ -65,10 +51,6 @@ export type CheckoutPriceCreate = { * Key-value object storing custom field values. */ customFieldData?: CheckoutPriceCreateCustomFieldData | undefined; - /** - * Payment processor to use. Currently only Stripe is supported. - */ - paymentProcessor?: "stripe" | undefined; /** * ID of the discount to apply to the checkout. */ @@ -222,29 +204,6 @@ export function checkoutPriceCreateCustomFieldDataFromJSON( ); } -/** @internal */ -export const CheckoutPriceCreatePaymentProcessor$inboundSchema: z.ZodNativeEnum< - typeof CheckoutPriceCreatePaymentProcessor -> = z.nativeEnum(CheckoutPriceCreatePaymentProcessor); - -/** @internal */ -export const CheckoutPriceCreatePaymentProcessor$outboundSchema: - z.ZodNativeEnum = - CheckoutPriceCreatePaymentProcessor$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CheckoutPriceCreatePaymentProcessor$ { - /** @deprecated use `CheckoutPriceCreatePaymentProcessor$inboundSchema` instead. */ - export const inboundSchema = - CheckoutPriceCreatePaymentProcessor$inboundSchema; - /** @deprecated use `CheckoutPriceCreatePaymentProcessor$outboundSchema` instead. */ - export const outboundSchema = - CheckoutPriceCreatePaymentProcessor$outboundSchema; -} - /** @internal */ export const CheckoutPriceCreateCustomerMetadata$inboundSchema: z.ZodType< CheckoutPriceCreateCustomerMetadata, @@ -312,7 +271,6 @@ export const CheckoutPriceCreate$inboundSchema: z.ZodType< custom_field_data: z.lazy(() => CheckoutPriceCreateCustomFieldData$inboundSchema ).optional(), - payment_processor: z.literal("stripe").optional(), discount_id: z.nullable(z.string()).optional(), allow_discount_codes: z.boolean().default(true), amount: z.nullable(z.number().int()).optional(), @@ -332,7 +290,6 @@ export const CheckoutPriceCreate$inboundSchema: z.ZodType< }).transform((v) => { return remap$(v, { "custom_field_data": "customFieldData", - "payment_processor": "paymentProcessor", "discount_id": "discountId", "allow_discount_codes": "allowDiscountCodes", "customer_id": "customerId", @@ -353,7 +310,6 @@ export const CheckoutPriceCreate$inboundSchema: z.ZodType< export type CheckoutPriceCreate$Outbound = { metadata?: { [k: string]: string | number | boolean } | undefined; custom_field_data?: CheckoutPriceCreateCustomFieldData$Outbound | undefined; - payment_processor: "stripe"; discount_id?: string | null | undefined; allow_discount_codes: boolean; amount?: number | null | undefined; @@ -381,7 +337,6 @@ export const CheckoutPriceCreate$outboundSchema: z.ZodType< customFieldData: z.lazy(() => CheckoutPriceCreateCustomFieldData$outboundSchema ).optional(), - paymentProcessor: z.literal("stripe").default("stripe"), discountId: z.nullable(z.string()).optional(), allowDiscountCodes: z.boolean().default(true), amount: z.nullable(z.number().int()).optional(), @@ -401,7 +356,6 @@ export const CheckoutPriceCreate$outboundSchema: z.ZodType< }).transform((v) => { return remap$(v, { customFieldData: "custom_field_data", - paymentProcessor: "payment_processor", discountId: "discount_id", allowDiscountCodes: "allow_discount_codes", customerId: "customer_id", diff --git a/src/models/components/checkoutproductcreate.ts b/src/models/components/checkoutproductcreate.ts index 624fb551..1e244eec 100644 --- a/src/models/components/checkoutproductcreate.ts +++ b/src/models/components/checkoutproductcreate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -22,19 +21,6 @@ export type CheckoutProductCreateMetadata = string | number | boolean; */ export type CheckoutProductCreateCustomFieldData = {}; -/** - * Payment processor to use. Currently only Stripe is supported. - */ -export const CheckoutProductCreatePaymentProcessor = { - Stripe: "stripe", -} as const; -/** - * Payment processor to use. Currently only Stripe is supported. - */ -export type CheckoutProductCreatePaymentProcessor = ClosedEnum< - typeof CheckoutProductCreatePaymentProcessor ->; - export type CheckoutProductCreateCustomerMetadata = string | number | boolean; /** @@ -65,10 +51,6 @@ export type CheckoutProductCreate = { * Key-value object storing custom field values. */ customFieldData?: CheckoutProductCreateCustomFieldData | undefined; - /** - * Payment processor to use. Currently only Stripe is supported. - */ - paymentProcessor?: "stripe" | undefined; /** * ID of the discount to apply to the checkout. */ @@ -223,30 +205,6 @@ export function checkoutProductCreateCustomFieldDataFromJSON( ); } -/** @internal */ -export const CheckoutProductCreatePaymentProcessor$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - CheckoutProductCreatePaymentProcessor, - ); - -/** @internal */ -export const CheckoutProductCreatePaymentProcessor$outboundSchema: - z.ZodNativeEnum = - CheckoutProductCreatePaymentProcessor$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CheckoutProductCreatePaymentProcessor$ { - /** @deprecated use `CheckoutProductCreatePaymentProcessor$inboundSchema` instead. */ - export const inboundSchema = - CheckoutProductCreatePaymentProcessor$inboundSchema; - /** @deprecated use `CheckoutProductCreatePaymentProcessor$outboundSchema` instead. */ - export const outboundSchema = - CheckoutProductCreatePaymentProcessor$outboundSchema; -} - /** @internal */ export const CheckoutProductCreateCustomerMetadata$inboundSchema: z.ZodType< CheckoutProductCreateCustomerMetadata, @@ -314,7 +272,6 @@ export const CheckoutProductCreate$inboundSchema: z.ZodType< custom_field_data: z.lazy(() => CheckoutProductCreateCustomFieldData$inboundSchema ).optional(), - payment_processor: z.literal("stripe").optional(), discount_id: z.nullable(z.string()).optional(), allow_discount_codes: z.boolean().default(true), amount: z.nullable(z.number().int()).optional(), @@ -334,7 +291,6 @@ export const CheckoutProductCreate$inboundSchema: z.ZodType< }).transform((v) => { return remap$(v, { "custom_field_data": "customFieldData", - "payment_processor": "paymentProcessor", "discount_id": "discountId", "allow_discount_codes": "allowDiscountCodes", "customer_id": "customerId", @@ -355,7 +311,6 @@ export const CheckoutProductCreate$inboundSchema: z.ZodType< export type CheckoutProductCreate$Outbound = { metadata?: { [k: string]: string | number | boolean } | undefined; custom_field_data?: CheckoutProductCreateCustomFieldData$Outbound | undefined; - payment_processor: "stripe"; discount_id?: string | null | undefined; allow_discount_codes: boolean; amount?: number | null | undefined; @@ -383,7 +338,6 @@ export const CheckoutProductCreate$outboundSchema: z.ZodType< customFieldData: z.lazy(() => CheckoutProductCreateCustomFieldData$outboundSchema ).optional(), - paymentProcessor: z.literal("stripe").default("stripe"), discountId: z.nullable(z.string()).optional(), allowDiscountCodes: z.boolean().default(true), amount: z.nullable(z.number().int()).optional(), @@ -403,7 +357,6 @@ export const CheckoutProductCreate$outboundSchema: z.ZodType< }).transform((v) => { return remap$(v, { customFieldData: "custom_field_data", - paymentProcessor: "payment_processor", discountId: "discount_id", allowDiscountCodes: "allow_discount_codes", customerId: "customer_id", diff --git a/src/models/components/checkoutpublic.ts b/src/models/components/checkoutpublic.ts index 52e766b1..ba44d824 100644 --- a/src/models/components/checkoutpublic.ts +++ b/src/models/components/checkoutpublic.ts @@ -60,6 +60,11 @@ import { Organization$Outbound, Organization$outboundSchema, } from "./organization.js"; +import { + PaymentProcessor, + PaymentProcessor$inboundSchema, + PaymentProcessor$outboundSchema, +} from "./paymentprocessor.js"; import { ProductPrice, ProductPrice$inboundSchema, @@ -100,7 +105,7 @@ export type CheckoutPublic = { * Key-value object storing custom field values. */ customFieldData?: CheckoutPublicCustomFieldData | undefined; - paymentProcessor?: "stripe" | undefined; + paymentProcessor: PaymentProcessor; status: CheckoutStatus; /** * Client secret used to update and complete the checkout session from the client. @@ -376,7 +381,7 @@ export const CheckoutPublic$inboundSchema: z.ZodType< id: z.string(), custom_field_data: z.lazy(() => CheckoutPublicCustomFieldData$inboundSchema) .optional(), - payment_processor: z.literal("stripe").optional(), + payment_processor: PaymentProcessor$inboundSchema, status: CheckoutStatus$inboundSchema, client_secret: z.string(), url: z.string(), @@ -458,7 +463,7 @@ export type CheckoutPublic$Outbound = { modified_at: string | null; id: string; custom_field_data?: CheckoutPublicCustomFieldData$Outbound | undefined; - payment_processor: "stripe"; + payment_processor: string; status: string; client_secret: string; url: string; @@ -509,7 +514,7 @@ export const CheckoutPublic$outboundSchema: z.ZodType< id: z.string(), customFieldData: z.lazy(() => CheckoutPublicCustomFieldData$outboundSchema) .optional(), - paymentProcessor: z.literal("stripe").default("stripe"), + paymentProcessor: PaymentProcessor$outboundSchema, status: CheckoutStatus$outboundSchema, clientSecret: z.string(), url: z.string(), diff --git a/src/models/components/checkoutpublicconfirmed.ts b/src/models/components/checkoutpublicconfirmed.ts index 17c6bc31..8fd8fc4d 100644 --- a/src/models/components/checkoutpublicconfirmed.ts +++ b/src/models/components/checkoutpublicconfirmed.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -56,6 +55,11 @@ import { Organization$Outbound, Organization$outboundSchema, } from "./organization.js"; +import { + PaymentProcessor, + PaymentProcessor$inboundSchema, + PaymentProcessor$outboundSchema, +} from "./paymentprocessor.js"; import { ProductPrice, ProductPrice$inboundSchema, @@ -68,11 +72,6 @@ import { */ export type CheckoutPublicConfirmedCustomFieldData = {}; -export const Status = { - Confirmed: "confirmed", -} as const; -export type Status = ClosedEnum; - export type CheckoutPublicConfirmedPaymentProcessorMetadata = {}; export type CheckoutPublicConfirmedDiscount = @@ -106,7 +105,7 @@ export type CheckoutPublicConfirmed = { * Key-value object storing custom field values. */ customFieldData?: CheckoutPublicConfirmedCustomFieldData | undefined; - paymentProcessor?: "stripe" | undefined; + paymentProcessor: PaymentProcessor; status?: "confirmed" | undefined; /** * Client secret used to update and complete the checkout session from the client. @@ -258,25 +257,6 @@ export function checkoutPublicConfirmedCustomFieldDataFromJSON( ); } -/** @internal */ -export const Status$inboundSchema: z.ZodNativeEnum = z - .nativeEnum(Status); - -/** @internal */ -export const Status$outboundSchema: z.ZodNativeEnum = - Status$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace Status$ { - /** @deprecated use `Status$inboundSchema` instead. */ - export const inboundSchema = Status$inboundSchema; - /** @deprecated use `Status$outboundSchema` instead. */ - export const outboundSchema = Status$outboundSchema; -} - /** @internal */ export const CheckoutPublicConfirmedPaymentProcessorMetadata$inboundSchema: z.ZodType< @@ -417,7 +397,7 @@ export const CheckoutPublicConfirmed$inboundSchema: z.ZodType< custom_field_data: z.lazy(() => CheckoutPublicConfirmedCustomFieldData$inboundSchema ).optional(), - payment_processor: z.literal("stripe").optional(), + payment_processor: PaymentProcessor$inboundSchema, status: z.literal("confirmed").optional(), client_secret: z.string(), url: z.string(), @@ -503,7 +483,7 @@ export type CheckoutPublicConfirmed$Outbound = { custom_field_data?: | CheckoutPublicConfirmedCustomFieldData$Outbound | undefined; - payment_processor: "stripe"; + payment_processor: string; status: "confirmed"; client_secret: string; url: string; @@ -557,8 +537,8 @@ export const CheckoutPublicConfirmed$outboundSchema: z.ZodType< customFieldData: z.lazy(() => CheckoutPublicConfirmedCustomFieldData$outboundSchema ).optional(), - paymentProcessor: z.literal("stripe").default("stripe"), - status: z.literal("confirmed").default("confirmed"), + paymentProcessor: PaymentProcessor$outboundSchema, + status: z.literal("confirmed").default("confirmed" as const), clientSecret: z.string(), url: z.string(), expiresAt: z.date().transform(v => v.toISOString()), diff --git a/src/models/components/customerbenefitgrantads.ts b/src/models/components/customerbenefitgrantads.ts index dd2dfdbd..1802eeef 100644 --- a/src/models/components/customerbenefitgrantads.ts +++ b/src/models/components/customerbenefitgrantads.ts @@ -19,6 +19,12 @@ import { BenefitGrantAdsProperties$Outbound, BenefitGrantAdsProperties$outboundSchema, } from "./benefitgrantadsproperties.js"; +import { + CustomerPortalCustomer, + CustomerPortalCustomer$inboundSchema, + CustomerPortalCustomer$Outbound, + CustomerPortalCustomer$outboundSchema, +} from "./customerportalcustomer.js"; export type CustomerBenefitGrantAds = { /** @@ -41,6 +47,7 @@ export type CustomerBenefitGrantAds = { orderId: string | null; isGranted: boolean; isRevoked: boolean; + customer: CustomerPortalCustomer; benefit: BenefitAdsSubscriber; properties: BenefitGrantAdsProperties; }; @@ -68,6 +75,7 @@ export const CustomerBenefitGrantAds$inboundSchema: z.ZodType< order_id: z.nullable(z.string()), is_granted: z.boolean(), is_revoked: z.boolean(), + customer: CustomerPortalCustomer$inboundSchema, benefit: BenefitAdsSubscriber$inboundSchema, properties: BenefitGrantAdsProperties$inboundSchema, }).transform((v) => { @@ -98,6 +106,7 @@ export type CustomerBenefitGrantAds$Outbound = { order_id: string | null; is_granted: boolean; is_revoked: boolean; + customer: CustomerPortalCustomer$Outbound; benefit: BenefitAdsSubscriber$Outbound; properties: BenefitGrantAdsProperties$Outbound; }; @@ -119,6 +128,7 @@ export const CustomerBenefitGrantAds$outboundSchema: z.ZodType< orderId: z.nullable(z.string()), isGranted: z.boolean(), isRevoked: z.boolean(), + customer: CustomerPortalCustomer$outboundSchema, benefit: BenefitAdsSubscriber$outboundSchema, properties: BenefitGrantAdsProperties$outboundSchema, }).transform((v) => { diff --git a/src/models/components/customerbenefitgrantadsupdate.ts b/src/models/components/customerbenefitgrantadsupdate.ts index bf06e9f0..51c7ff27 100644 --- a/src/models/components/customerbenefitgrantadsupdate.ts +++ b/src/models/components/customerbenefitgrantadsupdate.ts @@ -5,44 +5,13 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const CustomerBenefitGrantAdsUpdateBenefitType = { - Ads: "ads", -} as const; -export type CustomerBenefitGrantAdsUpdateBenefitType = ClosedEnum< - typeof CustomerBenefitGrantAdsUpdateBenefitType ->; - export type CustomerBenefitGrantAdsUpdate = { benefitType?: "ads" | undefined; }; -/** @internal */ -export const CustomerBenefitGrantAdsUpdateBenefitType$inboundSchema: - z.ZodNativeEnum = z - .nativeEnum(CustomerBenefitGrantAdsUpdateBenefitType); - -/** @internal */ -export const CustomerBenefitGrantAdsUpdateBenefitType$outboundSchema: - z.ZodNativeEnum = - CustomerBenefitGrantAdsUpdateBenefitType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomerBenefitGrantAdsUpdateBenefitType$ { - /** @deprecated use `CustomerBenefitGrantAdsUpdateBenefitType$inboundSchema` instead. */ - export const inboundSchema = - CustomerBenefitGrantAdsUpdateBenefitType$inboundSchema; - /** @deprecated use `CustomerBenefitGrantAdsUpdateBenefitType$outboundSchema` instead. */ - export const outboundSchema = - CustomerBenefitGrantAdsUpdateBenefitType$outboundSchema; -} - /** @internal */ export const CustomerBenefitGrantAdsUpdate$inboundSchema: z.ZodType< CustomerBenefitGrantAdsUpdate, @@ -67,7 +36,7 @@ export const CustomerBenefitGrantAdsUpdate$outboundSchema: z.ZodType< z.ZodTypeDef, CustomerBenefitGrantAdsUpdate > = z.object({ - benefitType: z.literal("ads").default("ads"), + benefitType: z.literal("ads").default("ads" as const), }).transform((v) => { return remap$(v, { benefitType: "benefit_type", diff --git a/src/models/components/customerbenefitgrantcustom.ts b/src/models/components/customerbenefitgrantcustom.ts index 19d53599..8fe1fd1f 100644 --- a/src/models/components/customerbenefitgrantcustom.ts +++ b/src/models/components/customerbenefitgrantcustom.ts @@ -19,6 +19,12 @@ import { BenefitGrantCustomProperties$Outbound, BenefitGrantCustomProperties$outboundSchema, } from "./benefitgrantcustomproperties.js"; +import { + CustomerPortalCustomer, + CustomerPortalCustomer$inboundSchema, + CustomerPortalCustomer$Outbound, + CustomerPortalCustomer$outboundSchema, +} from "./customerportalcustomer.js"; export type CustomerBenefitGrantCustom = { /** @@ -41,6 +47,7 @@ export type CustomerBenefitGrantCustom = { orderId: string | null; isGranted: boolean; isRevoked: boolean; + customer: CustomerPortalCustomer; benefit: BenefitCustomSubscriber; properties: BenefitGrantCustomProperties; }; @@ -68,6 +75,7 @@ export const CustomerBenefitGrantCustom$inboundSchema: z.ZodType< order_id: z.nullable(z.string()), is_granted: z.boolean(), is_revoked: z.boolean(), + customer: CustomerPortalCustomer$inboundSchema, benefit: BenefitCustomSubscriber$inboundSchema, properties: BenefitGrantCustomProperties$inboundSchema, }).transform((v) => { @@ -98,6 +106,7 @@ export type CustomerBenefitGrantCustom$Outbound = { order_id: string | null; is_granted: boolean; is_revoked: boolean; + customer: CustomerPortalCustomer$Outbound; benefit: BenefitCustomSubscriber$Outbound; properties: BenefitGrantCustomProperties$Outbound; }; @@ -119,6 +128,7 @@ export const CustomerBenefitGrantCustom$outboundSchema: z.ZodType< orderId: z.nullable(z.string()), isGranted: z.boolean(), isRevoked: z.boolean(), + customer: CustomerPortalCustomer$outboundSchema, benefit: BenefitCustomSubscriber$outboundSchema, properties: BenefitGrantCustomProperties$outboundSchema, }).transform((v) => { diff --git a/src/models/components/customerbenefitgrantcustomupdate.ts b/src/models/components/customerbenefitgrantcustomupdate.ts index 49002ffe..6417d1fe 100644 --- a/src/models/components/customerbenefitgrantcustomupdate.ts +++ b/src/models/components/customerbenefitgrantcustomupdate.ts @@ -5,44 +5,13 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const CustomerBenefitGrantCustomUpdateBenefitType = { - Custom: "custom", -} as const; -export type CustomerBenefitGrantCustomUpdateBenefitType = ClosedEnum< - typeof CustomerBenefitGrantCustomUpdateBenefitType ->; - export type CustomerBenefitGrantCustomUpdate = { benefitType?: "custom" | undefined; }; -/** @internal */ -export const CustomerBenefitGrantCustomUpdateBenefitType$inboundSchema: - z.ZodNativeEnum = z - .nativeEnum(CustomerBenefitGrantCustomUpdateBenefitType); - -/** @internal */ -export const CustomerBenefitGrantCustomUpdateBenefitType$outboundSchema: - z.ZodNativeEnum = - CustomerBenefitGrantCustomUpdateBenefitType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomerBenefitGrantCustomUpdateBenefitType$ { - /** @deprecated use `CustomerBenefitGrantCustomUpdateBenefitType$inboundSchema` instead. */ - export const inboundSchema = - CustomerBenefitGrantCustomUpdateBenefitType$inboundSchema; - /** @deprecated use `CustomerBenefitGrantCustomUpdateBenefitType$outboundSchema` instead. */ - export const outboundSchema = - CustomerBenefitGrantCustomUpdateBenefitType$outboundSchema; -} - /** @internal */ export const CustomerBenefitGrantCustomUpdate$inboundSchema: z.ZodType< CustomerBenefitGrantCustomUpdate, @@ -67,7 +36,7 @@ export const CustomerBenefitGrantCustomUpdate$outboundSchema: z.ZodType< z.ZodTypeDef, CustomerBenefitGrantCustomUpdate > = z.object({ - benefitType: z.literal("custom").default("custom"), + benefitType: z.literal("custom").default("custom" as const), }).transform((v) => { return remap$(v, { benefitType: "benefit_type", diff --git a/src/models/components/customerbenefitgrantdiscord.ts b/src/models/components/customerbenefitgrantdiscord.ts index dca56b7b..2f735f0e 100644 --- a/src/models/components/customerbenefitgrantdiscord.ts +++ b/src/models/components/customerbenefitgrantdiscord.ts @@ -19,6 +19,12 @@ import { BenefitGrantDiscordProperties$Outbound, BenefitGrantDiscordProperties$outboundSchema, } from "./benefitgrantdiscordproperties.js"; +import { + CustomerPortalCustomer, + CustomerPortalCustomer$inboundSchema, + CustomerPortalCustomer$Outbound, + CustomerPortalCustomer$outboundSchema, +} from "./customerportalcustomer.js"; export type CustomerBenefitGrantDiscord = { /** @@ -41,6 +47,7 @@ export type CustomerBenefitGrantDiscord = { orderId: string | null; isGranted: boolean; isRevoked: boolean; + customer: CustomerPortalCustomer; benefit: BenefitDiscordSubscriber; properties: BenefitGrantDiscordProperties; }; @@ -68,6 +75,7 @@ export const CustomerBenefitGrantDiscord$inboundSchema: z.ZodType< order_id: z.nullable(z.string()), is_granted: z.boolean(), is_revoked: z.boolean(), + customer: CustomerPortalCustomer$inboundSchema, benefit: BenefitDiscordSubscriber$inboundSchema, properties: BenefitGrantDiscordProperties$inboundSchema, }).transform((v) => { @@ -98,6 +106,7 @@ export type CustomerBenefitGrantDiscord$Outbound = { order_id: string | null; is_granted: boolean; is_revoked: boolean; + customer: CustomerPortalCustomer$Outbound; benefit: BenefitDiscordSubscriber$Outbound; properties: BenefitGrantDiscordProperties$Outbound; }; @@ -119,6 +128,7 @@ export const CustomerBenefitGrantDiscord$outboundSchema: z.ZodType< orderId: z.nullable(z.string()), isGranted: z.boolean(), isRevoked: z.boolean(), + customer: CustomerPortalCustomer$outboundSchema, benefit: BenefitDiscordSubscriber$outboundSchema, properties: BenefitGrantDiscordProperties$outboundSchema, }).transform((v) => { diff --git a/src/models/components/customerbenefitgrantdiscordupdate.ts b/src/models/components/customerbenefitgrantdiscordupdate.ts index 8299e4be..a940497c 100644 --- a/src/models/components/customerbenefitgrantdiscordupdate.ts +++ b/src/models/components/customerbenefitgrantdiscordupdate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,41 +14,11 @@ import { CustomerBenefitGrantDiscordPropertiesUpdate$outboundSchema, } from "./customerbenefitgrantdiscordpropertiesupdate.js"; -export const CustomerBenefitGrantDiscordUpdateBenefitType = { - Discord: "discord", -} as const; -export type CustomerBenefitGrantDiscordUpdateBenefitType = ClosedEnum< - typeof CustomerBenefitGrantDiscordUpdateBenefitType ->; - export type CustomerBenefitGrantDiscordUpdate = { benefitType?: "discord" | undefined; properties: CustomerBenefitGrantDiscordPropertiesUpdate; }; -/** @internal */ -export const CustomerBenefitGrantDiscordUpdateBenefitType$inboundSchema: - z.ZodNativeEnum = z - .nativeEnum(CustomerBenefitGrantDiscordUpdateBenefitType); - -/** @internal */ -export const CustomerBenefitGrantDiscordUpdateBenefitType$outboundSchema: - z.ZodNativeEnum = - CustomerBenefitGrantDiscordUpdateBenefitType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomerBenefitGrantDiscordUpdateBenefitType$ { - /** @deprecated use `CustomerBenefitGrantDiscordUpdateBenefitType$inboundSchema` instead. */ - export const inboundSchema = - CustomerBenefitGrantDiscordUpdateBenefitType$inboundSchema; - /** @deprecated use `CustomerBenefitGrantDiscordUpdateBenefitType$outboundSchema` instead. */ - export const outboundSchema = - CustomerBenefitGrantDiscordUpdateBenefitType$outboundSchema; -} - /** @internal */ export const CustomerBenefitGrantDiscordUpdate$inboundSchema: z.ZodType< CustomerBenefitGrantDiscordUpdate, @@ -76,7 +45,7 @@ export const CustomerBenefitGrantDiscordUpdate$outboundSchema: z.ZodType< z.ZodTypeDef, CustomerBenefitGrantDiscordUpdate > = z.object({ - benefitType: z.literal("discord").default("discord"), + benefitType: z.literal("discord").default("discord" as const), properties: CustomerBenefitGrantDiscordPropertiesUpdate$outboundSchema, }).transform((v) => { return remap$(v, { diff --git a/src/models/components/customerbenefitgrantdownloadables.ts b/src/models/components/customerbenefitgrantdownloadables.ts index cef98714..f5f6766a 100644 --- a/src/models/components/customerbenefitgrantdownloadables.ts +++ b/src/models/components/customerbenefitgrantdownloadables.ts @@ -19,6 +19,12 @@ import { BenefitGrantDownloadablesProperties$Outbound, BenefitGrantDownloadablesProperties$outboundSchema, } from "./benefitgrantdownloadablesproperties.js"; +import { + CustomerPortalCustomer, + CustomerPortalCustomer$inboundSchema, + CustomerPortalCustomer$Outbound, + CustomerPortalCustomer$outboundSchema, +} from "./customerportalcustomer.js"; export type CustomerBenefitGrantDownloadables = { /** @@ -41,6 +47,7 @@ export type CustomerBenefitGrantDownloadables = { orderId: string | null; isGranted: boolean; isRevoked: boolean; + customer: CustomerPortalCustomer; benefit: BenefitDownloadablesSubscriber; properties: BenefitGrantDownloadablesProperties; }; @@ -68,6 +75,7 @@ export const CustomerBenefitGrantDownloadables$inboundSchema: z.ZodType< order_id: z.nullable(z.string()), is_granted: z.boolean(), is_revoked: z.boolean(), + customer: CustomerPortalCustomer$inboundSchema, benefit: BenefitDownloadablesSubscriber$inboundSchema, properties: BenefitGrantDownloadablesProperties$inboundSchema, }).transform((v) => { @@ -98,6 +106,7 @@ export type CustomerBenefitGrantDownloadables$Outbound = { order_id: string | null; is_granted: boolean; is_revoked: boolean; + customer: CustomerPortalCustomer$Outbound; benefit: BenefitDownloadablesSubscriber$Outbound; properties: BenefitGrantDownloadablesProperties$Outbound; }; @@ -119,6 +128,7 @@ export const CustomerBenefitGrantDownloadables$outboundSchema: z.ZodType< orderId: z.nullable(z.string()), isGranted: z.boolean(), isRevoked: z.boolean(), + customer: CustomerPortalCustomer$outboundSchema, benefit: BenefitDownloadablesSubscriber$outboundSchema, properties: BenefitGrantDownloadablesProperties$outboundSchema, }).transform((v) => { diff --git a/src/models/components/customerbenefitgrantdownloadablesupdate.ts b/src/models/components/customerbenefitgrantdownloadablesupdate.ts index 49611788..e2c66a66 100644 --- a/src/models/components/customerbenefitgrantdownloadablesupdate.ts +++ b/src/models/components/customerbenefitgrantdownloadablesupdate.ts @@ -5,44 +5,13 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const CustomerBenefitGrantDownloadablesUpdateBenefitType = { - Downloadables: "downloadables", -} as const; -export type CustomerBenefitGrantDownloadablesUpdateBenefitType = ClosedEnum< - typeof CustomerBenefitGrantDownloadablesUpdateBenefitType ->; - export type CustomerBenefitGrantDownloadablesUpdate = { benefitType?: "downloadables" | undefined; }; -/** @internal */ -export const CustomerBenefitGrantDownloadablesUpdateBenefitType$inboundSchema: - z.ZodNativeEnum = z - .nativeEnum(CustomerBenefitGrantDownloadablesUpdateBenefitType); - -/** @internal */ -export const CustomerBenefitGrantDownloadablesUpdateBenefitType$outboundSchema: - z.ZodNativeEnum = - CustomerBenefitGrantDownloadablesUpdateBenefitType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomerBenefitGrantDownloadablesUpdateBenefitType$ { - /** @deprecated use `CustomerBenefitGrantDownloadablesUpdateBenefitType$inboundSchema` instead. */ - export const inboundSchema = - CustomerBenefitGrantDownloadablesUpdateBenefitType$inboundSchema; - /** @deprecated use `CustomerBenefitGrantDownloadablesUpdateBenefitType$outboundSchema` instead. */ - export const outboundSchema = - CustomerBenefitGrantDownloadablesUpdateBenefitType$outboundSchema; -} - /** @internal */ export const CustomerBenefitGrantDownloadablesUpdate$inboundSchema: z.ZodType< CustomerBenefitGrantDownloadablesUpdate, @@ -67,7 +36,7 @@ export const CustomerBenefitGrantDownloadablesUpdate$outboundSchema: z.ZodType< z.ZodTypeDef, CustomerBenefitGrantDownloadablesUpdate > = z.object({ - benefitType: z.literal("downloadables").default("downloadables"), + benefitType: z.literal("downloadables").default("downloadables" as const), }).transform((v) => { return remap$(v, { benefitType: "benefit_type", diff --git a/src/models/components/customerbenefitgrantgithubrepository.ts b/src/models/components/customerbenefitgrantgithubrepository.ts index a794575b..e5d0a09e 100644 --- a/src/models/components/customerbenefitgrantgithubrepository.ts +++ b/src/models/components/customerbenefitgrantgithubrepository.ts @@ -19,6 +19,12 @@ import { BenefitGrantGitHubRepositoryProperties$Outbound, BenefitGrantGitHubRepositoryProperties$outboundSchema, } from "./benefitgrantgithubrepositoryproperties.js"; +import { + CustomerPortalCustomer, + CustomerPortalCustomer$inboundSchema, + CustomerPortalCustomer$Outbound, + CustomerPortalCustomer$outboundSchema, +} from "./customerportalcustomer.js"; export type CustomerBenefitGrantGitHubRepository = { /** @@ -41,6 +47,7 @@ export type CustomerBenefitGrantGitHubRepository = { orderId: string | null; isGranted: boolean; isRevoked: boolean; + customer: CustomerPortalCustomer; benefit: BenefitGitHubRepositorySubscriber; properties: BenefitGrantGitHubRepositoryProperties; }; @@ -68,6 +75,7 @@ export const CustomerBenefitGrantGitHubRepository$inboundSchema: z.ZodType< order_id: z.nullable(z.string()), is_granted: z.boolean(), is_revoked: z.boolean(), + customer: CustomerPortalCustomer$inboundSchema, benefit: BenefitGitHubRepositorySubscriber$inboundSchema, properties: BenefitGrantGitHubRepositoryProperties$inboundSchema, }).transform((v) => { @@ -98,6 +106,7 @@ export type CustomerBenefitGrantGitHubRepository$Outbound = { order_id: string | null; is_granted: boolean; is_revoked: boolean; + customer: CustomerPortalCustomer$Outbound; benefit: BenefitGitHubRepositorySubscriber$Outbound; properties: BenefitGrantGitHubRepositoryProperties$Outbound; }; @@ -119,6 +128,7 @@ export const CustomerBenefitGrantGitHubRepository$outboundSchema: z.ZodType< orderId: z.nullable(z.string()), isGranted: z.boolean(), isRevoked: z.boolean(), + customer: CustomerPortalCustomer$outboundSchema, benefit: BenefitGitHubRepositorySubscriber$outboundSchema, properties: BenefitGrantGitHubRepositoryProperties$outboundSchema, }).transform((v) => { diff --git a/src/models/components/customerbenefitgrantgithubrepositoryupdate.ts b/src/models/components/customerbenefitgrantgithubrepositoryupdate.ts index 3e363bf5..e34d5c35 100644 --- a/src/models/components/customerbenefitgrantgithubrepositoryupdate.ts +++ b/src/models/components/customerbenefitgrantgithubrepositoryupdate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,43 +14,11 @@ import { CustomerBenefitGrantGitHubRepositoryPropertiesUpdate$outboundSchema, } from "./customerbenefitgrantgithubrepositorypropertiesupdate.js"; -export const CustomerBenefitGrantGitHubRepositoryUpdateBenefitType = { - GithubRepository: "github_repository", -} as const; -export type CustomerBenefitGrantGitHubRepositoryUpdateBenefitType = ClosedEnum< - typeof CustomerBenefitGrantGitHubRepositoryUpdateBenefitType ->; - export type CustomerBenefitGrantGitHubRepositoryUpdate = { benefitType?: "github_repository" | undefined; properties: CustomerBenefitGrantGitHubRepositoryPropertiesUpdate; }; -/** @internal */ -export const CustomerBenefitGrantGitHubRepositoryUpdateBenefitType$inboundSchema: - z.ZodNativeEnum< - typeof CustomerBenefitGrantGitHubRepositoryUpdateBenefitType - > = z.nativeEnum(CustomerBenefitGrantGitHubRepositoryUpdateBenefitType); - -/** @internal */ -export const CustomerBenefitGrantGitHubRepositoryUpdateBenefitType$outboundSchema: - z.ZodNativeEnum< - typeof CustomerBenefitGrantGitHubRepositoryUpdateBenefitType - > = CustomerBenefitGrantGitHubRepositoryUpdateBenefitType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomerBenefitGrantGitHubRepositoryUpdateBenefitType$ { - /** @deprecated use `CustomerBenefitGrantGitHubRepositoryUpdateBenefitType$inboundSchema` instead. */ - export const inboundSchema = - CustomerBenefitGrantGitHubRepositoryUpdateBenefitType$inboundSchema; - /** @deprecated use `CustomerBenefitGrantGitHubRepositoryUpdateBenefitType$outboundSchema` instead. */ - export const outboundSchema = - CustomerBenefitGrantGitHubRepositoryUpdateBenefitType$outboundSchema; -} - /** @internal */ export const CustomerBenefitGrantGitHubRepositoryUpdate$inboundSchema: z.ZodType = @@ -78,7 +45,9 @@ export const CustomerBenefitGrantGitHubRepositoryUpdate$outboundSchema: z.ZodTypeDef, CustomerBenefitGrantGitHubRepositoryUpdate > = z.object({ - benefitType: z.literal("github_repository").default("github_repository"), + benefitType: z.literal("github_repository").default( + "github_repository" as const, + ), properties: CustomerBenefitGrantGitHubRepositoryPropertiesUpdate$outboundSchema, }).transform((v) => { diff --git a/src/models/components/customerbenefitgrantlicensekeys.ts b/src/models/components/customerbenefitgrantlicensekeys.ts index 9ff08ab9..e58271a0 100644 --- a/src/models/components/customerbenefitgrantlicensekeys.ts +++ b/src/models/components/customerbenefitgrantlicensekeys.ts @@ -19,6 +19,12 @@ import { BenefitLicenseKeysSubscriber$Outbound, BenefitLicenseKeysSubscriber$outboundSchema, } from "./benefitlicensekeyssubscriber.js"; +import { + CustomerPortalCustomer, + CustomerPortalCustomer$inboundSchema, + CustomerPortalCustomer$Outbound, + CustomerPortalCustomer$outboundSchema, +} from "./customerportalcustomer.js"; export type CustomerBenefitGrantLicenseKeys = { /** @@ -41,6 +47,7 @@ export type CustomerBenefitGrantLicenseKeys = { orderId: string | null; isGranted: boolean; isRevoked: boolean; + customer: CustomerPortalCustomer; benefit: BenefitLicenseKeysSubscriber; properties: BenefitGrantLicenseKeysProperties; }; @@ -68,6 +75,7 @@ export const CustomerBenefitGrantLicenseKeys$inboundSchema: z.ZodType< order_id: z.nullable(z.string()), is_granted: z.boolean(), is_revoked: z.boolean(), + customer: CustomerPortalCustomer$inboundSchema, benefit: BenefitLicenseKeysSubscriber$inboundSchema, properties: BenefitGrantLicenseKeysProperties$inboundSchema, }).transform((v) => { @@ -98,6 +106,7 @@ export type CustomerBenefitGrantLicenseKeys$Outbound = { order_id: string | null; is_granted: boolean; is_revoked: boolean; + customer: CustomerPortalCustomer$Outbound; benefit: BenefitLicenseKeysSubscriber$Outbound; properties: BenefitGrantLicenseKeysProperties$Outbound; }; @@ -119,6 +128,7 @@ export const CustomerBenefitGrantLicenseKeys$outboundSchema: z.ZodType< orderId: z.nullable(z.string()), isGranted: z.boolean(), isRevoked: z.boolean(), + customer: CustomerPortalCustomer$outboundSchema, benefit: BenefitLicenseKeysSubscriber$outboundSchema, properties: BenefitGrantLicenseKeysProperties$outboundSchema, }).transform((v) => { diff --git a/src/models/components/customerbenefitgrantlicensekeysupdate.ts b/src/models/components/customerbenefitgrantlicensekeysupdate.ts index 54f86357..f5fcd283 100644 --- a/src/models/components/customerbenefitgrantlicensekeysupdate.ts +++ b/src/models/components/customerbenefitgrantlicensekeysupdate.ts @@ -5,44 +5,13 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const CustomerBenefitGrantLicenseKeysUpdateBenefitType = { - LicenseKeys: "license_keys", -} as const; -export type CustomerBenefitGrantLicenseKeysUpdateBenefitType = ClosedEnum< - typeof CustomerBenefitGrantLicenseKeysUpdateBenefitType ->; - export type CustomerBenefitGrantLicenseKeysUpdate = { benefitType?: "license_keys" | undefined; }; -/** @internal */ -export const CustomerBenefitGrantLicenseKeysUpdateBenefitType$inboundSchema: - z.ZodNativeEnum = z - .nativeEnum(CustomerBenefitGrantLicenseKeysUpdateBenefitType); - -/** @internal */ -export const CustomerBenefitGrantLicenseKeysUpdateBenefitType$outboundSchema: - z.ZodNativeEnum = - CustomerBenefitGrantLicenseKeysUpdateBenefitType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomerBenefitGrantLicenseKeysUpdateBenefitType$ { - /** @deprecated use `CustomerBenefitGrantLicenseKeysUpdateBenefitType$inboundSchema` instead. */ - export const inboundSchema = - CustomerBenefitGrantLicenseKeysUpdateBenefitType$inboundSchema; - /** @deprecated use `CustomerBenefitGrantLicenseKeysUpdateBenefitType$outboundSchema` instead. */ - export const outboundSchema = - CustomerBenefitGrantLicenseKeysUpdateBenefitType$outboundSchema; -} - /** @internal */ export const CustomerBenefitGrantLicenseKeysUpdate$inboundSchema: z.ZodType< CustomerBenefitGrantLicenseKeysUpdate, @@ -67,7 +36,7 @@ export const CustomerBenefitGrantLicenseKeysUpdate$outboundSchema: z.ZodType< z.ZodTypeDef, CustomerBenefitGrantLicenseKeysUpdate > = z.object({ - benefitType: z.literal("license_keys").default("license_keys"), + benefitType: z.literal("license_keys").default("license_keys" as const), }).transform((v) => { return remap$(v, { benefitType: "benefit_type", diff --git a/src/models/components/customersession.ts b/src/models/components/customersession.ts index a359f1bc..b5e718a5 100644 --- a/src/models/components/customersession.ts +++ b/src/models/components/customersession.ts @@ -32,6 +32,7 @@ export type CustomerSession = { id: string; token: string; expiresAt: Date; + customerPortalUrl: string; customerId: string; /** * A customer in an organization. @@ -52,6 +53,7 @@ export const CustomerSession$inboundSchema: z.ZodType< id: z.string(), token: z.string(), expires_at: z.string().datetime({ offset: true }).transform(v => new Date(v)), + customer_portal_url: z.string(), customer_id: z.string(), customer: Customer$inboundSchema, }).transform((v) => { @@ -59,6 +61,7 @@ export const CustomerSession$inboundSchema: z.ZodType< "created_at": "createdAt", "modified_at": "modifiedAt", "expires_at": "expiresAt", + "customer_portal_url": "customerPortalUrl", "customer_id": "customerId", }); }); @@ -70,6 +73,7 @@ export type CustomerSession$Outbound = { id: string; token: string; expires_at: string; + customer_portal_url: string; customer_id: string; customer: Customer$Outbound; }; @@ -85,6 +89,7 @@ export const CustomerSession$outboundSchema: z.ZodType< id: z.string(), token: z.string(), expiresAt: z.date().transform(v => v.toISOString()), + customerPortalUrl: z.string(), customerId: z.string(), customer: Customer$outboundSchema, }).transform((v) => { @@ -92,6 +97,7 @@ export const CustomerSession$outboundSchema: z.ZodType< createdAt: "created_at", modifiedAt: "modified_at", expiresAt: "expires_at", + customerPortalUrl: "customer_portal_url", customerId: "customer_id", }); }); diff --git a/src/models/components/customfieldcheckbox.ts b/src/models/components/customfieldcheckbox.ts index 109686e6..30dc506f 100644 --- a/src/models/components/customfieldcheckbox.ts +++ b/src/models/components/customfieldcheckbox.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -17,13 +16,6 @@ import { export type CustomFieldCheckboxMetadata = string | number | boolean; -export const CustomFieldCheckboxType = { - Checkbox: "checkbox", -} as const; -export type CustomFieldCheckboxType = ClosedEnum< - typeof CustomFieldCheckboxType ->; - /** * Schema for a custom field of type checkbox. */ @@ -107,27 +99,6 @@ export function customFieldCheckboxMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldCheckboxType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldCheckboxType -> = z.nativeEnum(CustomFieldCheckboxType); - -/** @internal */ -export const CustomFieldCheckboxType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldCheckboxType -> = CustomFieldCheckboxType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldCheckboxType$ { - /** @deprecated use `CustomFieldCheckboxType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldCheckboxType$inboundSchema; - /** @deprecated use `CustomFieldCheckboxType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldCheckboxType$outboundSchema; -} - /** @internal */ export const CustomFieldCheckbox$inboundSchema: z.ZodType< CustomFieldCheckbox, @@ -176,7 +147,7 @@ export const CustomFieldCheckbox$outboundSchema: z.ZodType< modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), metadata: z.record(z.union([z.string(), z.number().int(), z.boolean()])), - type: z.literal("checkbox").default("checkbox"), + type: z.literal("checkbox").default("checkbox" as const), slug: z.string(), name: z.string(), organizationId: z.string(), diff --git a/src/models/components/customfieldcreatecheckbox.ts b/src/models/components/customfieldcreatecheckbox.ts index c402eefe..45bd4657 100644 --- a/src/models/components/customfieldcreatecheckbox.ts +++ b/src/models/components/customfieldcreatecheckbox.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -17,13 +16,6 @@ import { export type CustomFieldCreateCheckboxMetadata = string | number | boolean; -export const CustomFieldCreateCheckboxType = { - Checkbox: "checkbox", -} as const; -export type CustomFieldCreateCheckboxType = ClosedEnum< - typeof CustomFieldCreateCheckboxType ->; - /** * Schema to create a custom field of type checkbox. */ @@ -113,27 +105,6 @@ export function customFieldCreateCheckboxMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldCreateCheckboxType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldCreateCheckboxType -> = z.nativeEnum(CustomFieldCreateCheckboxType); - -/** @internal */ -export const CustomFieldCreateCheckboxType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldCreateCheckboxType -> = CustomFieldCreateCheckboxType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldCreateCheckboxType$ { - /** @deprecated use `CustomFieldCreateCheckboxType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldCreateCheckboxType$inboundSchema; - /** @deprecated use `CustomFieldCreateCheckboxType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldCreateCheckboxType$outboundSchema; -} - /** @internal */ export const CustomFieldCreateCheckbox$inboundSchema: z.ZodType< CustomFieldCreateCheckbox, @@ -171,7 +142,7 @@ export const CustomFieldCreateCheckbox$outboundSchema: z.ZodType< > = z.object({ metadata: z.record(z.union([z.string(), z.number().int(), z.boolean()])) .optional(), - type: z.literal("checkbox").default("checkbox"), + type: z.literal("checkbox").default("checkbox" as const), slug: z.string(), name: z.string(), organizationId: z.nullable(z.string()).optional(), diff --git a/src/models/components/customfieldcreatedate.ts b/src/models/components/customfieldcreatedate.ts index e4641b41..7c945cb8 100644 --- a/src/models/components/customfieldcreatedate.ts +++ b/src/models/components/customfieldcreatedate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -17,13 +16,6 @@ import { export type CustomFieldCreateDateMetadata = string | number | boolean; -export const CustomFieldCreateDateType = { - Date: "date", -} as const; -export type CustomFieldCreateDateType = ClosedEnum< - typeof CustomFieldCreateDateType ->; - /** * Schema to create a custom field of type date. */ @@ -109,27 +101,6 @@ export function customFieldCreateDateMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldCreateDateType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldCreateDateType -> = z.nativeEnum(CustomFieldCreateDateType); - -/** @internal */ -export const CustomFieldCreateDateType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldCreateDateType -> = CustomFieldCreateDateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldCreateDateType$ { - /** @deprecated use `CustomFieldCreateDateType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldCreateDateType$inboundSchema; - /** @deprecated use `CustomFieldCreateDateType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldCreateDateType$outboundSchema; -} - /** @internal */ export const CustomFieldCreateDate$inboundSchema: z.ZodType< CustomFieldCreateDate, @@ -167,7 +138,7 @@ export const CustomFieldCreateDate$outboundSchema: z.ZodType< > = z.object({ metadata: z.record(z.union([z.string(), z.number().int(), z.boolean()])) .optional(), - type: z.literal("date").default("date"), + type: z.literal("date").default("date" as const), slug: z.string(), name: z.string(), organizationId: z.nullable(z.string()).optional(), diff --git a/src/models/components/customfieldcreatenumber.ts b/src/models/components/customfieldcreatenumber.ts index 78c43480..cbc2139b 100644 --- a/src/models/components/customfieldcreatenumber.ts +++ b/src/models/components/customfieldcreatenumber.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -17,13 +16,6 @@ import { export type CustomFieldCreateNumberMetadata = string | number | boolean; -export const CustomFieldCreateNumberType = { - Number: "number", -} as const; -export type CustomFieldCreateNumberType = ClosedEnum< - typeof CustomFieldCreateNumberType ->; - /** * Schema to create a custom field of type number. */ @@ -112,27 +104,6 @@ export function customFieldCreateNumberMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldCreateNumberType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldCreateNumberType -> = z.nativeEnum(CustomFieldCreateNumberType); - -/** @internal */ -export const CustomFieldCreateNumberType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldCreateNumberType -> = CustomFieldCreateNumberType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldCreateNumberType$ { - /** @deprecated use `CustomFieldCreateNumberType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldCreateNumberType$inboundSchema; - /** @deprecated use `CustomFieldCreateNumberType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldCreateNumberType$outboundSchema; -} - /** @internal */ export const CustomFieldCreateNumber$inboundSchema: z.ZodType< CustomFieldCreateNumber, @@ -170,7 +141,7 @@ export const CustomFieldCreateNumber$outboundSchema: z.ZodType< > = z.object({ metadata: z.record(z.union([z.string(), z.number().int(), z.boolean()])) .optional(), - type: z.literal("number").default("number"), + type: z.literal("number").default("number" as const), slug: z.string(), name: z.string(), organizationId: z.nullable(z.string()).optional(), diff --git a/src/models/components/customfieldcreateselect.ts b/src/models/components/customfieldcreateselect.ts index 6fb0c0d9..6df581ab 100644 --- a/src/models/components/customfieldcreateselect.ts +++ b/src/models/components/customfieldcreateselect.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -17,13 +16,6 @@ import { export type CustomFieldCreateSelectMetadata = string | number | boolean; -export const CustomFieldCreateSelectType = { - Select: "select", -} as const; -export type CustomFieldCreateSelectType = ClosedEnum< - typeof CustomFieldCreateSelectType ->; - /** * Schema to create a custom field of type select. */ @@ -112,27 +104,6 @@ export function customFieldCreateSelectMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldCreateSelectType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldCreateSelectType -> = z.nativeEnum(CustomFieldCreateSelectType); - -/** @internal */ -export const CustomFieldCreateSelectType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldCreateSelectType -> = CustomFieldCreateSelectType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldCreateSelectType$ { - /** @deprecated use `CustomFieldCreateSelectType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldCreateSelectType$inboundSchema; - /** @deprecated use `CustomFieldCreateSelectType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldCreateSelectType$outboundSchema; -} - /** @internal */ export const CustomFieldCreateSelect$inboundSchema: z.ZodType< CustomFieldCreateSelect, @@ -170,7 +141,7 @@ export const CustomFieldCreateSelect$outboundSchema: z.ZodType< > = z.object({ metadata: z.record(z.union([z.string(), z.number().int(), z.boolean()])) .optional(), - type: z.literal("select").default("select"), + type: z.literal("select").default("select" as const), slug: z.string(), name: z.string(), organizationId: z.nullable(z.string()).optional(), diff --git a/src/models/components/customfieldcreatetext.ts b/src/models/components/customfieldcreatetext.ts index 07c7c7d9..d1fb6df3 100644 --- a/src/models/components/customfieldcreatetext.ts +++ b/src/models/components/customfieldcreatetext.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -17,13 +16,6 @@ import { export type CustomFieldCreateTextMetadata = string | number | boolean; -export const CustomFieldCreateTextType = { - Text: "text", -} as const; -export type CustomFieldCreateTextType = ClosedEnum< - typeof CustomFieldCreateTextType ->; - /** * Schema to create a custom field of type text. */ @@ -109,27 +101,6 @@ export function customFieldCreateTextMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldCreateTextType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldCreateTextType -> = z.nativeEnum(CustomFieldCreateTextType); - -/** @internal */ -export const CustomFieldCreateTextType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldCreateTextType -> = CustomFieldCreateTextType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldCreateTextType$ { - /** @deprecated use `CustomFieldCreateTextType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldCreateTextType$inboundSchema; - /** @deprecated use `CustomFieldCreateTextType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldCreateTextType$outboundSchema; -} - /** @internal */ export const CustomFieldCreateText$inboundSchema: z.ZodType< CustomFieldCreateText, @@ -167,7 +138,7 @@ export const CustomFieldCreateText$outboundSchema: z.ZodType< > = z.object({ metadata: z.record(z.union([z.string(), z.number().int(), z.boolean()])) .optional(), - type: z.literal("text").default("text"), + type: z.literal("text").default("text" as const), slug: z.string(), name: z.string(), organizationId: z.nullable(z.string()).optional(), diff --git a/src/models/components/customfielddate.ts b/src/models/components/customfielddate.ts index 052d18f7..98a54e2b 100644 --- a/src/models/components/customfielddate.ts +++ b/src/models/components/customfielddate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -17,11 +16,6 @@ import { export type CustomFieldDateMetadata = string | number | boolean; -export const CustomFieldDateType = { - Date: "date", -} as const; -export type CustomFieldDateType = ClosedEnum; - /** * Schema for a custom field of type date. */ @@ -103,27 +97,6 @@ export function customFieldDateMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldDateType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldDateType -> = z.nativeEnum(CustomFieldDateType); - -/** @internal */ -export const CustomFieldDateType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldDateType -> = CustomFieldDateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldDateType$ { - /** @deprecated use `CustomFieldDateType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldDateType$inboundSchema; - /** @deprecated use `CustomFieldDateType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldDateType$outboundSchema; -} - /** @internal */ export const CustomFieldDate$inboundSchema: z.ZodType< CustomFieldDate, @@ -172,7 +145,7 @@ export const CustomFieldDate$outboundSchema: z.ZodType< modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), metadata: z.record(z.union([z.string(), z.number().int(), z.boolean()])), - type: z.literal("date").default("date"), + type: z.literal("date").default("date" as const), slug: z.string(), name: z.string(), organizationId: z.string(), diff --git a/src/models/components/customfieldnumber.ts b/src/models/components/customfieldnumber.ts index 62e9efcd..87688974 100644 --- a/src/models/components/customfieldnumber.ts +++ b/src/models/components/customfieldnumber.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -17,11 +16,6 @@ import { export type CustomFieldNumberMetadata = string | number | boolean; -export const CustomFieldNumberType = { - Number: "number", -} as const; -export type CustomFieldNumberType = ClosedEnum; - /** * Schema for a custom field of type number. */ @@ -103,27 +97,6 @@ export function customFieldNumberMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldNumberType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldNumberType -> = z.nativeEnum(CustomFieldNumberType); - -/** @internal */ -export const CustomFieldNumberType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldNumberType -> = CustomFieldNumberType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldNumberType$ { - /** @deprecated use `CustomFieldNumberType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldNumberType$inboundSchema; - /** @deprecated use `CustomFieldNumberType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldNumberType$outboundSchema; -} - /** @internal */ export const CustomFieldNumber$inboundSchema: z.ZodType< CustomFieldNumber, @@ -172,7 +145,7 @@ export const CustomFieldNumber$outboundSchema: z.ZodType< modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), metadata: z.record(z.union([z.string(), z.number().int(), z.boolean()])), - type: z.literal("number").default("number"), + type: z.literal("number").default("number" as const), slug: z.string(), name: z.string(), organizationId: z.string(), diff --git a/src/models/components/customfieldselect.ts b/src/models/components/customfieldselect.ts index 2311c2ad..ed58f63c 100644 --- a/src/models/components/customfieldselect.ts +++ b/src/models/components/customfieldselect.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -17,11 +16,6 @@ import { export type CustomFieldSelectMetadata = string | number | boolean; -export const CustomFieldSelectType = { - Select: "select", -} as const; -export type CustomFieldSelectType = ClosedEnum; - /** * Schema for a custom field of type select. */ @@ -103,27 +97,6 @@ export function customFieldSelectMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldSelectType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldSelectType -> = z.nativeEnum(CustomFieldSelectType); - -/** @internal */ -export const CustomFieldSelectType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldSelectType -> = CustomFieldSelectType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldSelectType$ { - /** @deprecated use `CustomFieldSelectType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldSelectType$inboundSchema; - /** @deprecated use `CustomFieldSelectType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldSelectType$outboundSchema; -} - /** @internal */ export const CustomFieldSelect$inboundSchema: z.ZodType< CustomFieldSelect, @@ -172,7 +145,7 @@ export const CustomFieldSelect$outboundSchema: z.ZodType< modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), metadata: z.record(z.union([z.string(), z.number().int(), z.boolean()])), - type: z.literal("select").default("select"), + type: z.literal("select").default("select" as const), slug: z.string(), name: z.string(), organizationId: z.string(), diff --git a/src/models/components/customfieldtext.ts b/src/models/components/customfieldtext.ts index 7e4b0224..0b45cacc 100644 --- a/src/models/components/customfieldtext.ts +++ b/src/models/components/customfieldtext.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -17,11 +16,6 @@ import { export type CustomFieldTextMetadata = string | number | boolean; -export const CustomFieldTextType = { - Text: "text", -} as const; -export type CustomFieldTextType = ClosedEnum; - /** * Schema for a custom field of type text. */ @@ -103,27 +97,6 @@ export function customFieldTextMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldTextType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldTextType -> = z.nativeEnum(CustomFieldTextType); - -/** @internal */ -export const CustomFieldTextType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldTextType -> = CustomFieldTextType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldTextType$ { - /** @deprecated use `CustomFieldTextType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldTextType$inboundSchema; - /** @deprecated use `CustomFieldTextType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldTextType$outboundSchema; -} - /** @internal */ export const CustomFieldText$inboundSchema: z.ZodType< CustomFieldText, @@ -172,7 +145,7 @@ export const CustomFieldText$outboundSchema: z.ZodType< modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), metadata: z.record(z.union([z.string(), z.number().int(), z.boolean()])), - type: z.literal("text").default("text"), + type: z.literal("text").default("text" as const), slug: z.string(), name: z.string(), organizationId: z.string(), diff --git a/src/models/components/customfieldupdatecheckbox.ts b/src/models/components/customfieldupdatecheckbox.ts index d1ee4398..065fdc58 100644 --- a/src/models/components/customfieldupdatecheckbox.ts +++ b/src/models/components/customfieldupdatecheckbox.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -16,13 +15,6 @@ import { export type CustomFieldUpdateCheckboxMetadata = string | number | boolean; -export const CustomFieldUpdateCheckboxType = { - Checkbox: "checkbox", -} as const; -export type CustomFieldUpdateCheckboxType = ClosedEnum< - typeof CustomFieldUpdateCheckboxType ->; - /** * Schema to update a custom field of type checkbox. */ @@ -88,27 +80,6 @@ export function customFieldUpdateCheckboxMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldUpdateCheckboxType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldUpdateCheckboxType -> = z.nativeEnum(CustomFieldUpdateCheckboxType); - -/** @internal */ -export const CustomFieldUpdateCheckboxType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldUpdateCheckboxType -> = CustomFieldUpdateCheckboxType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldUpdateCheckboxType$ { - /** @deprecated use `CustomFieldUpdateCheckboxType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldUpdateCheckboxType$inboundSchema; - /** @deprecated use `CustomFieldUpdateCheckboxType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldUpdateCheckboxType$outboundSchema; -} - /** @internal */ export const CustomFieldUpdateCheckbox$inboundSchema: z.ZodType< CustomFieldUpdateCheckbox, @@ -145,7 +116,7 @@ export const CustomFieldUpdateCheckbox$outboundSchema: z.ZodType< ).optional(), name: z.nullable(z.string()).optional(), slug: z.nullable(z.string()).optional(), - type: z.literal("checkbox").default("checkbox"), + type: z.literal("checkbox").default("checkbox" as const), properties: z.nullable(CustomFieldCheckboxProperties$outboundSchema) .optional(), }); diff --git a/src/models/components/customfieldupdatedate.ts b/src/models/components/customfieldupdatedate.ts index 65f2f26d..506de914 100644 --- a/src/models/components/customfieldupdatedate.ts +++ b/src/models/components/customfieldupdatedate.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -16,13 +15,6 @@ import { export type CustomFieldUpdateDateMetadata = string | number | boolean; -export const CustomFieldUpdateDateType = { - Date: "date", -} as const; -export type CustomFieldUpdateDateType = ClosedEnum< - typeof CustomFieldUpdateDateType ->; - /** * Schema to update a custom field of type date. */ @@ -84,27 +76,6 @@ export function customFieldUpdateDateMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldUpdateDateType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldUpdateDateType -> = z.nativeEnum(CustomFieldUpdateDateType); - -/** @internal */ -export const CustomFieldUpdateDateType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldUpdateDateType -> = CustomFieldUpdateDateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldUpdateDateType$ { - /** @deprecated use `CustomFieldUpdateDateType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldUpdateDateType$inboundSchema; - /** @deprecated use `CustomFieldUpdateDateType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldUpdateDateType$outboundSchema; -} - /** @internal */ export const CustomFieldUpdateDate$inboundSchema: z.ZodType< CustomFieldUpdateDate, @@ -140,7 +111,7 @@ export const CustomFieldUpdateDate$outboundSchema: z.ZodType< ).optional(), name: z.nullable(z.string()).optional(), slug: z.nullable(z.string()).optional(), - type: z.literal("date").default("date"), + type: z.literal("date").default("date" as const), properties: z.nullable(CustomFieldDateProperties$outboundSchema).optional(), }); diff --git a/src/models/components/customfieldupdatenumber.ts b/src/models/components/customfieldupdatenumber.ts index 3961ec83..6df79f77 100644 --- a/src/models/components/customfieldupdatenumber.ts +++ b/src/models/components/customfieldupdatenumber.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -16,13 +15,6 @@ import { export type CustomFieldUpdateNumberMetadata = string | number | boolean; -export const CustomFieldUpdateNumberType = { - Number: "number", -} as const; -export type CustomFieldUpdateNumberType = ClosedEnum< - typeof CustomFieldUpdateNumberType ->; - /** * Schema to update a custom field of type number. */ @@ -87,27 +79,6 @@ export function customFieldUpdateNumberMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldUpdateNumberType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldUpdateNumberType -> = z.nativeEnum(CustomFieldUpdateNumberType); - -/** @internal */ -export const CustomFieldUpdateNumberType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldUpdateNumberType -> = CustomFieldUpdateNumberType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldUpdateNumberType$ { - /** @deprecated use `CustomFieldUpdateNumberType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldUpdateNumberType$inboundSchema; - /** @deprecated use `CustomFieldUpdateNumberType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldUpdateNumberType$outboundSchema; -} - /** @internal */ export const CustomFieldUpdateNumber$inboundSchema: z.ZodType< CustomFieldUpdateNumber, @@ -143,7 +114,7 @@ export const CustomFieldUpdateNumber$outboundSchema: z.ZodType< ).optional(), name: z.nullable(z.string()).optional(), slug: z.nullable(z.string()).optional(), - type: z.literal("number").default("number"), + type: z.literal("number").default("number" as const), properties: z.nullable(CustomFieldNumberProperties$outboundSchema).optional(), }); diff --git a/src/models/components/customfieldupdateselect.ts b/src/models/components/customfieldupdateselect.ts index 73e9d3d4..873d52d4 100644 --- a/src/models/components/customfieldupdateselect.ts +++ b/src/models/components/customfieldupdateselect.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -16,13 +15,6 @@ import { export type CustomFieldUpdateSelectMetadata = string | number | boolean; -export const CustomFieldUpdateSelectType = { - Select: "select", -} as const; -export type CustomFieldUpdateSelectType = ClosedEnum< - typeof CustomFieldUpdateSelectType ->; - /** * Schema to update a custom field of type select. */ @@ -87,27 +79,6 @@ export function customFieldUpdateSelectMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldUpdateSelectType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldUpdateSelectType -> = z.nativeEnum(CustomFieldUpdateSelectType); - -/** @internal */ -export const CustomFieldUpdateSelectType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldUpdateSelectType -> = CustomFieldUpdateSelectType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldUpdateSelectType$ { - /** @deprecated use `CustomFieldUpdateSelectType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldUpdateSelectType$inboundSchema; - /** @deprecated use `CustomFieldUpdateSelectType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldUpdateSelectType$outboundSchema; -} - /** @internal */ export const CustomFieldUpdateSelect$inboundSchema: z.ZodType< CustomFieldUpdateSelect, @@ -143,7 +114,7 @@ export const CustomFieldUpdateSelect$outboundSchema: z.ZodType< ).optional(), name: z.nullable(z.string()).optional(), slug: z.nullable(z.string()).optional(), - type: z.literal("select").default("select"), + type: z.literal("select").default("select" as const), properties: z.nullable(CustomFieldSelectProperties$outboundSchema).optional(), }); diff --git a/src/models/components/customfieldupdatetext.ts b/src/models/components/customfieldupdatetext.ts index f7bafaaf..943ae257 100644 --- a/src/models/components/customfieldupdatetext.ts +++ b/src/models/components/customfieldupdatetext.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -16,13 +15,6 @@ import { export type CustomFieldUpdateTextMetadata = string | number | boolean; -export const CustomFieldUpdateTextType = { - Text: "text", -} as const; -export type CustomFieldUpdateTextType = ClosedEnum< - typeof CustomFieldUpdateTextType ->; - /** * Schema to update a custom field of type text. */ @@ -84,27 +76,6 @@ export function customFieldUpdateTextMetadataFromJSON( ); } -/** @internal */ -export const CustomFieldUpdateTextType$inboundSchema: z.ZodNativeEnum< - typeof CustomFieldUpdateTextType -> = z.nativeEnum(CustomFieldUpdateTextType); - -/** @internal */ -export const CustomFieldUpdateTextType$outboundSchema: z.ZodNativeEnum< - typeof CustomFieldUpdateTextType -> = CustomFieldUpdateTextType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace CustomFieldUpdateTextType$ { - /** @deprecated use `CustomFieldUpdateTextType$inboundSchema` instead. */ - export const inboundSchema = CustomFieldUpdateTextType$inboundSchema; - /** @deprecated use `CustomFieldUpdateTextType$outboundSchema` instead. */ - export const outboundSchema = CustomFieldUpdateTextType$outboundSchema; -} - /** @internal */ export const CustomFieldUpdateText$inboundSchema: z.ZodType< CustomFieldUpdateText, @@ -140,7 +111,7 @@ export const CustomFieldUpdateText$outboundSchema: z.ZodType< ).optional(), name: z.nullable(z.string()).optional(), slug: z.nullable(z.string()).optional(), - type: z.literal("text").default("text"), + type: z.literal("text").default("text" as const), properties: z.nullable(CustomFieldTextProperties$outboundSchema).optional(), }); diff --git a/src/models/components/downloadablefilecreate.ts b/src/models/components/downloadablefilecreate.ts index 3071ce0e..b264d4c7 100644 --- a/src/models/components/downloadablefilecreate.ts +++ b/src/models/components/downloadablefilecreate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,13 +14,6 @@ import { S3FileCreateMultipart$outboundSchema, } from "./s3filecreatemultipart.js"; -export const DownloadableFileCreateService = { - Downloadable: "downloadable", -} as const; -export type DownloadableFileCreateService = ClosedEnum< - typeof DownloadableFileCreateService ->; - /** * Schema to create a file to be associated with the downloadables benefit. */ @@ -36,27 +28,6 @@ export type DownloadableFileCreate = { version?: string | null | undefined; }; -/** @internal */ -export const DownloadableFileCreateService$inboundSchema: z.ZodNativeEnum< - typeof DownloadableFileCreateService -> = z.nativeEnum(DownloadableFileCreateService); - -/** @internal */ -export const DownloadableFileCreateService$outboundSchema: z.ZodNativeEnum< - typeof DownloadableFileCreateService -> = DownloadableFileCreateService$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace DownloadableFileCreateService$ { - /** @deprecated use `DownloadableFileCreateService$inboundSchema` instead. */ - export const inboundSchema = DownloadableFileCreateService$inboundSchema; - /** @deprecated use `DownloadableFileCreateService$outboundSchema` instead. */ - export const outboundSchema = DownloadableFileCreateService$outboundSchema; -} - /** @internal */ export const DownloadableFileCreate$inboundSchema: z.ZodType< DownloadableFileCreate, @@ -103,7 +74,7 @@ export const DownloadableFileCreate$outboundSchema: z.ZodType< size: z.number().int(), checksumSha256Base64: z.nullable(z.string()).optional(), upload: S3FileCreateMultipart$outboundSchema, - service: z.literal("downloadable").default("downloadable"), + service: z.literal("downloadable").default("downloadable" as const), version: z.nullable(z.string()).optional(), }).transform((v) => { return remap$(v, { diff --git a/src/models/components/downloadablefileread.ts b/src/models/components/downloadablefileread.ts index 383ad314..e88a2543 100644 --- a/src/models/components/downloadablefileread.ts +++ b/src/models/components/downloadablefileread.ts @@ -5,17 +5,9 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const DownloadableFileReadService = { - Downloadable: "downloadable", -} as const; -export type DownloadableFileReadService = ClosedEnum< - typeof DownloadableFileReadService ->; - /** * File to be associated with the downloadables benefit. */ @@ -41,27 +33,6 @@ export type DownloadableFileRead = { sizeReadable: string; }; -/** @internal */ -export const DownloadableFileReadService$inboundSchema: z.ZodNativeEnum< - typeof DownloadableFileReadService -> = z.nativeEnum(DownloadableFileReadService); - -/** @internal */ -export const DownloadableFileReadService$outboundSchema: z.ZodNativeEnum< - typeof DownloadableFileReadService -> = DownloadableFileReadService$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace DownloadableFileReadService$ { - /** @deprecated use `DownloadableFileReadService$inboundSchema` instead. */ - export const inboundSchema = DownloadableFileReadService$inboundSchema; - /** @deprecated use `DownloadableFileReadService$outboundSchema` instead. */ - export const outboundSchema = DownloadableFileReadService$outboundSchema; -} - /** @internal */ export const DownloadableFileRead$inboundSchema: z.ZodType< DownloadableFileRead, @@ -139,7 +110,7 @@ export const DownloadableFileRead$outboundSchema: z.ZodType< checksumSha256Hex: z.nullable(z.string()), lastModifiedAt: z.nullable(z.date().transform(v => v.toISOString())), version: z.nullable(z.string()), - service: z.literal("downloadable").default("downloadable"), + service: z.literal("downloadable").default("downloadable" as const), isUploaded: z.boolean(), createdAt: z.date().transform(v => v.toISOString()), sizeReadable: z.string(), diff --git a/src/models/components/externalorganization.ts b/src/models/components/externalorganization.ts index 4dddb06c..71aa4561 100644 --- a/src/models/components/externalorganization.ts +++ b/src/models/components/externalorganization.ts @@ -7,10 +7,15 @@ import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; +import { + Platforms, + Platforms$inboundSchema, + Platforms$outboundSchema, +} from "./platforms.js"; export type ExternalOrganization = { id: string; - platform?: "github" | undefined; + platform: Platforms; name: string; avatarUrl: string; isPersonal: boolean; @@ -31,7 +36,7 @@ export const ExternalOrganization$inboundSchema: z.ZodType< unknown > = z.object({ id: z.string(), - platform: z.literal("github").optional(), + platform: Platforms$inboundSchema, name: z.string(), avatar_url: z.string(), is_personal: z.boolean(), @@ -56,7 +61,7 @@ export const ExternalOrganization$inboundSchema: z.ZodType< /** @internal */ export type ExternalOrganization$Outbound = { id: string; - platform: "github"; + platform: string; name: string; avatar_url: string; is_personal: boolean; @@ -77,7 +82,7 @@ export const ExternalOrganization$outboundSchema: z.ZodType< ExternalOrganization > = z.object({ id: z.string(), - platform: z.literal("github").default("github"), + platform: Platforms$outboundSchema, name: z.string(), avatarUrl: z.string(), isPersonal: z.boolean(), diff --git a/src/models/components/introspecttokenresponse.ts b/src/models/components/introspecttokenresponse.ts index 4b558ce4..20525aa4 100644 --- a/src/models/components/introspecttokenresponse.ts +++ b/src/models/components/introspecttokenresponse.ts @@ -14,18 +14,16 @@ import { SubType$outboundSchema, } from "./subtype.js"; -export const IntrospectTokenResponseTokenType = { +export const TokenType = { AccessToken: "access_token", RefreshToken: "refresh_token", } as const; -export type IntrospectTokenResponseTokenType = ClosedEnum< - typeof IntrospectTokenResponseTokenType ->; +export type TokenType = ClosedEnum; export type IntrospectTokenResponse = { active: boolean; clientId: string; - tokenType: IntrospectTokenResponseTokenType; + tokenType: TokenType; scope: string; subType: SubType; sub: string; @@ -36,24 +34,22 @@ export type IntrospectTokenResponse = { }; /** @internal */ -export const IntrospectTokenResponseTokenType$inboundSchema: z.ZodNativeEnum< - typeof IntrospectTokenResponseTokenType -> = z.nativeEnum(IntrospectTokenResponseTokenType); +export const TokenType$inboundSchema: z.ZodNativeEnum = z + .nativeEnum(TokenType); /** @internal */ -export const IntrospectTokenResponseTokenType$outboundSchema: z.ZodNativeEnum< - typeof IntrospectTokenResponseTokenType -> = IntrospectTokenResponseTokenType$inboundSchema; +export const TokenType$outboundSchema: z.ZodNativeEnum = + TokenType$inboundSchema; /** * @internal * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. */ -export namespace IntrospectTokenResponseTokenType$ { - /** @deprecated use `IntrospectTokenResponseTokenType$inboundSchema` instead. */ - export const inboundSchema = IntrospectTokenResponseTokenType$inboundSchema; - /** @deprecated use `IntrospectTokenResponseTokenType$outboundSchema` instead. */ - export const outboundSchema = IntrospectTokenResponseTokenType$outboundSchema; +export namespace TokenType$ { + /** @deprecated use `TokenType$inboundSchema` instead. */ + export const inboundSchema = TokenType$inboundSchema; + /** @deprecated use `TokenType$outboundSchema` instead. */ + export const outboundSchema = TokenType$outboundSchema; } /** @internal */ @@ -64,7 +60,7 @@ export const IntrospectTokenResponse$inboundSchema: z.ZodType< > = z.object({ active: z.boolean(), client_id: z.string(), - token_type: IntrospectTokenResponseTokenType$inboundSchema, + token_type: TokenType$inboundSchema, scope: z.string(), sub_type: SubType$inboundSchema, sub: z.string(), @@ -102,7 +98,7 @@ export const IntrospectTokenResponse$outboundSchema: z.ZodType< > = z.object({ active: z.boolean(), clientId: z.string(), - tokenType: IntrospectTokenResponseTokenType$outboundSchema, + tokenType: TokenType$outboundSchema, scope: z.string(), subType: SubType$outboundSchema, sub: z.string(), diff --git a/src/models/components/issue.ts b/src/models/components/issue.ts index e5a8928d..e1f3f7e1 100644 --- a/src/models/components/issue.ts +++ b/src/models/components/issue.ts @@ -31,6 +31,11 @@ import { Label$Outbound, Label$outboundSchema, } from "./label.js"; +import { + Platforms, + Platforms$inboundSchema, + Platforms$outboundSchema, +} from "./platforms.js"; import { Reactions, Reactions$inboundSchema, @@ -47,7 +52,7 @@ import { State, State$inboundSchema, State$outboundSchema } from "./state.js"; export type Issue = { id: string; - platform?: "github" | undefined; + platform: Platforms; /** * GitHub #number */ @@ -109,7 +114,7 @@ export type Issue = { export const Issue$inboundSchema: z.ZodType = z .object({ id: z.string(), - platform: z.literal("github").optional(), + platform: Platforms$inboundSchema, number: z.number().int(), title: z.string(), body: z.nullable(z.string()).optional(), @@ -153,7 +158,7 @@ export const Issue$inboundSchema: z.ZodType = z /** @internal */ export type Issue$Outbound = { id: string; - platform: "github"; + platform: string; number: number; title: string; body?: string | null | undefined; @@ -182,7 +187,7 @@ export const Issue$outboundSchema: z.ZodType< Issue > = z.object({ id: z.string(), - platform: z.literal("github").default("github"), + platform: Platforms$outboundSchema, number: z.number().int(), title: z.string(), body: z.nullable(z.string()).optional(), diff --git a/src/models/components/oauth2client.ts b/src/models/components/oauth2client.ts index bf070acf..3fb55d97 100644 --- a/src/models/components/oauth2client.ts +++ b/src/models/components/oauth2client.ts @@ -24,16 +24,11 @@ export const GrantTypes = { } as const; export type GrantTypes = ClosedEnum; -export const ResponseTypes = { - Code: "code", -} as const; -export type ResponseTypes = ClosedEnum; - export type OAuth2Client = { redirectUris: Array; tokenEndpointAuthMethod?: TokenEndpointAuthMethod | undefined; grantTypes?: Array | undefined; - responseTypes?: Array | undefined; + responseTypes?: Array | undefined; scope?: string | undefined; clientName: string; clientUri?: string | null | undefined; @@ -94,27 +89,6 @@ export namespace GrantTypes$ { export const outboundSchema = GrantTypes$outboundSchema; } -/** @internal */ -export const ResponseTypes$inboundSchema: z.ZodNativeEnum< - typeof ResponseTypes -> = z.nativeEnum(ResponseTypes); - -/** @internal */ -export const ResponseTypes$outboundSchema: z.ZodNativeEnum< - typeof ResponseTypes -> = ResponseTypes$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ResponseTypes$ { - /** @deprecated use `ResponseTypes$inboundSchema` instead. */ - export const inboundSchema = ResponseTypes$inboundSchema; - /** @deprecated use `ResponseTypes$outboundSchema` instead. */ - export const outboundSchema = ResponseTypes$outboundSchema; -} - /** @internal */ export const OAuth2Client$inboundSchema: z.ZodType< OAuth2Client, @@ -126,7 +100,7 @@ export const OAuth2Client$inboundSchema: z.ZodType< "client_secret_post", ), grant_types: z.array(GrantTypes$inboundSchema).optional(), - response_types: z.array(ResponseTypes$inboundSchema).optional(), + response_types: z.array(z.string()).optional(), scope: z.string().default( "openid profile email user:read organizations:read organizations:write custom_fields:read custom_fields:write discounts:read discounts:write checkout_links:read checkout_links:write checkouts:read checkouts:write products:read products:write benefits:read benefits:write files:read files:write subscriptions:read subscriptions:write customers:read customers:write customer_sessions:write orders:read metrics:read webhooks:read webhooks:write external_organizations:read license_keys:read license_keys:write repositories:read repositories:write issues:read issues:write customer_portal:read customer_portal:write", ), @@ -194,7 +168,7 @@ export const OAuth2Client$outboundSchema: z.ZodType< "client_secret_post", ), grantTypes: z.array(GrantTypes$outboundSchema).optional(), - responseTypes: z.array(ResponseTypes$outboundSchema).optional(), + responseTypes: z.array(z.string()).optional(), scope: z.string().default( "openid profile email user:read organizations:read organizations:write custom_fields:read custom_fields:write discounts:read discounts:write checkout_links:read checkout_links:write checkouts:read checkouts:write products:read products:write benefits:read benefits:write files:read files:write subscriptions:read subscriptions:write customers:read customers:write customer_sessions:write orders:read metrics:read webhooks:read webhooks:write external_organizations:read license_keys:read license_keys:write repositories:read repositories:write issues:read issues:write customer_portal:read customer_portal:write", ), diff --git a/src/models/components/oauth2clientconfiguration.ts b/src/models/components/oauth2clientconfiguration.ts index b65e4b0e..399076fb 100644 --- a/src/models/components/oauth2clientconfiguration.ts +++ b/src/models/components/oauth2clientconfiguration.ts @@ -26,20 +26,13 @@ export type OAuth2ClientConfigurationGrantTypes = ClosedEnum< typeof OAuth2ClientConfigurationGrantTypes >; -export const OAuth2ClientConfigurationResponseTypes = { - Code: "code", -} as const; -export type OAuth2ClientConfigurationResponseTypes = ClosedEnum< - typeof OAuth2ClientConfigurationResponseTypes ->; - export type OAuth2ClientConfiguration = { redirectUris: Array; tokenEndpointAuthMethod?: | OAuth2ClientConfigurationTokenEndpointAuthMethod | undefined; grantTypes?: Array | undefined; - responseTypes?: Array | undefined; + responseTypes?: Array | undefined; scope?: string | undefined; clientName: string; clientUri?: string | null | undefined; @@ -94,30 +87,6 @@ export namespace OAuth2ClientConfigurationGrantTypes$ { OAuth2ClientConfigurationGrantTypes$outboundSchema; } -/** @internal */ -export const OAuth2ClientConfigurationResponseTypes$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - OAuth2ClientConfigurationResponseTypes, - ); - -/** @internal */ -export const OAuth2ClientConfigurationResponseTypes$outboundSchema: - z.ZodNativeEnum = - OAuth2ClientConfigurationResponseTypes$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace OAuth2ClientConfigurationResponseTypes$ { - /** @deprecated use `OAuth2ClientConfigurationResponseTypes$inboundSchema` instead. */ - export const inboundSchema = - OAuth2ClientConfigurationResponseTypes$inboundSchema; - /** @deprecated use `OAuth2ClientConfigurationResponseTypes$outboundSchema` instead. */ - export const outboundSchema = - OAuth2ClientConfigurationResponseTypes$outboundSchema; -} - /** @internal */ export const OAuth2ClientConfiguration$inboundSchema: z.ZodType< OAuth2ClientConfiguration, @@ -131,8 +100,7 @@ export const OAuth2ClientConfiguration$inboundSchema: z.ZodType< ), grant_types: z.array(OAuth2ClientConfigurationGrantTypes$inboundSchema) .optional(), - response_types: z.array(OAuth2ClientConfigurationResponseTypes$inboundSchema) - .optional(), + response_types: z.array(z.string()).optional(), scope: z.string().default( "openid profile email user:read organizations:read organizations:write custom_fields:read custom_fields:write discounts:read discounts:write checkout_links:read checkout_links:write checkouts:read checkouts:write products:read products:write benefits:read benefits:write files:read files:write subscriptions:read subscriptions:write customers:read customers:write customer_sessions:write orders:read metrics:read webhooks:read webhooks:write external_organizations:read license_keys:read license_keys:write repositories:read repositories:write issues:read issues:write customer_portal:read customer_portal:write", ), @@ -182,8 +150,7 @@ export const OAuth2ClientConfiguration$outboundSchema: z.ZodType< ), grantTypes: z.array(OAuth2ClientConfigurationGrantTypes$outboundSchema) .optional(), - responseTypes: z.array(OAuth2ClientConfigurationResponseTypes$outboundSchema) - .optional(), + responseTypes: z.array(z.string()).optional(), scope: z.string().default( "openid profile email user:read organizations:read organizations:write custom_fields:read custom_fields:write discounts:read discounts:write checkout_links:read checkout_links:write checkouts:read checkouts:write products:read products:write benefits:read benefits:write files:read files:write subscriptions:read subscriptions:write customers:read customers:write customer_sessions:write orders:read metrics:read webhooks:read webhooks:write external_organizations:read license_keys:read license_keys:write repositories:read repositories:write issues:read issues:write customer_portal:read customer_portal:write", ), diff --git a/src/models/components/oauth2clientconfigurationupdate.ts b/src/models/components/oauth2clientconfigurationupdate.ts index d17e83aa..f801b79b 100644 --- a/src/models/components/oauth2clientconfigurationupdate.ts +++ b/src/models/components/oauth2clientconfigurationupdate.ts @@ -26,22 +26,13 @@ export type OAuth2ClientConfigurationUpdateGrantTypes = ClosedEnum< typeof OAuth2ClientConfigurationUpdateGrantTypes >; -export const OAuth2ClientConfigurationUpdateResponseTypes = { - Code: "code", -} as const; -export type OAuth2ClientConfigurationUpdateResponseTypes = ClosedEnum< - typeof OAuth2ClientConfigurationUpdateResponseTypes ->; - export type OAuth2ClientConfigurationUpdate = { redirectUris: Array; tokenEndpointAuthMethod?: | OAuth2ClientConfigurationUpdateTokenEndpointAuthMethod | undefined; grantTypes?: Array | undefined; - responseTypes?: - | Array - | undefined; + responseTypes?: Array | undefined; scope?: string | undefined; clientName: string; clientUri?: string | null | undefined; @@ -99,29 +90,6 @@ export namespace OAuth2ClientConfigurationUpdateGrantTypes$ { OAuth2ClientConfigurationUpdateGrantTypes$outboundSchema; } -/** @internal */ -export const OAuth2ClientConfigurationUpdateResponseTypes$inboundSchema: - z.ZodNativeEnum = z - .nativeEnum(OAuth2ClientConfigurationUpdateResponseTypes); - -/** @internal */ -export const OAuth2ClientConfigurationUpdateResponseTypes$outboundSchema: - z.ZodNativeEnum = - OAuth2ClientConfigurationUpdateResponseTypes$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace OAuth2ClientConfigurationUpdateResponseTypes$ { - /** @deprecated use `OAuth2ClientConfigurationUpdateResponseTypes$inboundSchema` instead. */ - export const inboundSchema = - OAuth2ClientConfigurationUpdateResponseTypes$inboundSchema; - /** @deprecated use `OAuth2ClientConfigurationUpdateResponseTypes$outboundSchema` instead. */ - export const outboundSchema = - OAuth2ClientConfigurationUpdateResponseTypes$outboundSchema; -} - /** @internal */ export const OAuth2ClientConfigurationUpdate$inboundSchema: z.ZodType< OAuth2ClientConfigurationUpdate, @@ -134,9 +102,7 @@ export const OAuth2ClientConfigurationUpdate$inboundSchema: z.ZodType< .default("client_secret_post"), grant_types: z.array(OAuth2ClientConfigurationUpdateGrantTypes$inboundSchema) .optional(), - response_types: z.array( - OAuth2ClientConfigurationUpdateResponseTypes$inboundSchema, - ).optional(), + response_types: z.array(z.string()).optional(), scope: z.string().default( "openid profile email user:read organizations:read organizations:write custom_fields:read custom_fields:write discounts:read discounts:write checkout_links:read checkout_links:write checkouts:read checkouts:write products:read products:write benefits:read benefits:write files:read files:write subscriptions:read subscriptions:write customers:read customers:write customer_sessions:write orders:read metrics:read webhooks:read webhooks:write external_organizations:read license_keys:read license_keys:write repositories:read repositories:write issues:read issues:write customer_portal:read customer_portal:write", ), @@ -188,9 +154,7 @@ export const OAuth2ClientConfigurationUpdate$outboundSchema: z.ZodType< .default("client_secret_post"), grantTypes: z.array(OAuth2ClientConfigurationUpdateGrantTypes$outboundSchema) .optional(), - responseTypes: z.array( - OAuth2ClientConfigurationUpdateResponseTypes$outboundSchema, - ).optional(), + responseTypes: z.array(z.string()).optional(), scope: z.string().default( "openid profile email user:read organizations:read organizations:write custom_fields:read custom_fields:write discounts:read discounts:write checkout_links:read checkout_links:write checkouts:read checkouts:write products:read products:write benefits:read benefits:write files:read files:write subscriptions:read subscriptions:write customers:read customers:write customer_sessions:write orders:read metrics:read webhooks:read webhooks:write external_organizations:read license_keys:read license_keys:write repositories:read repositories:write issues:read issues:write customer_portal:read customer_portal:write", ), diff --git a/src/models/components/onev11oauth21tokenpostxcomponentsauthorizationcodetokenrequest.ts b/src/models/components/onev11oauth21tokenpostxcomponentsauthorizationcodetokenrequest.ts index 177b59a1..40e93322 100644 --- a/src/models/components/onev11oauth21tokenpostxcomponentsauthorizationcodetokenrequest.ts +++ b/src/models/components/onev11oauth21tokenpostxcomponentsauthorizationcodetokenrequest.ts @@ -5,15 +5,9 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const GrantType = { - AuthorizationCode: "authorization_code", -} as const; -export type GrantType = ClosedEnum; - export type Onev11oauth21tokenPostXComponentsAuthorizationCodeTokenRequest = { grantType?: "authorization_code" | undefined; clientId: string; @@ -22,25 +16,6 @@ export type Onev11oauth21tokenPostXComponentsAuthorizationCodeTokenRequest = { redirectUri: string; }; -/** @internal */ -export const GrantType$inboundSchema: z.ZodNativeEnum = z - .nativeEnum(GrantType); - -/** @internal */ -export const GrantType$outboundSchema: z.ZodNativeEnum = - GrantType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace GrantType$ { - /** @deprecated use `GrantType$inboundSchema` instead. */ - export const inboundSchema = GrantType$inboundSchema; - /** @deprecated use `GrantType$outboundSchema` instead. */ - export const outboundSchema = GrantType$outboundSchema; -} - /** @internal */ export const Onev11oauth21tokenPostXComponentsAuthorizationCodeTokenRequest$inboundSchema: z.ZodType< @@ -79,7 +54,9 @@ export const Onev11oauth21tokenPostXComponentsAuthorizationCodeTokenRequest$outb z.ZodTypeDef, Onev11oauth21tokenPostXComponentsAuthorizationCodeTokenRequest > = z.object({ - grantType: z.literal("authorization_code").default("authorization_code"), + grantType: z.literal("authorization_code").default( + "authorization_code" as const, + ), clientId: z.string(), clientSecret: z.string(), code: z.string(), diff --git a/src/models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequest.ts b/src/models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequest.ts index 43738ff6..e8b84296 100644 --- a/src/models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequest.ts +++ b/src/models/components/onev11oauth21tokenpostxcomponentsrefreshtokenrequest.ts @@ -5,18 +5,9 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType = { - RefreshToken: "refresh_token", -} as const; -export type Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType = - ClosedEnum< - typeof Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType - >; - export type Onev11oauth21tokenPostXComponentsRefreshTokenRequest = { grantType?: "refresh_token" | undefined; clientId: string; @@ -24,34 +15,6 @@ export type Onev11oauth21tokenPostXComponentsRefreshTokenRequest = { refreshToken: string; }; -/** @internal */ -export const Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType$inboundSchema: - z.ZodNativeEnum< - typeof Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType - > = z.nativeEnum( - Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType, - ); - -/** @internal */ -export const Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType$outboundSchema: - z.ZodNativeEnum< - typeof Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType - > = - Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType$ { - /** @deprecated use `Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType$inboundSchema` instead. */ - export const inboundSchema = - Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType$inboundSchema; - /** @deprecated use `Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType$outboundSchema` instead. */ - export const outboundSchema = - Onev11oauth21tokenPostXComponentsRefreshTokenRequestGrantType$outboundSchema; -} - /** @internal */ export const Onev11oauth21tokenPostXComponentsRefreshTokenRequest$inboundSchema: z.ZodType< @@ -87,7 +50,7 @@ export const Onev11oauth21tokenPostXComponentsRefreshTokenRequest$outboundSchema z.ZodTypeDef, Onev11oauth21tokenPostXComponentsRefreshTokenRequest > = z.object({ - grantType: z.literal("refresh_token").default("refresh_token"), + grantType: z.literal("refresh_token").default("refresh_token" as const), clientId: z.string(), clientSecret: z.string(), refreshToken: z.string(), diff --git a/src/models/components/organizationavatarfilecreate.ts b/src/models/components/organizationavatarfilecreate.ts index 563930ed..117d8548 100644 --- a/src/models/components/organizationavatarfilecreate.ts +++ b/src/models/components/organizationavatarfilecreate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,13 +14,6 @@ import { S3FileCreateMultipart$outboundSchema, } from "./s3filecreatemultipart.js"; -export const OrganizationAvatarFileCreateService = { - OrganizationAvatar: "organization_avatar", -} as const; -export type OrganizationAvatarFileCreateService = ClosedEnum< - typeof OrganizationAvatarFileCreateService ->; - /** * Schema to create a file to be used as an organization avatar. */ @@ -42,29 +34,6 @@ export type OrganizationAvatarFileCreate = { version?: string | null | undefined; }; -/** @internal */ -export const OrganizationAvatarFileCreateService$inboundSchema: z.ZodNativeEnum< - typeof OrganizationAvatarFileCreateService -> = z.nativeEnum(OrganizationAvatarFileCreateService); - -/** @internal */ -export const OrganizationAvatarFileCreateService$outboundSchema: - z.ZodNativeEnum = - OrganizationAvatarFileCreateService$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace OrganizationAvatarFileCreateService$ { - /** @deprecated use `OrganizationAvatarFileCreateService$inboundSchema` instead. */ - export const inboundSchema = - OrganizationAvatarFileCreateService$inboundSchema; - /** @deprecated use `OrganizationAvatarFileCreateService$outboundSchema` instead. */ - export const outboundSchema = - OrganizationAvatarFileCreateService$outboundSchema; -} - /** @internal */ export const OrganizationAvatarFileCreate$inboundSchema: z.ZodType< OrganizationAvatarFileCreate, @@ -111,7 +80,9 @@ export const OrganizationAvatarFileCreate$outboundSchema: z.ZodType< size: z.number().int(), checksumSha256Base64: z.nullable(z.string()).optional(), upload: S3FileCreateMultipart$outboundSchema, - service: z.literal("organization_avatar").default("organization_avatar"), + service: z.literal("organization_avatar").default( + "organization_avatar" as const, + ), version: z.nullable(z.string()).optional(), }).transform((v) => { return remap$(v, { diff --git a/src/models/components/organizationavatarfileread.ts b/src/models/components/organizationavatarfileread.ts index 6c27375e..d0fb8f12 100644 --- a/src/models/components/organizationavatarfileread.ts +++ b/src/models/components/organizationavatarfileread.ts @@ -5,17 +5,9 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const OrganizationAvatarFileReadService = { - OrganizationAvatar: "organization_avatar", -} as const; -export type OrganizationAvatarFileReadService = ClosedEnum< - typeof OrganizationAvatarFileReadService ->; - /** * File to be used as an organization avatar. */ @@ -42,28 +34,6 @@ export type OrganizationAvatarFileRead = { publicUrl: string; }; -/** @internal */ -export const OrganizationAvatarFileReadService$inboundSchema: z.ZodNativeEnum< - typeof OrganizationAvatarFileReadService -> = z.nativeEnum(OrganizationAvatarFileReadService); - -/** @internal */ -export const OrganizationAvatarFileReadService$outboundSchema: z.ZodNativeEnum< - typeof OrganizationAvatarFileReadService -> = OrganizationAvatarFileReadService$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace OrganizationAvatarFileReadService$ { - /** @deprecated use `OrganizationAvatarFileReadService$inboundSchema` instead. */ - export const inboundSchema = OrganizationAvatarFileReadService$inboundSchema; - /** @deprecated use `OrganizationAvatarFileReadService$outboundSchema` instead. */ - export const outboundSchema = - OrganizationAvatarFileReadService$outboundSchema; -} - /** @internal */ export const OrganizationAvatarFileRead$inboundSchema: z.ZodType< OrganizationAvatarFileRead, @@ -144,7 +114,9 @@ export const OrganizationAvatarFileRead$outboundSchema: z.ZodType< checksumSha256Hex: z.nullable(z.string()), lastModifiedAt: z.nullable(z.date().transform(v => v.toISOString())), version: z.nullable(z.string()), - service: z.literal("organization_avatar").default("organization_avatar"), + service: z.literal("organization_avatar").default( + "organization_avatar" as const, + ), isUploaded: z.boolean(), createdAt: z.date().transform(v => v.toISOString()), sizeReadable: z.string(), diff --git a/src/models/components/productmediafilecreate.ts b/src/models/components/productmediafilecreate.ts index 452a45e4..f05b8544 100644 --- a/src/models/components/productmediafilecreate.ts +++ b/src/models/components/productmediafilecreate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -15,13 +14,6 @@ import { S3FileCreateMultipart$outboundSchema, } from "./s3filecreatemultipart.js"; -export const ProductMediaFileCreateService = { - ProductMedia: "product_media", -} as const; -export type ProductMediaFileCreateService = ClosedEnum< - typeof ProductMediaFileCreateService ->; - /** * Schema to create a file to be used as a product media file. */ @@ -42,27 +34,6 @@ export type ProductMediaFileCreate = { version?: string | null | undefined; }; -/** @internal */ -export const ProductMediaFileCreateService$inboundSchema: z.ZodNativeEnum< - typeof ProductMediaFileCreateService -> = z.nativeEnum(ProductMediaFileCreateService); - -/** @internal */ -export const ProductMediaFileCreateService$outboundSchema: z.ZodNativeEnum< - typeof ProductMediaFileCreateService -> = ProductMediaFileCreateService$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductMediaFileCreateService$ { - /** @deprecated use `ProductMediaFileCreateService$inboundSchema` instead. */ - export const inboundSchema = ProductMediaFileCreateService$inboundSchema; - /** @deprecated use `ProductMediaFileCreateService$outboundSchema` instead. */ - export const outboundSchema = ProductMediaFileCreateService$outboundSchema; -} - /** @internal */ export const ProductMediaFileCreate$inboundSchema: z.ZodType< ProductMediaFileCreate, @@ -109,7 +80,7 @@ export const ProductMediaFileCreate$outboundSchema: z.ZodType< size: z.number().int(), checksumSha256Base64: z.nullable(z.string()).optional(), upload: S3FileCreateMultipart$outboundSchema, - service: z.literal("product_media").default("product_media"), + service: z.literal("product_media").default("product_media" as const), version: z.nullable(z.string()).optional(), }).transform((v) => { return remap$(v, { diff --git a/src/models/components/productmediafileread.ts b/src/models/components/productmediafileread.ts index b39ed521..553272d6 100644 --- a/src/models/components/productmediafileread.ts +++ b/src/models/components/productmediafileread.ts @@ -5,15 +5,9 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const Service = { - ProductMedia: "product_media", -} as const; -export type Service = ClosedEnum; - /** * File to be used as a product media file. */ @@ -40,25 +34,6 @@ export type ProductMediaFileRead = { publicUrl: string; }; -/** @internal */ -export const Service$inboundSchema: z.ZodNativeEnum = z - .nativeEnum(Service); - -/** @internal */ -export const Service$outboundSchema: z.ZodNativeEnum = - Service$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace Service$ { - /** @deprecated use `Service$inboundSchema` instead. */ - export const inboundSchema = Service$inboundSchema; - /** @deprecated use `Service$outboundSchema` instead. */ - export const outboundSchema = Service$outboundSchema; -} - /** @internal */ export const ProductMediaFileRead$inboundSchema: z.ZodType< ProductMediaFileRead, @@ -139,7 +114,7 @@ export const ProductMediaFileRead$outboundSchema: z.ZodType< checksumSha256Hex: z.nullable(z.string()), lastModifiedAt: z.nullable(z.date().transform(v => v.toISOString())), version: z.nullable(z.string()), - service: z.literal("product_media").default("product_media"), + service: z.literal("product_media").default("product_media" as const), isUploaded: z.boolean(), createdAt: z.date().transform(v => v.toISOString()), sizeReadable: z.string(), diff --git a/src/models/components/productpriceonetimecustom.ts b/src/models/components/productpriceonetimecustom.ts index 38e3f3c1..32282bce 100644 --- a/src/models/components/productpriceonetimecustom.ts +++ b/src/models/components/productpriceonetimecustom.ts @@ -5,30 +5,9 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const ProductPriceOneTimeCustomAmountType = { - Custom: "custom", -} as const; -export type ProductPriceOneTimeCustomAmountType = ClosedEnum< - typeof ProductPriceOneTimeCustomAmountType ->; - -/** - * The type of the price. - */ -export const ProductPriceOneTimeCustomType = { - OneTime: "one_time", -} as const; -/** - * The type of the price. - */ -export type ProductPriceOneTimeCustomType = ClosedEnum< - typeof ProductPriceOneTimeCustomType ->; - /** * A pay-what-you-want price for a one-time product. */ @@ -76,50 +55,6 @@ export type ProductPriceOneTimeCustom = { type?: "one_time" | undefined; }; -/** @internal */ -export const ProductPriceOneTimeCustomAmountType$inboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeCustomAmountType -> = z.nativeEnum(ProductPriceOneTimeCustomAmountType); - -/** @internal */ -export const ProductPriceOneTimeCustomAmountType$outboundSchema: - z.ZodNativeEnum = - ProductPriceOneTimeCustomAmountType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceOneTimeCustomAmountType$ { - /** @deprecated use `ProductPriceOneTimeCustomAmountType$inboundSchema` instead. */ - export const inboundSchema = - ProductPriceOneTimeCustomAmountType$inboundSchema; - /** @deprecated use `ProductPriceOneTimeCustomAmountType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceOneTimeCustomAmountType$outboundSchema; -} - -/** @internal */ -export const ProductPriceOneTimeCustomType$inboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeCustomType -> = z.nativeEnum(ProductPriceOneTimeCustomType); - -/** @internal */ -export const ProductPriceOneTimeCustomType$outboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeCustomType -> = ProductPriceOneTimeCustomType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceOneTimeCustomType$ { - /** @deprecated use `ProductPriceOneTimeCustomType$inboundSchema` instead. */ - export const inboundSchema = ProductPriceOneTimeCustomType$inboundSchema; - /** @deprecated use `ProductPriceOneTimeCustomType$outboundSchema` instead. */ - export const outboundSchema = ProductPriceOneTimeCustomType$outboundSchema; -} - /** @internal */ export const ProductPriceOneTimeCustom$inboundSchema: z.ZodType< ProductPriceOneTimeCustom, @@ -177,14 +112,14 @@ export const ProductPriceOneTimeCustom$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - amountType: z.literal("custom").default("custom"), + amountType: z.literal("custom").default("custom" as const), isArchived: z.boolean(), productId: z.string(), priceCurrency: z.string(), minimumAmount: z.nullable(z.number().int()), maximumAmount: z.nullable(z.number().int()), presetAmount: z.nullable(z.number().int()), - type: z.literal("one_time").default("one_time"), + type: z.literal("one_time").default("one_time" as const), }).transform((v) => { return remap$(v, { createdAt: "created_at", diff --git a/src/models/components/productpriceonetimecustomcreate.ts b/src/models/components/productpriceonetimecustomcreate.ts index 17fde932..19d67a71 100644 --- a/src/models/components/productpriceonetimecustomcreate.ts +++ b/src/models/components/productpriceonetimecustomcreate.ts @@ -5,24 +5,9 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const ProductPriceOneTimeCustomCreateType = { - OneTime: "one_time", -} as const; -export type ProductPriceOneTimeCustomCreateType = ClosedEnum< - typeof ProductPriceOneTimeCustomCreateType ->; - -export const ProductPriceOneTimeCustomCreateAmountType = { - Custom: "custom", -} as const; -export type ProductPriceOneTimeCustomCreateAmountType = ClosedEnum< - typeof ProductPriceOneTimeCustomCreateAmountType ->; - /** * Schema to create a pay-what-you-want price for a one-time product. */ @@ -47,52 +32,6 @@ export type ProductPriceOneTimeCustomCreate = { presetAmount?: number | null | undefined; }; -/** @internal */ -export const ProductPriceOneTimeCustomCreateType$inboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeCustomCreateType -> = z.nativeEnum(ProductPriceOneTimeCustomCreateType); - -/** @internal */ -export const ProductPriceOneTimeCustomCreateType$outboundSchema: - z.ZodNativeEnum = - ProductPriceOneTimeCustomCreateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceOneTimeCustomCreateType$ { - /** @deprecated use `ProductPriceOneTimeCustomCreateType$inboundSchema` instead. */ - export const inboundSchema = - ProductPriceOneTimeCustomCreateType$inboundSchema; - /** @deprecated use `ProductPriceOneTimeCustomCreateType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceOneTimeCustomCreateType$outboundSchema; -} - -/** @internal */ -export const ProductPriceOneTimeCustomCreateAmountType$inboundSchema: - z.ZodNativeEnum = z - .nativeEnum(ProductPriceOneTimeCustomCreateAmountType); - -/** @internal */ -export const ProductPriceOneTimeCustomCreateAmountType$outboundSchema: - z.ZodNativeEnum = - ProductPriceOneTimeCustomCreateAmountType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceOneTimeCustomCreateAmountType$ { - /** @deprecated use `ProductPriceOneTimeCustomCreateAmountType$inboundSchema` instead. */ - export const inboundSchema = - ProductPriceOneTimeCustomCreateAmountType$inboundSchema; - /** @deprecated use `ProductPriceOneTimeCustomCreateAmountType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceOneTimeCustomCreateAmountType$outboundSchema; -} - /** @internal */ export const ProductPriceOneTimeCustomCreate$inboundSchema: z.ZodType< ProductPriceOneTimeCustomCreate, @@ -131,8 +70,8 @@ export const ProductPriceOneTimeCustomCreate$outboundSchema: z.ZodType< z.ZodTypeDef, ProductPriceOneTimeCustomCreate > = z.object({ - type: z.literal("one_time").default("one_time"), - amountType: z.literal("custom").default("custom"), + type: z.literal("one_time").default("one_time" as const), + amountType: z.literal("custom").default("custom" as const), priceCurrency: z.string().default("usd"), minimumAmount: z.nullable(z.number().int()).optional(), maximumAmount: z.nullable(z.number().int()).optional(), diff --git a/src/models/components/productpriceonetimefixed.ts b/src/models/components/productpriceonetimefixed.ts index cb78b9af..dfbdc0ec 100644 --- a/src/models/components/productpriceonetimefixed.ts +++ b/src/models/components/productpriceonetimefixed.ts @@ -5,30 +5,9 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const ProductPriceOneTimeFixedAmountType = { - Fixed: "fixed", -} as const; -export type ProductPriceOneTimeFixedAmountType = ClosedEnum< - typeof ProductPriceOneTimeFixedAmountType ->; - -/** - * The type of the price. - */ -export const ProductPriceOneTimeFixedType = { - OneTime: "one_time", -} as const; -/** - * The type of the price. - */ -export type ProductPriceOneTimeFixedType = ClosedEnum< - typeof ProductPriceOneTimeFixedType ->; - /** * A one-time price for a product. */ @@ -68,49 +47,6 @@ export type ProductPriceOneTimeFixed = { type?: "one_time" | undefined; }; -/** @internal */ -export const ProductPriceOneTimeFixedAmountType$inboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeFixedAmountType -> = z.nativeEnum(ProductPriceOneTimeFixedAmountType); - -/** @internal */ -export const ProductPriceOneTimeFixedAmountType$outboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeFixedAmountType -> = ProductPriceOneTimeFixedAmountType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceOneTimeFixedAmountType$ { - /** @deprecated use `ProductPriceOneTimeFixedAmountType$inboundSchema` instead. */ - export const inboundSchema = ProductPriceOneTimeFixedAmountType$inboundSchema; - /** @deprecated use `ProductPriceOneTimeFixedAmountType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceOneTimeFixedAmountType$outboundSchema; -} - -/** @internal */ -export const ProductPriceOneTimeFixedType$inboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeFixedType -> = z.nativeEnum(ProductPriceOneTimeFixedType); - -/** @internal */ -export const ProductPriceOneTimeFixedType$outboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeFixedType -> = ProductPriceOneTimeFixedType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceOneTimeFixedType$ { - /** @deprecated use `ProductPriceOneTimeFixedType$inboundSchema` instead. */ - export const inboundSchema = ProductPriceOneTimeFixedType$inboundSchema; - /** @deprecated use `ProductPriceOneTimeFixedType$outboundSchema` instead. */ - export const outboundSchema = ProductPriceOneTimeFixedType$outboundSchema; -} - /** @internal */ export const ProductPriceOneTimeFixed$inboundSchema: z.ZodType< ProductPriceOneTimeFixed, @@ -162,12 +98,12 @@ export const ProductPriceOneTimeFixed$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - amountType: z.literal("fixed").default("fixed"), + amountType: z.literal("fixed").default("fixed" as const), isArchived: z.boolean(), productId: z.string(), priceCurrency: z.string(), priceAmount: z.number().int(), - type: z.literal("one_time").default("one_time"), + type: z.literal("one_time").default("one_time" as const), }).transform((v) => { return remap$(v, { createdAt: "created_at", diff --git a/src/models/components/productpriceonetimefixedcreate.ts b/src/models/components/productpriceonetimefixedcreate.ts index 3b96e86f..172bbaf3 100644 --- a/src/models/components/productpriceonetimefixedcreate.ts +++ b/src/models/components/productpriceonetimefixedcreate.ts @@ -5,24 +5,9 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const ProductPriceOneTimeFixedCreateType = { - OneTime: "one_time", -} as const; -export type ProductPriceOneTimeFixedCreateType = ClosedEnum< - typeof ProductPriceOneTimeFixedCreateType ->; - -export const ProductPriceOneTimeFixedCreateAmountType = { - Fixed: "fixed", -} as const; -export type ProductPriceOneTimeFixedCreateAmountType = ClosedEnum< - typeof ProductPriceOneTimeFixedCreateAmountType ->; - /** * Schema to create a one-time product price. */ @@ -39,51 +24,6 @@ export type ProductPriceOneTimeFixedCreate = { priceCurrency?: string | undefined; }; -/** @internal */ -export const ProductPriceOneTimeFixedCreateType$inboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeFixedCreateType -> = z.nativeEnum(ProductPriceOneTimeFixedCreateType); - -/** @internal */ -export const ProductPriceOneTimeFixedCreateType$outboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeFixedCreateType -> = ProductPriceOneTimeFixedCreateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceOneTimeFixedCreateType$ { - /** @deprecated use `ProductPriceOneTimeFixedCreateType$inboundSchema` instead. */ - export const inboundSchema = ProductPriceOneTimeFixedCreateType$inboundSchema; - /** @deprecated use `ProductPriceOneTimeFixedCreateType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceOneTimeFixedCreateType$outboundSchema; -} - -/** @internal */ -export const ProductPriceOneTimeFixedCreateAmountType$inboundSchema: - z.ZodNativeEnum = z - .nativeEnum(ProductPriceOneTimeFixedCreateAmountType); - -/** @internal */ -export const ProductPriceOneTimeFixedCreateAmountType$outboundSchema: - z.ZodNativeEnum = - ProductPriceOneTimeFixedCreateAmountType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceOneTimeFixedCreateAmountType$ { - /** @deprecated use `ProductPriceOneTimeFixedCreateAmountType$inboundSchema` instead. */ - export const inboundSchema = - ProductPriceOneTimeFixedCreateAmountType$inboundSchema; - /** @deprecated use `ProductPriceOneTimeFixedCreateAmountType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceOneTimeFixedCreateAmountType$outboundSchema; -} - /** @internal */ export const ProductPriceOneTimeFixedCreate$inboundSchema: z.ZodType< ProductPriceOneTimeFixedCreate, @@ -116,8 +56,8 @@ export const ProductPriceOneTimeFixedCreate$outboundSchema: z.ZodType< z.ZodTypeDef, ProductPriceOneTimeFixedCreate > = z.object({ - type: z.literal("one_time").default("one_time"), - amountType: z.literal("fixed").default("fixed"), + type: z.literal("one_time").default("one_time" as const), + amountType: z.literal("fixed").default("fixed" as const), priceAmount: z.number().int(), priceCurrency: z.string().default("usd"), }).transform((v) => { diff --git a/src/models/components/productpriceonetimefree.ts b/src/models/components/productpriceonetimefree.ts index cda78116..df85475d 100644 --- a/src/models/components/productpriceonetimefree.ts +++ b/src/models/components/productpriceonetimefree.ts @@ -5,30 +5,9 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const ProductPriceOneTimeFreeAmountType = { - Free: "free", -} as const; -export type ProductPriceOneTimeFreeAmountType = ClosedEnum< - typeof ProductPriceOneTimeFreeAmountType ->; - -/** - * The type of the price. - */ -export const ProductPriceOneTimeFreeType = { - OneTime: "one_time", -} as const; -/** - * The type of the price. - */ -export type ProductPriceOneTimeFreeType = ClosedEnum< - typeof ProductPriceOneTimeFreeType ->; - /** * A free one-time price for a product. */ @@ -60,49 +39,6 @@ export type ProductPriceOneTimeFree = { type?: "one_time" | undefined; }; -/** @internal */ -export const ProductPriceOneTimeFreeAmountType$inboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeFreeAmountType -> = z.nativeEnum(ProductPriceOneTimeFreeAmountType); - -/** @internal */ -export const ProductPriceOneTimeFreeAmountType$outboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeFreeAmountType -> = ProductPriceOneTimeFreeAmountType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceOneTimeFreeAmountType$ { - /** @deprecated use `ProductPriceOneTimeFreeAmountType$inboundSchema` instead. */ - export const inboundSchema = ProductPriceOneTimeFreeAmountType$inboundSchema; - /** @deprecated use `ProductPriceOneTimeFreeAmountType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceOneTimeFreeAmountType$outboundSchema; -} - -/** @internal */ -export const ProductPriceOneTimeFreeType$inboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeFreeType -> = z.nativeEnum(ProductPriceOneTimeFreeType); - -/** @internal */ -export const ProductPriceOneTimeFreeType$outboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeFreeType -> = ProductPriceOneTimeFreeType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceOneTimeFreeType$ { - /** @deprecated use `ProductPriceOneTimeFreeType$inboundSchema` instead. */ - export const inboundSchema = ProductPriceOneTimeFreeType$inboundSchema; - /** @deprecated use `ProductPriceOneTimeFreeType$outboundSchema` instead. */ - export const outboundSchema = ProductPriceOneTimeFreeType$outboundSchema; -} - /** @internal */ export const ProductPriceOneTimeFree$inboundSchema: z.ZodType< ProductPriceOneTimeFree, @@ -148,10 +84,10 @@ export const ProductPriceOneTimeFree$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - amountType: z.literal("free").default("free"), + amountType: z.literal("free").default("free" as const), isArchived: z.boolean(), productId: z.string(), - type: z.literal("one_time").default("one_time"), + type: z.literal("one_time").default("one_time" as const), }).transform((v) => { return remap$(v, { createdAt: "created_at", diff --git a/src/models/components/productpriceonetimefreecreate.ts b/src/models/components/productpriceonetimefreecreate.ts index 96aeff46..7286bc11 100644 --- a/src/models/components/productpriceonetimefreecreate.ts +++ b/src/models/components/productpriceonetimefreecreate.ts @@ -5,24 +5,9 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const ProductPriceOneTimeFreeCreateType = { - OneTime: "one_time", -} as const; -export type ProductPriceOneTimeFreeCreateType = ClosedEnum< - typeof ProductPriceOneTimeFreeCreateType ->; - -export const ProductPriceOneTimeFreeCreateAmountType = { - Free: "free", -} as const; -export type ProductPriceOneTimeFreeCreateAmountType = ClosedEnum< - typeof ProductPriceOneTimeFreeCreateAmountType ->; - /** * Schema to create a free one-time product price. */ @@ -31,51 +16,6 @@ export type ProductPriceOneTimeFreeCreate = { amountType?: "free" | undefined; }; -/** @internal */ -export const ProductPriceOneTimeFreeCreateType$inboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeFreeCreateType -> = z.nativeEnum(ProductPriceOneTimeFreeCreateType); - -/** @internal */ -export const ProductPriceOneTimeFreeCreateType$outboundSchema: z.ZodNativeEnum< - typeof ProductPriceOneTimeFreeCreateType -> = ProductPriceOneTimeFreeCreateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceOneTimeFreeCreateType$ { - /** @deprecated use `ProductPriceOneTimeFreeCreateType$inboundSchema` instead. */ - export const inboundSchema = ProductPriceOneTimeFreeCreateType$inboundSchema; - /** @deprecated use `ProductPriceOneTimeFreeCreateType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceOneTimeFreeCreateType$outboundSchema; -} - -/** @internal */ -export const ProductPriceOneTimeFreeCreateAmountType$inboundSchema: - z.ZodNativeEnum = z - .nativeEnum(ProductPriceOneTimeFreeCreateAmountType); - -/** @internal */ -export const ProductPriceOneTimeFreeCreateAmountType$outboundSchema: - z.ZodNativeEnum = - ProductPriceOneTimeFreeCreateAmountType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceOneTimeFreeCreateAmountType$ { - /** @deprecated use `ProductPriceOneTimeFreeCreateAmountType$inboundSchema` instead. */ - export const inboundSchema = - ProductPriceOneTimeFreeCreateAmountType$inboundSchema; - /** @deprecated use `ProductPriceOneTimeFreeCreateAmountType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceOneTimeFreeCreateAmountType$outboundSchema; -} - /** @internal */ export const ProductPriceOneTimeFreeCreate$inboundSchema: z.ZodType< ProductPriceOneTimeFreeCreate, @@ -102,8 +42,8 @@ export const ProductPriceOneTimeFreeCreate$outboundSchema: z.ZodType< z.ZodTypeDef, ProductPriceOneTimeFreeCreate > = z.object({ - type: z.literal("one_time").default("one_time"), - amountType: z.literal("free").default("free"), + type: z.literal("one_time").default("one_time" as const), + amountType: z.literal("free").default("free" as const), }).transform((v) => { return remap$(v, { amountType: "amount_type", diff --git a/src/models/components/productpricerecurringcustom.ts b/src/models/components/productpricerecurringcustom.ts index 601089d9..2d52a1f7 100644 --- a/src/models/components/productpricerecurringcustom.ts +++ b/src/models/components/productpricerecurringcustom.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,26 +13,6 @@ import { SubscriptionRecurringInterval$outboundSchema, } from "./subscriptionrecurringinterval.js"; -export const ProductPriceRecurringCustomAmountType = { - Custom: "custom", -} as const; -export type ProductPriceRecurringCustomAmountType = ClosedEnum< - typeof ProductPriceRecurringCustomAmountType ->; - -/** - * The type of the price. - */ -export const ProductPriceRecurringCustomType = { - Recurring: "recurring", -} as const; -/** - * The type of the price. - */ -export type ProductPriceRecurringCustomType = ClosedEnum< - typeof ProductPriceRecurringCustomType ->; - /** * A pay-what-you-want recurring price for a product, i.e. a subscription. */ @@ -82,51 +61,6 @@ export type ProductPriceRecurringCustom = { recurringInterval: SubscriptionRecurringInterval; }; -/** @internal */ -export const ProductPriceRecurringCustomAmountType$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - ProductPriceRecurringCustomAmountType, - ); - -/** @internal */ -export const ProductPriceRecurringCustomAmountType$outboundSchema: - z.ZodNativeEnum = - ProductPriceRecurringCustomAmountType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceRecurringCustomAmountType$ { - /** @deprecated use `ProductPriceRecurringCustomAmountType$inboundSchema` instead. */ - export const inboundSchema = - ProductPriceRecurringCustomAmountType$inboundSchema; - /** @deprecated use `ProductPriceRecurringCustomAmountType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceRecurringCustomAmountType$outboundSchema; -} - -/** @internal */ -export const ProductPriceRecurringCustomType$inboundSchema: z.ZodNativeEnum< - typeof ProductPriceRecurringCustomType -> = z.nativeEnum(ProductPriceRecurringCustomType); - -/** @internal */ -export const ProductPriceRecurringCustomType$outboundSchema: z.ZodNativeEnum< - typeof ProductPriceRecurringCustomType -> = ProductPriceRecurringCustomType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceRecurringCustomType$ { - /** @deprecated use `ProductPriceRecurringCustomType$inboundSchema` instead. */ - export const inboundSchema = ProductPriceRecurringCustomType$inboundSchema; - /** @deprecated use `ProductPriceRecurringCustomType$outboundSchema` instead. */ - export const outboundSchema = ProductPriceRecurringCustomType$outboundSchema; -} - /** @internal */ export const ProductPriceRecurringCustom$inboundSchema: z.ZodType< ProductPriceRecurringCustom, @@ -187,14 +121,14 @@ export const ProductPriceRecurringCustom$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - amountType: z.literal("custom").default("custom"), + amountType: z.literal("custom").default("custom" as const), isArchived: z.boolean(), productId: z.string(), priceCurrency: z.string(), minimumAmount: z.nullable(z.number().int()), maximumAmount: z.nullable(z.number().int()), presetAmount: z.nullable(z.number().int()), - type: z.literal("recurring").default("recurring"), + type: z.literal("recurring").default("recurring" as const), recurringInterval: SubscriptionRecurringInterval$outboundSchema, }).transform((v) => { return remap$(v, { diff --git a/src/models/components/productpricerecurringfixed.ts b/src/models/components/productpricerecurringfixed.ts index 1f078e5e..58e68625 100644 --- a/src/models/components/productpricerecurringfixed.ts +++ b/src/models/components/productpricerecurringfixed.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,22 +13,6 @@ import { SubscriptionRecurringInterval$outboundSchema, } from "./subscriptionrecurringinterval.js"; -export const AmountType = { - Fixed: "fixed", -} as const; -export type AmountType = ClosedEnum; - -/** - * The type of the price. - */ -export const Type = { - Recurring: "recurring", -} as const; -/** - * The type of the price. - */ -export type Type = ClosedEnum; - /** * A recurring price for a product, i.e. a subscription. */ @@ -70,45 +53,6 @@ export type ProductPriceRecurringFixed = { recurringInterval: SubscriptionRecurringInterval; }; -/** @internal */ -export const AmountType$inboundSchema: z.ZodNativeEnum = z - .nativeEnum(AmountType); - -/** @internal */ -export const AmountType$outboundSchema: z.ZodNativeEnum = - AmountType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace AmountType$ { - /** @deprecated use `AmountType$inboundSchema` instead. */ - export const inboundSchema = AmountType$inboundSchema; - /** @deprecated use `AmountType$outboundSchema` instead. */ - export const outboundSchema = AmountType$outboundSchema; -} - -/** @internal */ -export const Type$inboundSchema: z.ZodNativeEnum = z.nativeEnum( - Type, -); - -/** @internal */ -export const Type$outboundSchema: z.ZodNativeEnum = - Type$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace Type$ { - /** @deprecated use `Type$inboundSchema` instead. */ - export const inboundSchema = Type$inboundSchema; - /** @deprecated use `Type$outboundSchema` instead. */ - export const outboundSchema = Type$outboundSchema; -} - /** @internal */ export const ProductPriceRecurringFixed$inboundSchema: z.ZodType< ProductPriceRecurringFixed, @@ -163,12 +107,12 @@ export const ProductPriceRecurringFixed$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - amountType: z.literal("fixed").default("fixed"), + amountType: z.literal("fixed").default("fixed" as const), isArchived: z.boolean(), productId: z.string(), priceCurrency: z.string(), priceAmount: z.number().int(), - type: z.literal("recurring").default("recurring"), + type: z.literal("recurring").default("recurring" as const), recurringInterval: SubscriptionRecurringInterval$outboundSchema, }).transform((v) => { return remap$(v, { diff --git a/src/models/components/productpricerecurringfixedcreate.ts b/src/models/components/productpricerecurringfixedcreate.ts index 7be0578b..7ed54ee4 100644 --- a/src/models/components/productpricerecurringfixedcreate.ts +++ b/src/models/components/productpricerecurringfixedcreate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,20 +13,6 @@ import { SubscriptionRecurringInterval$outboundSchema, } from "./subscriptionrecurringinterval.js"; -export const ProductPriceRecurringFixedCreateType = { - Recurring: "recurring", -} as const; -export type ProductPriceRecurringFixedCreateType = ClosedEnum< - typeof ProductPriceRecurringFixedCreateType ->; - -export const ProductPriceRecurringFixedCreateAmountType = { - Fixed: "fixed", -} as const; -export type ProductPriceRecurringFixedCreateAmountType = ClosedEnum< - typeof ProductPriceRecurringFixedCreateAmountType ->; - /** * Schema to create a recurring product price, i.e. a subscription. */ @@ -45,53 +30,6 @@ export type ProductPriceRecurringFixedCreate = { recurringInterval: SubscriptionRecurringInterval; }; -/** @internal */ -export const ProductPriceRecurringFixedCreateType$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - ProductPriceRecurringFixedCreateType, - ); - -/** @internal */ -export const ProductPriceRecurringFixedCreateType$outboundSchema: - z.ZodNativeEnum = - ProductPriceRecurringFixedCreateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceRecurringFixedCreateType$ { - /** @deprecated use `ProductPriceRecurringFixedCreateType$inboundSchema` instead. */ - export const inboundSchema = - ProductPriceRecurringFixedCreateType$inboundSchema; - /** @deprecated use `ProductPriceRecurringFixedCreateType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceRecurringFixedCreateType$outboundSchema; -} - -/** @internal */ -export const ProductPriceRecurringFixedCreateAmountType$inboundSchema: - z.ZodNativeEnum = z - .nativeEnum(ProductPriceRecurringFixedCreateAmountType); - -/** @internal */ -export const ProductPriceRecurringFixedCreateAmountType$outboundSchema: - z.ZodNativeEnum = - ProductPriceRecurringFixedCreateAmountType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceRecurringFixedCreateAmountType$ { - /** @deprecated use `ProductPriceRecurringFixedCreateAmountType$inboundSchema` instead. */ - export const inboundSchema = - ProductPriceRecurringFixedCreateAmountType$inboundSchema; - /** @deprecated use `ProductPriceRecurringFixedCreateAmountType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceRecurringFixedCreateAmountType$outboundSchema; -} - /** @internal */ export const ProductPriceRecurringFixedCreate$inboundSchema: z.ZodType< ProductPriceRecurringFixedCreate, @@ -127,8 +65,8 @@ export const ProductPriceRecurringFixedCreate$outboundSchema: z.ZodType< z.ZodTypeDef, ProductPriceRecurringFixedCreate > = z.object({ - type: z.literal("recurring").default("recurring"), - amountType: z.literal("fixed").default("fixed"), + type: z.literal("recurring").default("recurring" as const), + amountType: z.literal("fixed").default("fixed" as const), priceAmount: z.number().int(), priceCurrency: z.string().default("usd"), recurringInterval: SubscriptionRecurringInterval$outboundSchema, diff --git a/src/models/components/productpricerecurringfree.ts b/src/models/components/productpricerecurringfree.ts index 77f59cdc..85e61779 100644 --- a/src/models/components/productpricerecurringfree.ts +++ b/src/models/components/productpricerecurringfree.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,26 +13,6 @@ import { SubscriptionRecurringInterval$outboundSchema, } from "./subscriptionrecurringinterval.js"; -export const ProductPriceRecurringFreeAmountType = { - Free: "free", -} as const; -export type ProductPriceRecurringFreeAmountType = ClosedEnum< - typeof ProductPriceRecurringFreeAmountType ->; - -/** - * The type of the price. - */ -export const ProductPriceRecurringFreeType = { - Recurring: "recurring", -} as const; -/** - * The type of the price. - */ -export type ProductPriceRecurringFreeType = ClosedEnum< - typeof ProductPriceRecurringFreeType ->; - /** * A free recurring price for a product, i.e. a subscription. */ @@ -66,50 +45,6 @@ export type ProductPriceRecurringFree = { recurringInterval: SubscriptionRecurringInterval; }; -/** @internal */ -export const ProductPriceRecurringFreeAmountType$inboundSchema: z.ZodNativeEnum< - typeof ProductPriceRecurringFreeAmountType -> = z.nativeEnum(ProductPriceRecurringFreeAmountType); - -/** @internal */ -export const ProductPriceRecurringFreeAmountType$outboundSchema: - z.ZodNativeEnum = - ProductPriceRecurringFreeAmountType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceRecurringFreeAmountType$ { - /** @deprecated use `ProductPriceRecurringFreeAmountType$inboundSchema` instead. */ - export const inboundSchema = - ProductPriceRecurringFreeAmountType$inboundSchema; - /** @deprecated use `ProductPriceRecurringFreeAmountType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceRecurringFreeAmountType$outboundSchema; -} - -/** @internal */ -export const ProductPriceRecurringFreeType$inboundSchema: z.ZodNativeEnum< - typeof ProductPriceRecurringFreeType -> = z.nativeEnum(ProductPriceRecurringFreeType); - -/** @internal */ -export const ProductPriceRecurringFreeType$outboundSchema: z.ZodNativeEnum< - typeof ProductPriceRecurringFreeType -> = ProductPriceRecurringFreeType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceRecurringFreeType$ { - /** @deprecated use `ProductPriceRecurringFreeType$inboundSchema` instead. */ - export const inboundSchema = ProductPriceRecurringFreeType$inboundSchema; - /** @deprecated use `ProductPriceRecurringFreeType$outboundSchema` instead. */ - export const outboundSchema = ProductPriceRecurringFreeType$outboundSchema; -} - /** @internal */ export const ProductPriceRecurringFree$inboundSchema: z.ZodType< ProductPriceRecurringFree, @@ -158,10 +93,10 @@ export const ProductPriceRecurringFree$outboundSchema: z.ZodType< createdAt: z.date().transform(v => v.toISOString()), modifiedAt: z.nullable(z.date().transform(v => v.toISOString())), id: z.string(), - amountType: z.literal("free").default("free"), + amountType: z.literal("free").default("free" as const), isArchived: z.boolean(), productId: z.string(), - type: z.literal("recurring").default("recurring"), + type: z.literal("recurring").default("recurring" as const), recurringInterval: SubscriptionRecurringInterval$outboundSchema, }).transform((v) => { return remap$(v, { diff --git a/src/models/components/productpricerecurringfreecreate.ts b/src/models/components/productpricerecurringfreecreate.ts index 3dc95d3b..e054dd78 100644 --- a/src/models/components/productpricerecurringfreecreate.ts +++ b/src/models/components/productpricerecurringfreecreate.ts @@ -5,7 +5,6 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,20 +13,6 @@ import { SubscriptionRecurringInterval$outboundSchema, } from "./subscriptionrecurringinterval.js"; -export const ProductPriceRecurringFreeCreateType = { - Recurring: "recurring", -} as const; -export type ProductPriceRecurringFreeCreateType = ClosedEnum< - typeof ProductPriceRecurringFreeCreateType ->; - -export const ProductPriceRecurringFreeCreateAmountType = { - Free: "free", -} as const; -export type ProductPriceRecurringFreeCreateAmountType = ClosedEnum< - typeof ProductPriceRecurringFreeCreateAmountType ->; - /** * Schema to create a free recurring product price, i.e. a subscription. */ @@ -37,52 +22,6 @@ export type ProductPriceRecurringFreeCreate = { recurringInterval: SubscriptionRecurringInterval; }; -/** @internal */ -export const ProductPriceRecurringFreeCreateType$inboundSchema: z.ZodNativeEnum< - typeof ProductPriceRecurringFreeCreateType -> = z.nativeEnum(ProductPriceRecurringFreeCreateType); - -/** @internal */ -export const ProductPriceRecurringFreeCreateType$outboundSchema: - z.ZodNativeEnum = - ProductPriceRecurringFreeCreateType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceRecurringFreeCreateType$ { - /** @deprecated use `ProductPriceRecurringFreeCreateType$inboundSchema` instead. */ - export const inboundSchema = - ProductPriceRecurringFreeCreateType$inboundSchema; - /** @deprecated use `ProductPriceRecurringFreeCreateType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceRecurringFreeCreateType$outboundSchema; -} - -/** @internal */ -export const ProductPriceRecurringFreeCreateAmountType$inboundSchema: - z.ZodNativeEnum = z - .nativeEnum(ProductPriceRecurringFreeCreateAmountType); - -/** @internal */ -export const ProductPriceRecurringFreeCreateAmountType$outboundSchema: - z.ZodNativeEnum = - ProductPriceRecurringFreeCreateAmountType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ProductPriceRecurringFreeCreateAmountType$ { - /** @deprecated use `ProductPriceRecurringFreeCreateAmountType$inboundSchema` instead. */ - export const inboundSchema = - ProductPriceRecurringFreeCreateAmountType$inboundSchema; - /** @deprecated use `ProductPriceRecurringFreeCreateAmountType$outboundSchema` instead. */ - export const outboundSchema = - ProductPriceRecurringFreeCreateAmountType$outboundSchema; -} - /** @internal */ export const ProductPriceRecurringFreeCreate$inboundSchema: z.ZodType< ProductPriceRecurringFreeCreate, @@ -112,8 +51,8 @@ export const ProductPriceRecurringFreeCreate$outboundSchema: z.ZodType< z.ZodTypeDef, ProductPriceRecurringFreeCreate > = z.object({ - type: z.literal("recurring").default("recurring"), - amountType: z.literal("free").default("free"), + type: z.literal("recurring").default("recurring" as const), + amountType: z.literal("free").default("free" as const), recurringInterval: SubscriptionRecurringInterval$outboundSchema, }).transform((v) => { return remap$(v, { diff --git a/src/models/components/repository.ts b/src/models/components/repository.ts index 5dd00b85..0296c576 100644 --- a/src/models/components/repository.ts +++ b/src/models/components/repository.ts @@ -19,6 +19,11 @@ import { Organization$Outbound, Organization$outboundSchema, } from "./organization.js"; +import { + Platforms, + Platforms$inboundSchema, + Platforms$outboundSchema, +} from "./platforms.js"; import { RepositoryProfileSettings, RepositoryProfileSettings$inboundSchema, @@ -28,7 +33,7 @@ import { export type Repository = { id: string; - platform?: "github" | undefined; + platform: Platforms; isPrivate: boolean; name: string; description: string | null; @@ -50,7 +55,7 @@ export const Repository$inboundSchema: z.ZodType< unknown > = z.object({ id: z.string(), - platform: z.literal("github").optional(), + platform: Platforms$inboundSchema, is_private: z.boolean(), name: z.string(), description: z.nullable(z.string()), @@ -71,7 +76,7 @@ export const Repository$inboundSchema: z.ZodType< /** @internal */ export type Repository$Outbound = { id: string; - platform: "github"; + platform: string; is_private: boolean; name: string; description: string | null; @@ -90,7 +95,7 @@ export const Repository$outboundSchema: z.ZodType< Repository > = z.object({ id: z.string(), - platform: z.literal("github").default("github"), + platform: Platforms$outboundSchema, isPrivate: z.boolean(), name: z.string(), description: z.nullable(z.string()), diff --git a/src/models/components/tokenresponse.ts b/src/models/components/tokenresponse.ts index 94c35970..6475b098 100644 --- a/src/models/components/tokenresponse.ts +++ b/src/models/components/tokenresponse.ts @@ -5,15 +5,9 @@ import * as z from "zod"; import { remap as remap$ } from "../../lib/primitives.js"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; -export const TokenType = { - Bearer: "Bearer", -} as const; -export type TokenType = ClosedEnum; - export type TokenResponse = { accessToken: string; tokenType?: "Bearer" | undefined; @@ -23,25 +17,6 @@ export type TokenResponse = { idToken: string; }; -/** @internal */ -export const TokenType$inboundSchema: z.ZodNativeEnum = z - .nativeEnum(TokenType); - -/** @internal */ -export const TokenType$outboundSchema: z.ZodNativeEnum = - TokenType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace TokenType$ { - /** @deprecated use `TokenType$inboundSchema` instead. */ - export const inboundSchema = TokenType$inboundSchema; - /** @deprecated use `TokenType$outboundSchema` instead. */ - export const outboundSchema = TokenType$outboundSchema; -} - /** @internal */ export const TokenResponse$inboundSchema: z.ZodType< TokenResponse, @@ -81,7 +56,7 @@ export const TokenResponse$outboundSchema: z.ZodType< TokenResponse > = z.object({ accessToken: z.string(), - tokenType: z.literal("Bearer").default("Bearer"), + tokenType: z.literal("Bearer").default("Bearer" as const), expiresIn: z.number().int(), refreshToken: z.nullable(z.string()), scope: z.string(), diff --git a/src/models/components/webhookbenefitcreatedpayload.ts b/src/models/components/webhookbenefitcreatedpayload.ts index 2eb8d1cb..232ad839 100644 --- a/src/models/components/webhookbenefitcreatedpayload.ts +++ b/src/models/components/webhookbenefitcreatedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Benefit$outboundSchema, } from "./benefit.js"; -export const WebhookBenefitCreatedPayloadType = { - BenefitCreated: "benefit.created", -} as const; -export type WebhookBenefitCreatedPayloadType = ClosedEnum< - typeof WebhookBenefitCreatedPayloadType ->; - /** * Sent when a new benefit is created. * @@ -33,27 +25,6 @@ export type WebhookBenefitCreatedPayload = { data: Benefit; }; -/** @internal */ -export const WebhookBenefitCreatedPayloadType$inboundSchema: z.ZodNativeEnum< - typeof WebhookBenefitCreatedPayloadType -> = z.nativeEnum(WebhookBenefitCreatedPayloadType); - -/** @internal */ -export const WebhookBenefitCreatedPayloadType$outboundSchema: z.ZodNativeEnum< - typeof WebhookBenefitCreatedPayloadType -> = WebhookBenefitCreatedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookBenefitCreatedPayloadType$ { - /** @deprecated use `WebhookBenefitCreatedPayloadType$inboundSchema` instead. */ - export const inboundSchema = WebhookBenefitCreatedPayloadType$inboundSchema; - /** @deprecated use `WebhookBenefitCreatedPayloadType$outboundSchema` instead. */ - export const outboundSchema = WebhookBenefitCreatedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookBenefitCreatedPayload$inboundSchema: z.ZodType< WebhookBenefitCreatedPayload, @@ -76,7 +47,7 @@ export const WebhookBenefitCreatedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookBenefitCreatedPayload > = z.object({ - type: z.literal("benefit.created").default("benefit.created"), + type: z.literal("benefit.created").default("benefit.created" as const), data: Benefit$outboundSchema, }); diff --git a/src/models/components/webhookbenefitgrantcreatedpayload.ts b/src/models/components/webhookbenefitgrantcreatedpayload.ts index 2aa9f161..2fd38915 100644 --- a/src/models/components/webhookbenefitgrantcreatedpayload.ts +++ b/src/models/components/webhookbenefitgrantcreatedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { BenefitGrantWebhook$outboundSchema, } from "./benefitgrantwebhook.js"; -export const WebhookBenefitGrantCreatedPayloadType = { - BenefitGrantCreated: "benefit_grant.created", -} as const; -export type WebhookBenefitGrantCreatedPayloadType = ClosedEnum< - typeof WebhookBenefitGrantCreatedPayloadType ->; - /** * Sent when a new benefit grant is created. * @@ -33,30 +25,6 @@ export type WebhookBenefitGrantCreatedPayload = { data: BenefitGrantWebhook; }; -/** @internal */ -export const WebhookBenefitGrantCreatedPayloadType$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - WebhookBenefitGrantCreatedPayloadType, - ); - -/** @internal */ -export const WebhookBenefitGrantCreatedPayloadType$outboundSchema: - z.ZodNativeEnum = - WebhookBenefitGrantCreatedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookBenefitGrantCreatedPayloadType$ { - /** @deprecated use `WebhookBenefitGrantCreatedPayloadType$inboundSchema` instead. */ - export const inboundSchema = - WebhookBenefitGrantCreatedPayloadType$inboundSchema; - /** @deprecated use `WebhookBenefitGrantCreatedPayloadType$outboundSchema` instead. */ - export const outboundSchema = - WebhookBenefitGrantCreatedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookBenefitGrantCreatedPayload$inboundSchema: z.ZodType< WebhookBenefitGrantCreatedPayload, @@ -79,7 +47,9 @@ export const WebhookBenefitGrantCreatedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookBenefitGrantCreatedPayload > = z.object({ - type: z.literal("benefit_grant.created").default("benefit_grant.created"), + type: z.literal("benefit_grant.created").default( + "benefit_grant.created" as const, + ), data: BenefitGrantWebhook$outboundSchema, }); diff --git a/src/models/components/webhookbenefitgrantrevokedpayload.ts b/src/models/components/webhookbenefitgrantrevokedpayload.ts index d18036be..cf52cb0a 100644 --- a/src/models/components/webhookbenefitgrantrevokedpayload.ts +++ b/src/models/components/webhookbenefitgrantrevokedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { BenefitGrantWebhook$outboundSchema, } from "./benefitgrantwebhook.js"; -export const WebhookBenefitGrantRevokedPayloadType = { - BenefitGrantRevoked: "benefit_grant.revoked", -} as const; -export type WebhookBenefitGrantRevokedPayloadType = ClosedEnum< - typeof WebhookBenefitGrantRevokedPayloadType ->; - /** * Sent when a new benefit grant is revoked. * @@ -33,30 +25,6 @@ export type WebhookBenefitGrantRevokedPayload = { data: BenefitGrantWebhook; }; -/** @internal */ -export const WebhookBenefitGrantRevokedPayloadType$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - WebhookBenefitGrantRevokedPayloadType, - ); - -/** @internal */ -export const WebhookBenefitGrantRevokedPayloadType$outboundSchema: - z.ZodNativeEnum = - WebhookBenefitGrantRevokedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookBenefitGrantRevokedPayloadType$ { - /** @deprecated use `WebhookBenefitGrantRevokedPayloadType$inboundSchema` instead. */ - export const inboundSchema = - WebhookBenefitGrantRevokedPayloadType$inboundSchema; - /** @deprecated use `WebhookBenefitGrantRevokedPayloadType$outboundSchema` instead. */ - export const outboundSchema = - WebhookBenefitGrantRevokedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookBenefitGrantRevokedPayload$inboundSchema: z.ZodType< WebhookBenefitGrantRevokedPayload, @@ -79,7 +47,9 @@ export const WebhookBenefitGrantRevokedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookBenefitGrantRevokedPayload > = z.object({ - type: z.literal("benefit_grant.revoked").default("benefit_grant.revoked"), + type: z.literal("benefit_grant.revoked").default( + "benefit_grant.revoked" as const, + ), data: BenefitGrantWebhook$outboundSchema, }); diff --git a/src/models/components/webhookbenefitgrantupdatedpayload.ts b/src/models/components/webhookbenefitgrantupdatedpayload.ts index b3df19a9..a48d45e8 100644 --- a/src/models/components/webhookbenefitgrantupdatedpayload.ts +++ b/src/models/components/webhookbenefitgrantupdatedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { BenefitGrantWebhook$outboundSchema, } from "./benefitgrantwebhook.js"; -export const WebhookBenefitGrantUpdatedPayloadType = { - BenefitGrantUpdated: "benefit_grant.updated", -} as const; -export type WebhookBenefitGrantUpdatedPayloadType = ClosedEnum< - typeof WebhookBenefitGrantUpdatedPayloadType ->; - /** * Sent when a new benefit grant is updated. * @@ -33,30 +25,6 @@ export type WebhookBenefitGrantUpdatedPayload = { data: BenefitGrantWebhook; }; -/** @internal */ -export const WebhookBenefitGrantUpdatedPayloadType$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - WebhookBenefitGrantUpdatedPayloadType, - ); - -/** @internal */ -export const WebhookBenefitGrantUpdatedPayloadType$outboundSchema: - z.ZodNativeEnum = - WebhookBenefitGrantUpdatedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookBenefitGrantUpdatedPayloadType$ { - /** @deprecated use `WebhookBenefitGrantUpdatedPayloadType$inboundSchema` instead. */ - export const inboundSchema = - WebhookBenefitGrantUpdatedPayloadType$inboundSchema; - /** @deprecated use `WebhookBenefitGrantUpdatedPayloadType$outboundSchema` instead. */ - export const outboundSchema = - WebhookBenefitGrantUpdatedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookBenefitGrantUpdatedPayload$inboundSchema: z.ZodType< WebhookBenefitGrantUpdatedPayload, @@ -79,7 +47,9 @@ export const WebhookBenefitGrantUpdatedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookBenefitGrantUpdatedPayload > = z.object({ - type: z.literal("benefit_grant.updated").default("benefit_grant.updated"), + type: z.literal("benefit_grant.updated").default( + "benefit_grant.updated" as const, + ), data: BenefitGrantWebhook$outboundSchema, }); diff --git a/src/models/components/webhookbenefitupdatedpayload.ts b/src/models/components/webhookbenefitupdatedpayload.ts index f334a7ce..852fcce7 100644 --- a/src/models/components/webhookbenefitupdatedpayload.ts +++ b/src/models/components/webhookbenefitupdatedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Benefit$outboundSchema, } from "./benefit.js"; -export const WebhookBenefitUpdatedPayloadType = { - BenefitUpdated: "benefit.updated", -} as const; -export type WebhookBenefitUpdatedPayloadType = ClosedEnum< - typeof WebhookBenefitUpdatedPayloadType ->; - /** * Sent when a benefit is updated. * @@ -33,27 +25,6 @@ export type WebhookBenefitUpdatedPayload = { data: Benefit; }; -/** @internal */ -export const WebhookBenefitUpdatedPayloadType$inboundSchema: z.ZodNativeEnum< - typeof WebhookBenefitUpdatedPayloadType -> = z.nativeEnum(WebhookBenefitUpdatedPayloadType); - -/** @internal */ -export const WebhookBenefitUpdatedPayloadType$outboundSchema: z.ZodNativeEnum< - typeof WebhookBenefitUpdatedPayloadType -> = WebhookBenefitUpdatedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookBenefitUpdatedPayloadType$ { - /** @deprecated use `WebhookBenefitUpdatedPayloadType$inboundSchema` instead. */ - export const inboundSchema = WebhookBenefitUpdatedPayloadType$inboundSchema; - /** @deprecated use `WebhookBenefitUpdatedPayloadType$outboundSchema` instead. */ - export const outboundSchema = WebhookBenefitUpdatedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookBenefitUpdatedPayload$inboundSchema: z.ZodType< WebhookBenefitUpdatedPayload, @@ -76,7 +47,7 @@ export const WebhookBenefitUpdatedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookBenefitUpdatedPayload > = z.object({ - type: z.literal("benefit.updated").default("benefit.updated"), + type: z.literal("benefit.updated").default("benefit.updated" as const), data: Benefit$outboundSchema, }); diff --git a/src/models/components/webhookcheckoutcreatedpayload.ts b/src/models/components/webhookcheckoutcreatedpayload.ts index cb838f45..f972c3cb 100644 --- a/src/models/components/webhookcheckoutcreatedpayload.ts +++ b/src/models/components/webhookcheckoutcreatedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Checkout$outboundSchema, } from "./checkout.js"; -export const WebhookCheckoutCreatedPayloadType = { - CheckoutCreated: "checkout.created", -} as const; -export type WebhookCheckoutCreatedPayloadType = ClosedEnum< - typeof WebhookCheckoutCreatedPayloadType ->; - /** * Sent when a new checkout is created. * @@ -36,28 +28,6 @@ export type WebhookCheckoutCreatedPayload = { data: Checkout; }; -/** @internal */ -export const WebhookCheckoutCreatedPayloadType$inboundSchema: z.ZodNativeEnum< - typeof WebhookCheckoutCreatedPayloadType -> = z.nativeEnum(WebhookCheckoutCreatedPayloadType); - -/** @internal */ -export const WebhookCheckoutCreatedPayloadType$outboundSchema: z.ZodNativeEnum< - typeof WebhookCheckoutCreatedPayloadType -> = WebhookCheckoutCreatedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookCheckoutCreatedPayloadType$ { - /** @deprecated use `WebhookCheckoutCreatedPayloadType$inboundSchema` instead. */ - export const inboundSchema = WebhookCheckoutCreatedPayloadType$inboundSchema; - /** @deprecated use `WebhookCheckoutCreatedPayloadType$outboundSchema` instead. */ - export const outboundSchema = - WebhookCheckoutCreatedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookCheckoutCreatedPayload$inboundSchema: z.ZodType< WebhookCheckoutCreatedPayload, @@ -80,7 +50,7 @@ export const WebhookCheckoutCreatedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookCheckoutCreatedPayload > = z.object({ - type: z.literal("checkout.created").default("checkout.created"), + type: z.literal("checkout.created").default("checkout.created" as const), data: Checkout$outboundSchema, }); diff --git a/src/models/components/webhookcheckoutupdatedpayload.ts b/src/models/components/webhookcheckoutupdatedpayload.ts index 2b26abf6..813697fb 100644 --- a/src/models/components/webhookcheckoutupdatedpayload.ts +++ b/src/models/components/webhookcheckoutupdatedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Checkout$outboundSchema, } from "./checkout.js"; -export const WebhookCheckoutUpdatedPayloadType = { - CheckoutUpdated: "checkout.updated", -} as const; -export type WebhookCheckoutUpdatedPayloadType = ClosedEnum< - typeof WebhookCheckoutUpdatedPayloadType ->; - /** * Sent when a checkout is updated. * @@ -36,28 +28,6 @@ export type WebhookCheckoutUpdatedPayload = { data: Checkout; }; -/** @internal */ -export const WebhookCheckoutUpdatedPayloadType$inboundSchema: z.ZodNativeEnum< - typeof WebhookCheckoutUpdatedPayloadType -> = z.nativeEnum(WebhookCheckoutUpdatedPayloadType); - -/** @internal */ -export const WebhookCheckoutUpdatedPayloadType$outboundSchema: z.ZodNativeEnum< - typeof WebhookCheckoutUpdatedPayloadType -> = WebhookCheckoutUpdatedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookCheckoutUpdatedPayloadType$ { - /** @deprecated use `WebhookCheckoutUpdatedPayloadType$inboundSchema` instead. */ - export const inboundSchema = WebhookCheckoutUpdatedPayloadType$inboundSchema; - /** @deprecated use `WebhookCheckoutUpdatedPayloadType$outboundSchema` instead. */ - export const outboundSchema = - WebhookCheckoutUpdatedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookCheckoutUpdatedPayload$inboundSchema: z.ZodType< WebhookCheckoutUpdatedPayload, @@ -80,7 +50,7 @@ export const WebhookCheckoutUpdatedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookCheckoutUpdatedPayload > = z.object({ - type: z.literal("checkout.updated").default("checkout.updated"), + type: z.literal("checkout.updated").default("checkout.updated" as const), data: Checkout$outboundSchema, }); diff --git a/src/models/components/webhookordercreatedpayload.ts b/src/models/components/webhookordercreatedpayload.ts index 2273d229..af6dab2e 100644 --- a/src/models/components/webhookordercreatedpayload.ts +++ b/src/models/components/webhookordercreatedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Order$outboundSchema, } from "./order.js"; -export const WebhookOrderCreatedPayloadType = { - OrderCreated: "order.created", -} as const; -export type WebhookOrderCreatedPayloadType = ClosedEnum< - typeof WebhookOrderCreatedPayloadType ->; - /** * Sent when a new order is created. * @@ -33,27 +25,6 @@ export type WebhookOrderCreatedPayload = { data: Order; }; -/** @internal */ -export const WebhookOrderCreatedPayloadType$inboundSchema: z.ZodNativeEnum< - typeof WebhookOrderCreatedPayloadType -> = z.nativeEnum(WebhookOrderCreatedPayloadType); - -/** @internal */ -export const WebhookOrderCreatedPayloadType$outboundSchema: z.ZodNativeEnum< - typeof WebhookOrderCreatedPayloadType -> = WebhookOrderCreatedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookOrderCreatedPayloadType$ { - /** @deprecated use `WebhookOrderCreatedPayloadType$inboundSchema` instead. */ - export const inboundSchema = WebhookOrderCreatedPayloadType$inboundSchema; - /** @deprecated use `WebhookOrderCreatedPayloadType$outboundSchema` instead. */ - export const outboundSchema = WebhookOrderCreatedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookOrderCreatedPayload$inboundSchema: z.ZodType< WebhookOrderCreatedPayload, @@ -76,7 +47,7 @@ export const WebhookOrderCreatedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookOrderCreatedPayload > = z.object({ - type: z.literal("order.created").default("order.created"), + type: z.literal("order.created").default("order.created" as const), data: Order$outboundSchema, }); diff --git a/src/models/components/webhookorganizationupdatedpayload.ts b/src/models/components/webhookorganizationupdatedpayload.ts index de2addfc..91bba216 100644 --- a/src/models/components/webhookorganizationupdatedpayload.ts +++ b/src/models/components/webhookorganizationupdatedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Organization$outboundSchema, } from "./organization.js"; -export const WebhookOrganizationUpdatedPayloadType = { - OrganizationUpdated: "organization.updated", -} as const; -export type WebhookOrganizationUpdatedPayloadType = ClosedEnum< - typeof WebhookOrganizationUpdatedPayloadType ->; - /** * Sent when a organization is updated. * @@ -33,30 +25,6 @@ export type WebhookOrganizationUpdatedPayload = { data: Organization; }; -/** @internal */ -export const WebhookOrganizationUpdatedPayloadType$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - WebhookOrganizationUpdatedPayloadType, - ); - -/** @internal */ -export const WebhookOrganizationUpdatedPayloadType$outboundSchema: - z.ZodNativeEnum = - WebhookOrganizationUpdatedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookOrganizationUpdatedPayloadType$ { - /** @deprecated use `WebhookOrganizationUpdatedPayloadType$inboundSchema` instead. */ - export const inboundSchema = - WebhookOrganizationUpdatedPayloadType$inboundSchema; - /** @deprecated use `WebhookOrganizationUpdatedPayloadType$outboundSchema` instead. */ - export const outboundSchema = - WebhookOrganizationUpdatedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookOrganizationUpdatedPayload$inboundSchema: z.ZodType< WebhookOrganizationUpdatedPayload, @@ -79,7 +47,9 @@ export const WebhookOrganizationUpdatedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookOrganizationUpdatedPayload > = z.object({ - type: z.literal("organization.updated").default("organization.updated"), + type: z.literal("organization.updated").default( + "organization.updated" as const, + ), data: Organization$outboundSchema, }); diff --git a/src/models/components/webhookpledgecreatedpayload.ts b/src/models/components/webhookpledgecreatedpayload.ts index 3b8d4bef..3e719321 100644 --- a/src/models/components/webhookpledgecreatedpayload.ts +++ b/src/models/components/webhookpledgecreatedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Pledge$outboundSchema, } from "./pledge.js"; -export const WebhookPledgeCreatedPayloadType = { - PledgeCreated: "pledge.created", -} as const; -export type WebhookPledgeCreatedPayloadType = ClosedEnum< - typeof WebhookPledgeCreatedPayloadType ->; - /** * Sent when a new pledge is created. Note that this does mean that the pledge has been paid yet. * @@ -33,27 +25,6 @@ export type WebhookPledgeCreatedPayload = { data: Pledge; }; -/** @internal */ -export const WebhookPledgeCreatedPayloadType$inboundSchema: z.ZodNativeEnum< - typeof WebhookPledgeCreatedPayloadType -> = z.nativeEnum(WebhookPledgeCreatedPayloadType); - -/** @internal */ -export const WebhookPledgeCreatedPayloadType$outboundSchema: z.ZodNativeEnum< - typeof WebhookPledgeCreatedPayloadType -> = WebhookPledgeCreatedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookPledgeCreatedPayloadType$ { - /** @deprecated use `WebhookPledgeCreatedPayloadType$inboundSchema` instead. */ - export const inboundSchema = WebhookPledgeCreatedPayloadType$inboundSchema; - /** @deprecated use `WebhookPledgeCreatedPayloadType$outboundSchema` instead. */ - export const outboundSchema = WebhookPledgeCreatedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookPledgeCreatedPayload$inboundSchema: z.ZodType< WebhookPledgeCreatedPayload, @@ -76,7 +47,7 @@ export const WebhookPledgeCreatedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookPledgeCreatedPayload > = z.object({ - type: z.literal("pledge.created").default("pledge.created"), + type: z.literal("pledge.created").default("pledge.created" as const), data: Pledge$outboundSchema, }); diff --git a/src/models/components/webhookpledgeupdatedpayload.ts b/src/models/components/webhookpledgeupdatedpayload.ts index c33f6147..667fce99 100644 --- a/src/models/components/webhookpledgeupdatedpayload.ts +++ b/src/models/components/webhookpledgeupdatedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Pledge$outboundSchema, } from "./pledge.js"; -export const WebhookPledgeUpdatedPayloadType = { - PledgeUpdated: "pledge.updated", -} as const; -export type WebhookPledgeUpdatedPayloadType = ClosedEnum< - typeof WebhookPledgeUpdatedPayloadType ->; - /** * Sent when a pledge is updated. * @@ -33,27 +25,6 @@ export type WebhookPledgeUpdatedPayload = { data: Pledge; }; -/** @internal */ -export const WebhookPledgeUpdatedPayloadType$inboundSchema: z.ZodNativeEnum< - typeof WebhookPledgeUpdatedPayloadType -> = z.nativeEnum(WebhookPledgeUpdatedPayloadType); - -/** @internal */ -export const WebhookPledgeUpdatedPayloadType$outboundSchema: z.ZodNativeEnum< - typeof WebhookPledgeUpdatedPayloadType -> = WebhookPledgeUpdatedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookPledgeUpdatedPayloadType$ { - /** @deprecated use `WebhookPledgeUpdatedPayloadType$inboundSchema` instead. */ - export const inboundSchema = WebhookPledgeUpdatedPayloadType$inboundSchema; - /** @deprecated use `WebhookPledgeUpdatedPayloadType$outboundSchema` instead. */ - export const outboundSchema = WebhookPledgeUpdatedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookPledgeUpdatedPayload$inboundSchema: z.ZodType< WebhookPledgeUpdatedPayload, @@ -76,7 +47,7 @@ export const WebhookPledgeUpdatedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookPledgeUpdatedPayload > = z.object({ - type: z.literal("pledge.updated").default("pledge.updated"), + type: z.literal("pledge.updated").default("pledge.updated" as const), data: Pledge$outboundSchema, }); diff --git a/src/models/components/webhookproductcreatedpayload.ts b/src/models/components/webhookproductcreatedpayload.ts index b7cb801c..350b4572 100644 --- a/src/models/components/webhookproductcreatedpayload.ts +++ b/src/models/components/webhookproductcreatedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Product$outboundSchema, } from "./product.js"; -export const WebhookProductCreatedPayloadType = { - ProductCreated: "product.created", -} as const; -export type WebhookProductCreatedPayloadType = ClosedEnum< - typeof WebhookProductCreatedPayloadType ->; - /** * Sent when a new product is created. * @@ -36,27 +28,6 @@ export type WebhookProductCreatedPayload = { data: Product; }; -/** @internal */ -export const WebhookProductCreatedPayloadType$inboundSchema: z.ZodNativeEnum< - typeof WebhookProductCreatedPayloadType -> = z.nativeEnum(WebhookProductCreatedPayloadType); - -/** @internal */ -export const WebhookProductCreatedPayloadType$outboundSchema: z.ZodNativeEnum< - typeof WebhookProductCreatedPayloadType -> = WebhookProductCreatedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookProductCreatedPayloadType$ { - /** @deprecated use `WebhookProductCreatedPayloadType$inboundSchema` instead. */ - export const inboundSchema = WebhookProductCreatedPayloadType$inboundSchema; - /** @deprecated use `WebhookProductCreatedPayloadType$outboundSchema` instead. */ - export const outboundSchema = WebhookProductCreatedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookProductCreatedPayload$inboundSchema: z.ZodType< WebhookProductCreatedPayload, @@ -79,7 +50,7 @@ export const WebhookProductCreatedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookProductCreatedPayload > = z.object({ - type: z.literal("product.created").default("product.created"), + type: z.literal("product.created").default("product.created" as const), data: Product$outboundSchema, }); diff --git a/src/models/components/webhookproductupdatedpayload.ts b/src/models/components/webhookproductupdatedpayload.ts index 2a9c6dc0..968c024a 100644 --- a/src/models/components/webhookproductupdatedpayload.ts +++ b/src/models/components/webhookproductupdatedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Product$outboundSchema, } from "./product.js"; -export const WebhookProductUpdatedPayloadType = { - ProductUpdated: "product.updated", -} as const; -export type WebhookProductUpdatedPayloadType = ClosedEnum< - typeof WebhookProductUpdatedPayloadType ->; - /** * Sent when a product is updated. * @@ -36,27 +28,6 @@ export type WebhookProductUpdatedPayload = { data: Product; }; -/** @internal */ -export const WebhookProductUpdatedPayloadType$inboundSchema: z.ZodNativeEnum< - typeof WebhookProductUpdatedPayloadType -> = z.nativeEnum(WebhookProductUpdatedPayloadType); - -/** @internal */ -export const WebhookProductUpdatedPayloadType$outboundSchema: z.ZodNativeEnum< - typeof WebhookProductUpdatedPayloadType -> = WebhookProductUpdatedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookProductUpdatedPayloadType$ { - /** @deprecated use `WebhookProductUpdatedPayloadType$inboundSchema` instead. */ - export const inboundSchema = WebhookProductUpdatedPayloadType$inboundSchema; - /** @deprecated use `WebhookProductUpdatedPayloadType$outboundSchema` instead. */ - export const outboundSchema = WebhookProductUpdatedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookProductUpdatedPayload$inboundSchema: z.ZodType< WebhookProductUpdatedPayload, @@ -79,7 +50,7 @@ export const WebhookProductUpdatedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookProductUpdatedPayload > = z.object({ - type: z.literal("product.updated").default("product.updated"), + type: z.literal("product.updated").default("product.updated" as const), data: Product$outboundSchema, }); diff --git a/src/models/components/webhooksubscriptionactivepayload.ts b/src/models/components/webhooksubscriptionactivepayload.ts index c138e120..c375a1e5 100644 --- a/src/models/components/webhooksubscriptionactivepayload.ts +++ b/src/models/components/webhooksubscriptionactivepayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Subscription$outboundSchema, } from "./subscription.js"; -export const WebhookSubscriptionActivePayloadType = { - SubscriptionActive: "subscription.active", -} as const; -export type WebhookSubscriptionActivePayloadType = ClosedEnum< - typeof WebhookSubscriptionActivePayloadType ->; - /** * Sent when a subscription becomes active, * @@ -34,30 +26,6 @@ export type WebhookSubscriptionActivePayload = { data: Subscription; }; -/** @internal */ -export const WebhookSubscriptionActivePayloadType$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - WebhookSubscriptionActivePayloadType, - ); - -/** @internal */ -export const WebhookSubscriptionActivePayloadType$outboundSchema: - z.ZodNativeEnum = - WebhookSubscriptionActivePayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookSubscriptionActivePayloadType$ { - /** @deprecated use `WebhookSubscriptionActivePayloadType$inboundSchema` instead. */ - export const inboundSchema = - WebhookSubscriptionActivePayloadType$inboundSchema; - /** @deprecated use `WebhookSubscriptionActivePayloadType$outboundSchema` instead. */ - export const outboundSchema = - WebhookSubscriptionActivePayloadType$outboundSchema; -} - /** @internal */ export const WebhookSubscriptionActivePayload$inboundSchema: z.ZodType< WebhookSubscriptionActivePayload, @@ -80,7 +48,9 @@ export const WebhookSubscriptionActivePayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookSubscriptionActivePayload > = z.object({ - type: z.literal("subscription.active").default("subscription.active"), + type: z.literal("subscription.active").default( + "subscription.active" as const, + ), data: Subscription$outboundSchema, }); diff --git a/src/models/components/webhooksubscriptioncanceledpayload.ts b/src/models/components/webhooksubscriptioncanceledpayload.ts index 1645891f..cd06ae31 100644 --- a/src/models/components/webhooksubscriptioncanceledpayload.ts +++ b/src/models/components/webhooksubscriptioncanceledpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Subscription$outboundSchema, } from "./subscription.js"; -export const WebhookSubscriptionCanceledPayloadType = { - SubscriptionCanceled: "subscription.canceled", -} as const; -export type WebhookSubscriptionCanceledPayloadType = ClosedEnum< - typeof WebhookSubscriptionCanceledPayloadType ->; - /** * Sent when a subscription is canceled by the user. * @@ -34,30 +26,6 @@ export type WebhookSubscriptionCanceledPayload = { data: Subscription; }; -/** @internal */ -export const WebhookSubscriptionCanceledPayloadType$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - WebhookSubscriptionCanceledPayloadType, - ); - -/** @internal */ -export const WebhookSubscriptionCanceledPayloadType$outboundSchema: - z.ZodNativeEnum = - WebhookSubscriptionCanceledPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookSubscriptionCanceledPayloadType$ { - /** @deprecated use `WebhookSubscriptionCanceledPayloadType$inboundSchema` instead. */ - export const inboundSchema = - WebhookSubscriptionCanceledPayloadType$inboundSchema; - /** @deprecated use `WebhookSubscriptionCanceledPayloadType$outboundSchema` instead. */ - export const outboundSchema = - WebhookSubscriptionCanceledPayloadType$outboundSchema; -} - /** @internal */ export const WebhookSubscriptionCanceledPayload$inboundSchema: z.ZodType< WebhookSubscriptionCanceledPayload, @@ -80,7 +48,9 @@ export const WebhookSubscriptionCanceledPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookSubscriptionCanceledPayload > = z.object({ - type: z.literal("subscription.canceled").default("subscription.canceled"), + type: z.literal("subscription.canceled").default( + "subscription.canceled" as const, + ), data: Subscription$outboundSchema, }); diff --git a/src/models/components/webhooksubscriptioncreatedpayload.ts b/src/models/components/webhooksubscriptioncreatedpayload.ts index 153cdcaa..d4086b22 100644 --- a/src/models/components/webhooksubscriptioncreatedpayload.ts +++ b/src/models/components/webhooksubscriptioncreatedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Subscription$outboundSchema, } from "./subscription.js"; -export const WebhookSubscriptionCreatedPayloadType = { - SubscriptionCreated: "subscription.created", -} as const; -export type WebhookSubscriptionCreatedPayloadType = ClosedEnum< - typeof WebhookSubscriptionCreatedPayloadType ->; - /** * Sent when a new subscription is created. * @@ -33,30 +25,6 @@ export type WebhookSubscriptionCreatedPayload = { data: Subscription; }; -/** @internal */ -export const WebhookSubscriptionCreatedPayloadType$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - WebhookSubscriptionCreatedPayloadType, - ); - -/** @internal */ -export const WebhookSubscriptionCreatedPayloadType$outboundSchema: - z.ZodNativeEnum = - WebhookSubscriptionCreatedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookSubscriptionCreatedPayloadType$ { - /** @deprecated use `WebhookSubscriptionCreatedPayloadType$inboundSchema` instead. */ - export const inboundSchema = - WebhookSubscriptionCreatedPayloadType$inboundSchema; - /** @deprecated use `WebhookSubscriptionCreatedPayloadType$outboundSchema` instead. */ - export const outboundSchema = - WebhookSubscriptionCreatedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookSubscriptionCreatedPayload$inboundSchema: z.ZodType< WebhookSubscriptionCreatedPayload, @@ -79,7 +47,9 @@ export const WebhookSubscriptionCreatedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookSubscriptionCreatedPayload > = z.object({ - type: z.literal("subscription.created").default("subscription.created"), + type: z.literal("subscription.created").default( + "subscription.created" as const, + ), data: Subscription$outboundSchema, }); diff --git a/src/models/components/webhooksubscriptionrevokedpayload.ts b/src/models/components/webhooksubscriptionrevokedpayload.ts index ab9cda05..0d88bc4b 100644 --- a/src/models/components/webhooksubscriptionrevokedpayload.ts +++ b/src/models/components/webhooksubscriptionrevokedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Subscription$outboundSchema, } from "./subscription.js"; -export const WebhookSubscriptionRevokedPayloadType = { - SubscriptionRevoked: "subscription.revoked", -} as const; -export type WebhookSubscriptionRevokedPayloadType = ClosedEnum< - typeof WebhookSubscriptionRevokedPayloadType ->; - /** * Sent when a subscription is revoked, the user looses access immediately. * @@ -34,30 +26,6 @@ export type WebhookSubscriptionRevokedPayload = { data: Subscription; }; -/** @internal */ -export const WebhookSubscriptionRevokedPayloadType$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - WebhookSubscriptionRevokedPayloadType, - ); - -/** @internal */ -export const WebhookSubscriptionRevokedPayloadType$outboundSchema: - z.ZodNativeEnum = - WebhookSubscriptionRevokedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookSubscriptionRevokedPayloadType$ { - /** @deprecated use `WebhookSubscriptionRevokedPayloadType$inboundSchema` instead. */ - export const inboundSchema = - WebhookSubscriptionRevokedPayloadType$inboundSchema; - /** @deprecated use `WebhookSubscriptionRevokedPayloadType$outboundSchema` instead. */ - export const outboundSchema = - WebhookSubscriptionRevokedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookSubscriptionRevokedPayload$inboundSchema: z.ZodType< WebhookSubscriptionRevokedPayload, @@ -80,7 +48,9 @@ export const WebhookSubscriptionRevokedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookSubscriptionRevokedPayload > = z.object({ - type: z.literal("subscription.revoked").default("subscription.revoked"), + type: z.literal("subscription.revoked").default( + "subscription.revoked" as const, + ), data: Subscription$outboundSchema, }); diff --git a/src/models/components/webhooksubscriptionupdatedpayload.ts b/src/models/components/webhooksubscriptionupdatedpayload.ts index 04dbe19e..46cee753 100644 --- a/src/models/components/webhooksubscriptionupdatedpayload.ts +++ b/src/models/components/webhooksubscriptionupdatedpayload.ts @@ -4,7 +4,6 @@ import * as z from "zod"; import { safeParse } from "../../lib/schemas.js"; -import { ClosedEnum } from "../../types/enums.js"; import { Result as SafeParseResult } from "../../types/fp.js"; import { SDKValidationError } from "../errors/sdkvalidationerror.js"; import { @@ -14,13 +13,6 @@ import { Subscription$outboundSchema, } from "./subscription.js"; -export const WebhookSubscriptionUpdatedPayloadType = { - SubscriptionUpdated: "subscription.updated", -} as const; -export type WebhookSubscriptionUpdatedPayloadType = ClosedEnum< - typeof WebhookSubscriptionUpdatedPayloadType ->; - /** * Sent when a subscription is updated. This event fires for all changes to the subscription, including renewals. * @@ -37,30 +29,6 @@ export type WebhookSubscriptionUpdatedPayload = { data: Subscription; }; -/** @internal */ -export const WebhookSubscriptionUpdatedPayloadType$inboundSchema: - z.ZodNativeEnum = z.nativeEnum( - WebhookSubscriptionUpdatedPayloadType, - ); - -/** @internal */ -export const WebhookSubscriptionUpdatedPayloadType$outboundSchema: - z.ZodNativeEnum = - WebhookSubscriptionUpdatedPayloadType$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace WebhookSubscriptionUpdatedPayloadType$ { - /** @deprecated use `WebhookSubscriptionUpdatedPayloadType$inboundSchema` instead. */ - export const inboundSchema = - WebhookSubscriptionUpdatedPayloadType$inboundSchema; - /** @deprecated use `WebhookSubscriptionUpdatedPayloadType$outboundSchema` instead. */ - export const outboundSchema = - WebhookSubscriptionUpdatedPayloadType$outboundSchema; -} - /** @internal */ export const WebhookSubscriptionUpdatedPayload$inboundSchema: z.ZodType< WebhookSubscriptionUpdatedPayload, @@ -83,7 +51,9 @@ export const WebhookSubscriptionUpdatedPayload$outboundSchema: z.ZodType< z.ZodTypeDef, WebhookSubscriptionUpdatedPayload > = z.object({ - type: z.literal("subscription.updated").default("subscription.updated"), + type: z.literal("subscription.updated").default( + "subscription.updated" as const, + ), data: Subscription$outboundSchema, }); diff --git a/src/models/errors/alreadycanceledsubscription.ts b/src/models/errors/alreadycanceledsubscription.ts index 3dffc612..7f437b1b 100644 --- a/src/models/errors/alreadycanceledsubscription.ts +++ b/src/models/errors/alreadycanceledsubscription.ts @@ -3,14 +3,6 @@ */ import * as z from "zod"; -import { ClosedEnum } from "../../types/enums.js"; - -export const AlreadyCanceledSubscriptionError = { - AlreadyCanceledSubscription: "AlreadyCanceledSubscription", -} as const; -export type AlreadyCanceledSubscriptionError = ClosedEnum< - typeof AlreadyCanceledSubscriptionError ->; export type AlreadyCanceledSubscriptionData = { error: "AlreadyCanceledSubscription"; @@ -38,27 +30,6 @@ export class AlreadyCanceledSubscription extends Error { } } -/** @internal */ -export const AlreadyCanceledSubscriptionError$inboundSchema: z.ZodNativeEnum< - typeof AlreadyCanceledSubscriptionError -> = z.nativeEnum(AlreadyCanceledSubscriptionError); - -/** @internal */ -export const AlreadyCanceledSubscriptionError$outboundSchema: z.ZodNativeEnum< - typeof AlreadyCanceledSubscriptionError -> = AlreadyCanceledSubscriptionError$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace AlreadyCanceledSubscriptionError$ { - /** @deprecated use `AlreadyCanceledSubscriptionError$inboundSchema` instead. */ - export const inboundSchema = AlreadyCanceledSubscriptionError$inboundSchema; - /** @deprecated use `AlreadyCanceledSubscriptionError$outboundSchema` instead. */ - export const outboundSchema = AlreadyCanceledSubscriptionError$outboundSchema; -} - /** @internal */ export const AlreadyCanceledSubscription$inboundSchema: z.ZodType< AlreadyCanceledSubscription, @@ -87,7 +58,7 @@ export const AlreadyCanceledSubscription$outboundSchema: z.ZodType< .transform(v => v.data$) .pipe(z.object({ error: z.literal("AlreadyCanceledSubscription").default( - "AlreadyCanceledSubscription", + "AlreadyCanceledSubscription" as const, ), detail: z.string(), })); diff --git a/src/models/errors/notpermitted.ts b/src/models/errors/notpermitted.ts index 25dc9ffd..418e8d02 100644 --- a/src/models/errors/notpermitted.ts +++ b/src/models/errors/notpermitted.ts @@ -3,12 +3,6 @@ */ import * as z from "zod"; -import { ClosedEnum } from "../../types/enums.js"; - -export const NotPermittedError = { - NotPermitted: "NotPermitted", -} as const; -export type NotPermittedError = ClosedEnum; export type NotPermittedData = { error: "NotPermitted"; @@ -36,27 +30,6 @@ export class NotPermitted extends Error { } } -/** @internal */ -export const NotPermittedError$inboundSchema: z.ZodNativeEnum< - typeof NotPermittedError -> = z.nativeEnum(NotPermittedError); - -/** @internal */ -export const NotPermittedError$outboundSchema: z.ZodNativeEnum< - typeof NotPermittedError -> = NotPermittedError$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace NotPermittedError$ { - /** @deprecated use `NotPermittedError$inboundSchema` instead. */ - export const inboundSchema = NotPermittedError$inboundSchema; - /** @deprecated use `NotPermittedError$outboundSchema` instead. */ - export const outboundSchema = NotPermittedError$outboundSchema; -} - /** @internal */ export const NotPermitted$inboundSchema: z.ZodType< NotPermitted, @@ -84,7 +57,7 @@ export const NotPermitted$outboundSchema: z.ZodType< > = z.instanceof(NotPermitted) .transform(v => v.data$) .pipe(z.object({ - error: z.literal("NotPermitted").default("NotPermitted"), + error: z.literal("NotPermitted").default("NotPermitted" as const), detail: z.string(), })); diff --git a/src/models/errors/resourcenotfound.ts b/src/models/errors/resourcenotfound.ts index b82c5155..1ad11958 100644 --- a/src/models/errors/resourcenotfound.ts +++ b/src/models/errors/resourcenotfound.ts @@ -3,12 +3,6 @@ */ import * as z from "zod"; -import { ClosedEnum } from "../../types/enums.js"; - -export const ErrorT = { - ResourceNotFound: "ResourceNotFound", -} as const; -export type ErrorT = ClosedEnum; export type ResourceNotFoundData = { error: "ResourceNotFound"; @@ -36,25 +30,6 @@ export class ResourceNotFound extends Error { } } -/** @internal */ -export const ErrorT$inboundSchema: z.ZodNativeEnum = z - .nativeEnum(ErrorT); - -/** @internal */ -export const ErrorT$outboundSchema: z.ZodNativeEnum = - ErrorT$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace ErrorT$ { - /** @deprecated use `ErrorT$inboundSchema` instead. */ - export const inboundSchema = ErrorT$inboundSchema; - /** @deprecated use `ErrorT$outboundSchema` instead. */ - export const outboundSchema = ErrorT$outboundSchema; -} - /** @internal */ export const ResourceNotFound$inboundSchema: z.ZodType< ResourceNotFound, @@ -82,7 +57,7 @@ export const ResourceNotFound$outboundSchema: z.ZodType< > = z.instanceof(ResourceNotFound) .transform(v => v.data$) .pipe(z.object({ - error: z.literal("ResourceNotFound").default("ResourceNotFound"), + error: z.literal("ResourceNotFound").default("ResourceNotFound" as const), detail: z.string(), })); diff --git a/src/models/errors/unauthorized.ts b/src/models/errors/unauthorized.ts index 57e1c73a..dd96ef31 100644 --- a/src/models/errors/unauthorized.ts +++ b/src/models/errors/unauthorized.ts @@ -3,12 +3,6 @@ */ import * as z from "zod"; -import { ClosedEnum } from "../../types/enums.js"; - -export const UnauthorizedError = { - Unauthorized: "Unauthorized", -} as const; -export type UnauthorizedError = ClosedEnum; export type UnauthorizedData = { error: "Unauthorized"; @@ -36,27 +30,6 @@ export class Unauthorized extends Error { } } -/** @internal */ -export const UnauthorizedError$inboundSchema: z.ZodNativeEnum< - typeof UnauthorizedError -> = z.nativeEnum(UnauthorizedError); - -/** @internal */ -export const UnauthorizedError$outboundSchema: z.ZodNativeEnum< - typeof UnauthorizedError -> = UnauthorizedError$inboundSchema; - -/** - * @internal - * @deprecated This namespace will be removed in future versions. Use schemas and types that are exported directly from this module. - */ -export namespace UnauthorizedError$ { - /** @deprecated use `UnauthorizedError$inboundSchema` instead. */ - export const inboundSchema = UnauthorizedError$inboundSchema; - /** @deprecated use `UnauthorizedError$outboundSchema` instead. */ - export const outboundSchema = UnauthorizedError$outboundSchema; -} - /** @internal */ export const Unauthorized$inboundSchema: z.ZodType< Unauthorized, @@ -84,7 +57,7 @@ export const Unauthorized$outboundSchema: z.ZodType< > = z.instanceof(Unauthorized) .transform(v => v.data$) .pipe(z.object({ - error: z.literal("Unauthorized").default("Unauthorized"), + error: z.literal("Unauthorized").default("Unauthorized" as const), detail: z.string(), })); diff --git a/tsconfig.json b/tsconfig.json index f9d286a7..94d81a34 100644 --- a/tsconfig.json +++ b/tsconfig.json @@ -2,7 +2,7 @@ "compilerOptions": { "incremental": true, "tsBuildInfoFile": ".tsbuildinfo", - "target": "ES2018", + "target": "ES2020", "lib": ["ES2022", "DOM", "DOM.Iterable"], "jsx": "react-jsx",